id; edge_media_to_comment; comments_disabled; taken_at_timestamp; edge_media_to_caption
2231709603930204748; 0; False; 1580260538; #Repost @fisiomonicaferreira • • • • • • Fisioterapiaresp#fisiorespiratoria #fisioterapiaguarulhos #coronavirus #reabilitacaopulmonar #fisiomonicaferreira
2231709600885163146; 0; False; 1580260537; #coronavirus - signs are up
2231709576701214218; 0; False; 1580260534; Menakutkan :expressionless_face: . #wuhan #wuhanvirus #coronavirus
2231709572993567563; 0; False; 1580260534; #turkey #türkiye #corona #korona #virüs #coronavirüs #sondakika #istanbul #bursa #izmir #ankara #hasta #hastalık #virus #coronavirus #haber #haberler #sondakikahaberler #çin #china #wuhan #güncel #güncelhaber #güncelhaberler #coronaviruses #coronaviruese #new #news #sondakikahaberleri
2231709568748339188; 0; False; 1580260533; Amen :folded_hands_medium-light_skin_tone::red_heart::raising_hands: #Amen #Jesus #Church #Godisgood #blessed #Bible #Church #Christian #gym #coffee #sports #love #igdaily #reading #books #God #jesussaves #forgiven935 #jesuschrist #fishing #nba #coronavirus #war #saved
2231709494147492372; 0; False; 1580260525; It’s not a joke . Share guys and stay safe #coronavirus
2231709391513852893; 0; False; 1580260512; Amen :folded_hands_medium-light_skin_tone::red_heart::raising_hands: #Amen #Jesus #Church #Godisgood #blessed #Bible #Church #Christian #gym #coffee #sports #love #igdaily #reading #books #God #jesussaves #forgiven935 #jesuschrist #fishing #nba #coronavirus #war #saved
2231709371675330821; 0; False; 1580260510; [ Info untuk Kome ] . Perlukah barang yang saya terima dari negara China melalui proses 'sanitizing' selepas terjadinya wabak Novel Coronavirus? . Adalah perlu sebagai langkah pencegahan penularan virus tersebut. . Sumber: Kementerian Kesihatan Malaysia . #coronavirus #JabatanPenerangan #SayangiMalaysiaku #PeneranganPerak #perakdihatikome #perakkitapunya
2231707469809510135; 1; False; 1580260510; Villages are sealing themselves off in China, blocking roads and building walls to protect against outsiders with #coronavirus. There are official and unofficial checkpoints, a dystopian vision. #Wuhan keep going. #china @solidarity.cyber.action @solidarity.cyber.action @solidarity.cyber.action
2231709355409866106; 0; False; 1580260508; Yooo it's the end times Follow @shacomain69 #meme #memepage #follow #promo #youtube #lol #meme #nhentai #dm #cat #catmeme #earth #earthmeme #earthpod #2020 #coronavirus #endoftheworld
2231709327532611514; 0; False; 1580260505; "Roadshow Infectious Disease Preparedness" oleh HUMS 28 Januari 2020. PPIB telah menerima kunjungan daripada pasukan Hospital UMS, dan telah diberi taklimat untuk mengelakkan jangkitan coronavirus. Taklimat tersebut telah disampaikan oleh: - Dr. Shazia Qaiser, Pegawai Perubatan Poliklinik UMS - Prof Madya Dr. Syed Sharizman Syed Abdul Rahim, Pensyarah Fakulti Perubatan & Sains Kesihatan UMS - Prof Dr. Khamisah Awang Lukman, Pengarah Pusat Keselamatan dan Kesihatan Pekerjaan UMS - Dr Muhammad Syafiq Bin Abdullah, Ketua Pusat Kesihatan Universiti UMS #healthylife #coronaVirus #HUMSRoadshow #ppibbaini #ppib #umsbaini #ums25tahun #MenginsankanManusia #bertekadcemerlang
2231709306671523178; 0; False; 1580260502; #Repost @fisiomonicaferreira • • • • • • Fisioterapiaresp#fisiorespiratoria #fisioterapiaguarulhos #coronavirus #reabilitacaopulmonar #fisiomonicaferreira
2231709273771822305; 0; False; 1580260498; #coronavirus
2231708916214081045; 0; False; 1580260494; - “There’s been a long queue of health sector workers in Mong Kok all evening, waiting to register for the new HA Employees Alliance trade union.⁣ ⁣ The queue is reaching its cut-off for today but will resume tomorrow.”⁣ ⁣ The union is protesting against the Hong Kong government’s approach to handling the coronavirus.⁣ ⁣ #WuhanSARS #WuhanOutbreak #CCPChina #chinazi #SARS2020 #武漢肺炎 #武汉疫情 #ChinaVirus #CoronavirusOutbreak at #Wuhan #china #武漢疫情 #冠狀病毒 #武漢肺炎 #新型肺炎 #新型コロナウィルス #武漢 #武漢市新型冠狀病毒肺炎 #武漢市 #chinanews #becausechina #faceofchina #massmigration #springfestival #coronavirus #WuhanCoronavirus #WuhanPneumonia #wuhanvirus
2231709199203785096; 0; False; 1580260489; It seems like it's one thing after another. These events are a test of how us humans can collectively come together to do better no matter how unsettling the situation is. Check out the article we linked below. Please consider donating to help out with a cause that will help countless lives. Donations can be made to the following addresses located in our bio. Thank you! https://www.google.com/amp/s/7bitcoins.com/crypto-firms-donating-to-help-coronavirus-victims/amp/ #cryptocurrency #bitcoin #crypto #blockchain #btc #ethereum #money #trading #bitcoinmining #cryptotrading #investment #business #cryptonews #forextrader #entrepreneur #investing #bitcoinnews #dobetter #bitcoins #eth #aidcoin #cryptocurrencies #invest #life #binance #trader #coronavirus #investor #donations #philanthropy
2231709181287593257; 0; False; 1580260487; Sebagai orang indonesia, terkadang kita merasakan cuaca yang mendadak berubah- ubah, dan kondisi ini sering kali membuat kulit kita kering, sensitif, dan cepat kusam. Tentunya kalian butuh perawatan untuk extra melembabkan bahkan mencerahkan, bukan? Yes, kalian butuh Glasskin Drink sebagai proteksi dan nutrisi dari dalam. Karna didalamnya terdapat 𝘏𝘦𝘳𝘰 𝘐𝘯𝘨𝘳𝘦𝘥𝘪𝘦𝘯𝘵𝘴 yang sangat bersahabat untuk kulit orang Indonesia, seperti: • 𝐋-𝐠𝐥𝐮𝐭𝐚𝐭𝐡𝐢𝐨𝐧𝐞 yang merupakan antioksidan master yg menangkal radikal bebas penyebab kerusakan kulit seperti flek / jerawat, mendetox racun dalam tubuh melalui urin, menetralisir bahan aktif berbahaya dlm kosmetik, menghambat produksi melanin sehingga memutihkan seluruh tubuh. • 𝐇𝐲𝐚𝐥𝐮𝐫𝐨𝐧𝐢𝐜 𝐚𝐜𝐢𝐝 yang mampu meningkatkan produksi kolagen alami dalam tubuh sehingga membantu kulit tetap kenyal dan kencang. Progress penggunaan 𝘏𝘺𝘢𝘭𝘶𝘳𝘰𝘯𝘪𝘤 𝘈𝘤𝘪𝘥 𝘥𝘢𝘯 𝘎𝘭𝘶𝘵𝘩𝘢𝘵𝘪𝘰𝘯𝘦 sudah nampak setelah 14 hari loh, Beauties :red_heart: Tentunya dengan dibarengi konsumsi banyak air putih dan ikuti gaya hidup yang sehat. Karena proses detox dan penyerapan vitamin akan lebih maksimal :red_heart: #glasskindrinkmsglow #msglow #msglowbeautypalu #msglowbanjaragenresmi #coronavirus #ilovemydaughters #bdrsharing #teamglowing
2231707960751775407; 0; False; 1580260483; :pensive_face::folded_hands: #coronavirus #outbreak #notd #news
2231709146365751560; 0; False; 1580260483; #coronavirus #china #penis #globalaveragedicksize #growing #bigdick #simpsons #lisasimpsonmemes #lisasimpson #outbreak #virus
2231707609042765601; 0; False; 1580260482; Un paciente infectado por coronavirus, intentó salir de la sala del aislamiento donde se encontraba en el hospital. Las enfermeras trataron de impedir que saliera de la habitación. Video cortesía _ #LaPrensaLara #Noticias #Coronavirus #28Ene
2231709113513990008; 0; False; 1580260479; Toot toot . . This post is brought to you by NordVPN:trade_mark:. Make sure to like, subscribe and click that bell button so you won't miss any new posts we make! . . 𝙁𝙊𝙇𝙇𝙊𝙒 @rarefrens 𝙖𝙣𝙙 𝙧𝙚𝙘𝙚𝙞𝙫𝙚 (っ◔◡◔)っ 𝓰𝓸𝓸𝓭 𝓵𝓾𝓬𝓴! ᴸⁱᵏᵉ ᶜᵒᵐᵐᵉⁿᵗ ᵃⁿᵈ ᵗᵃᵍ ʸᵒᵘʳ ᶠʳⁱᵉⁿᵈˢ ᶠᵒʳ ᵃᵘˢᵖⁱᶜⁱᵒᵘˢ ᵖʳᵒˢᵖᵉʳⁱᵗʸ~ #pcbuild #meme #lmao #anime #4chan #chainlink #blockchain #sergeynazarov #bitcoin #dogecoin #cryptocurrency #crypto #jojo #fren #dankmemes #anime #hongkong #protests #capitalism #joker #apustaja #coronavirus #china #xijinping
2231709070775545629; 0; False; 1580260474; Amen :folded_hands_medium-light_skin_tone::red_heart::raising_hands: #Amen #Jesus #Church #Godisgood #blessed #Bible #Church #Christian #gym #coffee #sports #love #igdaily #reading #books #God #jesussaves #forgiven935 #jesuschrist #fishing #nba #coronavirus #war #saved
2231709065532517409; 0; False; 1580260473; :warning::warning: Atenção :warning::warning: . . Coronavírus :down_arrow: :black_small_square: Pode infectar animais e pessoas causando doenças do trato respiratório. . . :black_small_square:O que o coronavírus faz ? Risco de pneumonia e insuficiência respiratória em pessoas mais velhas e que já tenham outras doenças. . . :black_small_square:Como é feito o diagnóstico? O diagnóstico do novo coronavírus é feito com a coleta de materiais respiratórios com potencial de aerossolização (aspiração de vias aéreas ou indução de escarro). . . :double_exclamation_mark:Cuidado:double_exclamation_mark: . . . . . . . . . . . . . . . . . #coronavirus #infectologista #doenca #biomed #farmacia #prevencao #informacion
2231709056934132742; 0; False; 1580260472; #Repost @fisiomonicaferreira • • • • • • Fisioterapiaresp#fisiorespiratoria #fisioterapiaguarulhos #coronavirus #reabilitacaopulmonar #fisiomonicaferreira
2231709035376583928; 0; False; 1580260470; Así va el hospital qué el gobierno chino ordenó construir en 10 días, para tratar los pacientes infectados con el #coronavirus. La entrega es el 1 de febrero. :flushed_face::clapping_hands_light_skin_tone:
2231708416789951557; 0; False; 1580260465; @awreceh.id @kegoblogangarislucu @kegobloganunfaedah @kegoblogan.unfaedaah @kegoblogan.unfaeda @ambon.video @medanvidgram @indovidgram #slomo #lucuabis #wuhan #rachelvennya #lucintaluna #tiktokindo #makassarinfo #siantar #tiktokmedan #princessyahrini #payudarasexy #keanuagl #gila #coronavirus #dagelan #ikanasin #memesdaily #lfl:yellow_heart: #medan #daraarafah #medanhits #corona #payudara #fff:kiss_mark: #raja_ngakak #storywa #katabijak #nikitamirzani #ccpedit #bataktoba
2231708969181118085; 0; False; 1580260462; Amen :folded_hands_medium-light_skin_tone::red_heart::raising_hands: #Amen #Jesus #Church #Godisgood #blessed #Bible #Church #Christian #gym #coffee #sports #love #igdaily #reading #books #God #jesussaves #forgiven935 #jesuschrist #fishing #nba #coronavirus #war #saved
2231708907843471125; 0; False; 1580260455; Not my problem. Nice try, virus. :face_with_tears_of_joy::hundred_points: #introvertmemes #coronavirus #china - - - Tags: #introvert #introverts #lmfao #lmao #introvertsbelike #sickmemes #comedy #funny #explorepage #trending #viral #nochillmemes #savagememes #funnymemes #funnypics #memepage #memepages #memes #memesdaily #dailymemes #dankmemes #instafunny #follow4more #like #like4like #commentbelow #tagafriend
2231708901600939929; 0; False; 1580260454; A recent statement from the World Naturopathic Federation details diagnosis, treatment and prevention options for Chinese Coronavirus (2019-nCoV). Preventing acute viral infections requires a 2 part approach that involves both decreasing exposure and addressing individual immune resistance to minimise susceptibility. Join us this Friday at 12:30pm AEDT in our Facebook group, PracConnect with Paul Kern to learn more about how to use diet, lifestyle, nutrients and herbs is to strengthen immune resilience and reduce your risk of viral infections! To view the statement see our Insta Story! #coronavirus #coronavirusoutbreak
2231708885026912226; 0; False; 1580260452; :bat: - - #wuhan #china #coronavirus #lovetoyou
2231708823630295090; 0; False; 1580260445; Amen :folded_hands_medium-light_skin_tone::red_heart::raising_hands: #Amen #Jesus #Church #Godisgood #blessed #Bible #Church #Christian #gym #coffee #sports #love #igdaily #reading #books #God #jesussaves #forgiven935 #jesuschrist #fishing #nba #coronavirus #war #saved
2231708799547297261; 0; False; 1580260442; État de la situation #Coronavirus en Chine:China: | Mise à jour du 28 janvier de l'Organisation mondiale de la santé (OMS/WHO). 4593 cas confirmés 6973 cas suspects 976 cas sévères 106 décès Selon l'OMS, le risque dans le pays reste à un niveau très élevé avec 4593 cas confirmés dans le monde :world_map: dont 4537 en Chine:China: & 56 dans 14 autres pays: Allemagne:Germany: Australie:Australia: Cambodge:Cambodia: Canada:Canada: Rép de Corée:South_Korea: Etats-Unis:United_States: France:France: Japon:Japan: Malaisie:Malaysia: Népal:Nepal: Singapour:Singapore: Sri Lanka:Sri_Lanka: Thaïlande:Thailand: Vietnam:Vietnam:
2231708780781120763; 0; False; 1580260439; Cold blooded.. #CoronaVirus
2231708727464222824; 0; False; 1580260433; #coronavirus Everyone please don’t take this lightly! #coronavirusoutbreak #coronaviruschina
2231708566611646851; 0; False; 1580260414; #homoeopathicmedicine #prevention #coronavirus #Justicia
2231708359277465215; 0; False; 1580260402; Local people aimed at people returning from Wuhan. Just like the Cultural Revolution. 外地針對當地從武漢回來的人，就像文革一样。 #CoronavirusOutbreak at #Wuhan #China #WuhanSARS #WuhanOutbreak #CCPChina #chinazi #SARS2020 #WuhanCoronavirus #WuhanPneumonia #wuhanvirus #ChinaVirus #chinanews #becausechina #faceofchina #massmigration #springfestival #coronavirus #武漢 #武漢市 #武漢疫情 #武漢肺炎 #武汉疫情 #冠狀病毒 #武漢肺炎 #新型肺炎 #新型コロナウィルス #武漢市新型冠狀病毒肺炎
2231708405324360559; 0; False; 1580260395; #coronavirus
2231708334104598966; 0; False; 1580260386; After the long Chinese New Year holiday, everyone supposes to go back to office today in which you should see lion dancing everywhere to welcome them. ⁣ ⁣ Shops and companies hang lettuce at the entrance on their first day of work in the new year to welcome the Lion, which is believed to bring good luck and fortune to the business. Lettuce, in chinese 生菜 (san choi), has a similar pronunciation as 生財 (sun choi), which means growing wealth and prosperity. The lion will eat the lettuce and throw it into the shop, which the storekeepers will catch the lettuce (luck and wealth).⁣ ⁣ The atmosphere on the first working day should be a lot different this year. Civil servants (except those who provide urgent and necessary public services) and many other private sector employees will work from home until Feb 2 as a preventive measure to minimise the spread of Wuhan Coronavirus. ⁣ ⁣ Stay healthy everyone! May the lion also bring us good health! ⁣ ⁣ #explorehongkong_festival⁣⁣⁣⁣⁣⁣⁣⁣ #explorehongkong_lunarnewyear⁣⁣⁣⁣⁣⁣⁣⁣ ⁣⁣⁣⁣⁣⁣⁣⁣ #hk #hongkong #香港 #舞獅 #liondance #採青 #香港旅遊 #香港旅行 #explorehongkong #discoverhongkong #hkstyle #travelgram #香港好去處 #travelasia #cny #chinesenewyear #lunarnewyear #newyear #新年 #恭喜發財 #開工大吉 #身體健康 #最緊要身體健康 #武漢肺炎 #coronavirus #wuhanvirus
2231708326226694954; 0; False; 1580260385; Prevention is better than cure. :white_heavy_check_mark::white_heavy_check_mark: . #takaful #medicalcard #coronavirus #takecareofyourself
2231708302824686736; 0; False; 1580260382; Sundays class on Winter wellness was full of very easy ways to maintain your health through winter cold and flu season @nursemariam #healthy #healthylifestyle #strong #immunesystem #vitamins #virus #flu #cold #aromatherapy #coronavirus #free #event #staples #spotlight #spotlightspace
2231708284973113030; 0; False; 1580260380; Taiwan melaporkan kasus pertamanya tentang penularan virus corona yang terjadi di dalam negeri, Selasa (28/1/2020) dan mengeluarkan peringatan kunjungan ke China, dengan mengatakan masyarakat sebaiknya menghindari pergi kecuali untuk urusan yang sangat penting menyusul mewabahnya virus di sana. Lengkapnya ada di indopos.co.id gaes, jangan lupa mampir ke webnya #coronavirus #taiwan #bacaindoposaja #indoposonline #indoposcoid #17thmendewasakanbangsa #17thindopos
2231707969460296720; 0; False; 1580260378; Holi amikes, somos dos wnes sin vida que decidimos crear esta página para curar la depresión y el coronavirus, ojalá que les guste y difundan para llegar a más gente :woman_gesturing_OK_dark_skin_tone::revolving_hearts: Haremos todo nuestro esfuerzo en subir contenido original (osea ninguno :smiling_face_with_sunglasses:) . . . . . . #instachile #cringe #tiktok #instalike #coronavirus #dramaqueen #vscogirl #lgbt #memeschilenos
2231708061650968042; 0; False; 1580260354; Ifykyk – Cali - - - - #memes #dank #dankmemes #edgy #edgymemes #spicymemes #memesdaily #dailymemes #funny #cringe #cringy #mood #genz #tiktok #lol #lmao #lmfao #jokes #comedy #coronavirus #minecraft #pewdiepie #ww3 #offensivememes #memesdaily #vines #tumblr #twitter #tweets #textposts #shitposts
2231708055433704314; 0; False; 1580260353; Spammin it rn to make up for lack of posts today . . . . . . . . . . . . - Discord Server In Bio! - . . . . . . . #meme #memes #funny #dankmemes #memesdaily #funnymemes #lol #dank #humor #like #follow #lmao #dankmeme #edgymemes #offensivememes #anime #love #coronavirus #comedy #dailymemes #edgy #fun #xbox #metalmemes #ps4 #discord #discordserver #offensivememes #ww3memes #ww3
2231707676899744363; 0; False; 1580260350; Source: @rt The best medicine? Song, apparently. As China fights the worsening coronavirus outbreak, residents under quarantine in Wuhan have shared videos online of their battle against cabin fever, showing how they are lifting each other’s – and the nation's – spirits. . #coronavirus #coronavirusoutbreak #virus #wuhan #wuhanvirus #coronaviruschina #wuhanchina #corona #coronovirus
2231707958815128441; 0; False; 1580260341; Informações sobre o Coronavírus #boanoite #coronavirus #china #brasil #virus #epidemia #doencas #neurociencias #neuropsicologia #neuropsicologiainfantil #psicopedagogia #psicologia #psicologiacomportamental #terapia
2231707867822602127; 0; False; 1580260331; vean el video completo es importante!! ㅤAclaro;; ❝ Comentarios de hate serán eliminados, no gastes tu tiempo en ello ❞ ꦿ ㅤ. ᪶⇢‧⸼ ✧ . ° ✦ ◌ · ˚✧ ﹡✦ . • ㅤㅤㅤㅤㅤ꒰:coconut:꒱ ⇢‧⸼ ✧ . ° ✦ ◌ · ˚✧ ﹡✦ . • ㅤ. . •••••••••••••••••••••••••••••••••••••••• . :bow_and_arrow:ᴛᴀɢs, ɪɢɴᴏʀᴀʀ:bow_and_arrow: ㅤ. 『:label:』Tags;; #selfcare #selfcarethreads #selfcarespanish #selfcareespañol #tips #selfcaredaily #selfcarehacks #selfcarevegan #selfcarelove #muak #selfcareroutine #selfcareeveryday #selfcaretips #selfcarevideos #selfcareautocuidado #theme #selfcaregirls #themes #selfcarebeauty #beautifulselfcare #selfcarevideo #selfcarebelleza #selfcarecute #selfcarefotos #feed #autocuidado #bellezanatural #enfermedad #coronavirus #virus
2231707477173625882; 0; False; 1580260327; - - - - -- -#dankmemes #spongebobmemes #spongebob #dankest #memesthatcurecancer #memesthatcuredepression #memesdaily #bestmemesever #nutt #bestmemesof2019 #joker #jokermovie #bigmouth #xboxisgay #thiccmemes #ww3memes #fortnite #memesarelife #redditmemes #normiememes #bestmemes #offensivememes #offensivememes:sweat_droplets::eyes::hundred_points::face_with_tears_of_joy::face_with_tears_of_joy::gem_stone::fire::face_with_steam_from_nose::sweat_droplets::OK_hand::hundred_points::face_with_tears_of_joy::folded_hands::face_with_tears_of_joy::face_with_tears_of_joy::gem_stone::gem_stone::fire::face_with_steam_from_nose::sweat_droplets::eyes::eyes:#coronavirus
2231707800354803098; 0; False; 1580260323; ‪32,000 hospitalized with symptoms of Corona; airports, theatres, shopping centers, transit stations shut down. ‬ ‪These are current status reported; please be apprised; Please do further research.‬ ‪#Agenda21 #coronavirus #FEMA #Virus #Outbreak ‬ ‪https://youtu.be/jtj9e-7Brvg‬
2231707774659955505; 0; False; 1580260320; ‪32,000 hospitalized with symptoms of Corona; airports, theatres, shopping centers, transit stations shut down. ‬ ‪These are current status reported; please be apprised; Please do further research.‬ ‪#Agenda21 #coronavirus #FEMA #Virus #Outbreak ‬ ‪https://youtu.be/jtj9e-7Brvg‬
2231707750358745009; 0; False; 1580260317; ‪32,000 hospitalized with symptoms of Corona; airports, theatres, shopping centers, transit stations shut down. ‬ ‪These are current status reported; please be apprised; Please do further research.‬ ‪#Agenda21 #coronavirus #FEMA #Virus #Outbreak ‬ ‪https://youtu.be/jtj9e-7Brvg‬
2231706026917420375; 0; False; 1580260315; #IMPORTANTE || CONOZCA LA SINTOMATOLOGÍA DEL CORONAVIRUS . Reggie Barrera, jefe de epidemiología en la entidad, explicó los síntomas que se pudiesen registrar en caso de presentarse un caso de coronavirus y la investigación que se realizaría en caso de una posible sospecha del mismo. . . Reporte: Luzfrandy Contreras @Luzfrandyc . . #28Ene #ReporteV #NuncaTodoEstáContado #Noticias #NoticiasTáchira #Táchira #SanCristóbal #Coronavirus
2231707722875761067; 0; False; 1580260313; ‪32,000 hospitalized with symptoms of Corona; airports, theatres, shopping centers, transit stations shut down. ‬ ‪These are current status reported; please be apprised; Please do further research.‬ ‪#Agenda21 #coronavirus #FEMA #Virus #Outbreak ‬ ‪https://youtu.be/jtj9e-7Brvg‬
2231707688501002716; 0; False; 1580260309; ‪32,000 hospitalized with symptoms of Corona; airports, theatres, shopping centers, transit stations shut down. ‬ ‪These are current status reported; please be apprised; Please do further research.‬ ‪#Agenda21 #coronavirus #FEMA #Virus #Outbreak ‬ ‪https://youtu.be/jtj9e-7Brvg‬
2231707004760491891; 0; False; 1580260308; #TaJodonaLaVaina. Si los vecinos saben que estuviste en #wuhan la #ciudad del #coronaVirus te condenan la puerta para que no salgas .
2231707222781426488; 0; False; 1580260306; ¡SEÑOR PROTÉGELOS!:folded_hands_light_skin_tone: #Coronavirus | En China :China: dos ciudadanos se pelearon para poder comprar una mascarilla, debido a que ya no hay suficientes :prohibited: y las que se consiguen las venden muy caras. . . Vía eldiario . . #China #Viral #Mascarilla
2231707653065928178; 0; False; 1580260305; The 9th day of self-#quarantine. Just wanna be clear: most Chinese don’t eat and don’t even want to eat wild animals. #springfestival #china #nCoV #coronavirus #deathstranding #playstation #tomorrowisinyourhands #otaku
2231707650340811683; 0; False; 1580260305; #coronavirus #symptoms #prevention #howtospread #homoeopathicmedicine #treatment #homoeopathyforeveryone
2231707639091643867; 0; False; 1580260303; True #meme #memes #china #coronavirus #coronavirusmemes #cartoon #memesdaily #90s
2231707579566528954; 1; False; 1580260296; Nadie es completamente bueno ni completamente malo, todos tenemos la posibilidad y hasta el instinto de hacer las cosas en algunos de los polos, es la “elección” la que va a determinar la calidad de nuestras acciones. Los espero a las 10 pm en @ntelemicro5 . #outfit @almaceneslyn #Noticias #Informaciones #News #RD #Coronavirus #Anchor #EliantaQuintero #Terremoto #Jamaica #Cuba
2231707560155483648; 0; False; 1580260294; #손소독제 #품절 이런 #나눔 은 어떨까. STARBUCKS CHINA는 어떻게 대처하고 있을까. 하워드 슐츠는 중국에서 엄청난 매출을 올릴 뿐만 아니라, 전세계로 유통하는 스타벅스 MD상품을 중국에서 만들고 있으니, 중국에게 고마워 해야한다. 미중/중미 갈등 속에서도 천문학적인 수치의 돈을 벌고 있으니 말이다. 이 #우한폐렴 #CoronaVirus 어려운 시기에 내가 대표라면, 매출고민이 아니라 사회적 역할 수행에 대한 고민을 한번 쯤 해볼 것 같다. 실천까지는 어렵더라도. (사진, 2011 북경 스타벅스) @yj_loves 용진이형은 어떻게 할 것인가. #星巴克 #스타벅스 #starbucks #teatime #喝茶 #바빠도커피한잔 #커피한잔의여유 #trip #travel #여행스타그램 #인생 #행복 #life #happiness #성공 #success #사업 #management #foundr #entrepreneur #커피스타그램 #카페스타그램
2231707527615949766; 0; False; 1580260290; Blocos de rua, gente suando, estrangeiros visitando o país só pelo carnaval.... é vai dar certinho viu?! Kkkk #corona #coronavirus
2231707513992997084; 0; False; 1580260288; Right mask & right way to wear. Takecare of ourselves guys :palms_up_together_light_skin_tone: #coronavirus
2231691717380114815; 0; False; 1580260284; Pendiente ya que el mundo nos es muy 'grande', debemos documentarnos al respecto y estar pendiente con todo lo que podamos para evitar algún contagio. #coronavirus #coronavirusoutbreak
2231707477946995045; 0; False; 1580260284; Use VODKA to fight virus? During the severe outbreak of Coronavirus, many masks and hand sanitizers are out of stock in market. The most easiest way is to make your own safety from things that you may find close around and be creative. I found a bottle of Vodka at home (not that I am a drinker), and you can mix with aloe vera gel and add few drops of essential oil for your favorite aroma. Vodka contains ethanol which kills organism by denaturing their proteins and dissolving their lipids, and is effective against bacteria and many viruses. Aloe Vera can be used to replace glycerin which is also one of the ingredients to make hand sanitizer. #handsanitizer #ayurveda #holistichealing #holistichealth #holistic #homemade #coronavirus #virus #vodka #healthylifestyle #holisticmedicine
2231707424945894093; 0; False; 1580260278; Way ahead of pace #QAnon #coronavirus
2231707428638398355; 0; False; 1580260278; I wonder if this is what the #coronavirus looks like
2231706838021660638; 0; False; 1580260278; :eyes::face_with_monocle::thinking_face:⠀⠀ ⠀⠀⠀⠀⠀⠀ ⠀⠀⠀⠀⠀⠀ ⠀⠀ #Coronavirus | En China :China: dos ciudadanos se pelearon para poder comprar una mascarilla, debido a que ya no hay suficientes :prohibited: y las que se consiguen las venden muy caras. ⠀⠀⠀⠀⠀⠀ ⠀⠀⠀ ⠀⠀⠀⠀⠀⠀ ⠀⠀⠀⠀⠀⠀ ⠀⠀⠀⠀⠀⠀ ⠀⠀⠀ ⠀⠀⠀⠀⠀⠀ ⠀⠀⠀⠀⠀⠀ ⠀⠀⠀ ••••••••••••••••••••••••••••••••••••••••••••••••••••••••••••••• ⠀ @doblemoralrd noticias #actualidad #internacional #republicadominicana #view #alerta #novedad #viral #rd #dominicannetflix #doblemoralrd #dominicana #jamaica #japon #jamaica #japon #franklinmirabal #licey #cuba #haiti #toros #faride #miami #angelestevez #hanley #bonilla #ericfilia #delacruz #pelucho #brito #pujeazul #seriefinallidom2020
2231707388306304648; 0; False; 1580260273; AKUN PRIBADI VIU PREMIUM SETAHUN (HARI INI SAMPE 24 JANUARI 2021) CUMA 40 ribu AJAH :smiling_face_with_heart-eyes::smiling_face_with_heart-eyes: *PROMO TERBATAAAS yaaa dearkuh* #testimurmershopdua . Cuma dengan :backhand_index_pointing_down: • Rp. 40.000 bank BCA saja/OVO • Rp. 50.000 Telkomsel/XL . Kamu dapet kelebihan dibawah ini :backhand_index_pointing_down: :blue_heart:Bisa untuk Android , IOS , PC/KOMPUTER. :blue_heart: Akun km yg saya premiumkan (PREMIUM DISINI BUKAN NONTON TANPA KUOTA YA, tapi semua FILM LOCK itu UNLOCK/TERBUKA) :blue_heart: AKUN NYA Terima beres, TINGGAL LOGIN TIDAK RIBET :blue_heart: Bukan via link:cross_mark: :blue_heart: Tidak ada jeda iklan:cross_mark: :blue_heart: Bisa download & nonton nanti :blue_heart: Subtitle indonesia jelas & rapi :blue_heart: Tidak Termasuk Kuota Data & Perpanjang Otomatis (NONTON TETAP PAKE KUOTA kamu ya) *sesuai paket dari viunya tidak termasuk kuota data:thumbs_up: . . WAKTU TERBATAS!! Buruan order, jangan sampe kehabisan, nangis lagi :winking_face_with_tongue: . Note: VIU adalah aplikasi nonton Online yaa dear :face_blowing_a_kiss: dan saya jual akun Premium untuk VIU nya :face_blowing_a_kiss: . . #jualviupremiumiosmurah#viupremiummurah#viupremiumandroidmurah#viupremiumandro#viupremiumiosmurah#likeforlike#viupremiummurah#explorebekasi#theextraordinary#kpopina#dramakorea#bts#exo#bandung#explorebandung#garut#manokwari#jakarta#sumatra#jualaplikasiviupremiumsetahun#starwarsriseofstarwalker#kfc#awkarin#viupremiumios#akunviupremiummurah#viupremiummurah#jualviupremiumiosmurah#bts#blackpink#jualviupremiummurah#viupremiummurah#daraarafah#coronavirus
2231707319586307408; 0; False; 1580260265; #prayforwuhan :folded_hands::folded_hands::folded_hands: #武汉平安 #武汉加油 #武汉加油中国加油 #wuhan #china #virus #coronavirus #ไวรัสโคโรน่า
2231707276519685971; 0; False; 1580260260; :face_with_tears_of_joy::skull:#coronavirusmemes #coronavirus #coronavirusoutbreak #corona #corona:beer_mug: #coronaviruses #coronaviruschina #coronavirüsü #wuhanchina #wuhanvirus
2231707237990919590; 0; False; 1580260256; AKUN PRIBADI VIU PREMIUM SETAHUN (HARI INI SAMPE 24 JANUARI 2021) CUMA 40 ribu AJAH :smiling_face_with_heart-eyes::smiling_face_with_heart-eyes: *PROMO TERBATAAAS yaaa dearkuh* #testimurmershopdua . Cuma dengan :backhand_index_pointing_down: • Rp. 40.000 bank BCA saja/OVO • Rp. 50.000 Telkomsel/XL . Kamu dapet kelebihan dibawah ini :backhand_index_pointing_down: :blue_heart:Bisa untuk Android , IOS , PC/KOMPUTER. :blue_heart: Akun km yg saya premiumkan (PREMIUM DISINI BUKAN NONTON TANPA KUOTA YA, tapi semua FILM LOCK itu UNLOCK/TERBUKA) :blue_heart: AKUN NYA Terima beres, TINGGAL LOGIN TIDAK RIBET :blue_heart: Bukan via link:cross_mark: :blue_heart: Tidak ada jeda iklan:cross_mark: :blue_heart: Bisa download & nonton nanti :blue_heart: Subtitle indonesia jelas & rapi :blue_heart: Tidak Termasuk Kuota Data & Perpanjang Otomatis (NONTON TETAP PAKE KUOTA kamu ya) *sesuai paket dari viunya tidak termasuk kuota data:thumbs_up: . . WAKTU TERBATAS!! Buruan order, jangan sampe kehabisan, nangis lagi :winking_face_with_tongue: . Note: VIU adalah aplikasi nonton Online yaa dear :face_blowing_a_kiss: dan saya jual akun Premium untuk VIU nya :face_blowing_a_kiss: . . #jualviupremiumiosmurah#viupremiummurah#viupremiumandroidmurah#viupremiumandro#viupremiumiosmurah#likeforlike#viupremiummurah#explorebekasi#theextraordinary#kpopina#dramakorea#bts#exo#bandung#explorebandung#garut#manokwari#jakarta#sumatra#jualaplikasiviupremiumsetahun#starwarsriseofstarwalker#kfc#awkarin#viupremiumios#akunviupremiummurah#viupremiummurah#jualviupremiumiosmurah#bts#blackpink#jualviupremiummurah#viupremiummurah#daraarafah#coronavirus
2231707232739069292; 0; False; 1580260255; the world population boutta be 6 million instead of 7 million #coronavirus #worldpopulationday
2231707160100977461; 1; False; 1580260246; once again, we have to put up with their fucking bullshit
2231707159918643794; 0; False; 1580260246; [ENGLISH BELOW] Từ khi tụi mình doạ nạt, năn nỉ phát tờ rơi ở #Dalat những ngày #Tet, #Dalatthấtthủ thật sự. Mặc dù đã chuẩn bị #khẩutrang cho khách đến quán nhưng trong một diễn biến khác #biểnngười ở #chợDalat và khách tìm #homestay, #hotel không quan tâm lắm đến tình hình #dịchbệnh cho lắm. Để đảm bảo an toàn cho mấy miếng #bbq đang đeo khẩu trang, tụi mình đóng cửa quán tạm thời và thực hiện #CoronaVirusAway, một hành trình ăn chơi là chính, đem "khẩu trang & niềm vui" đến với mọi người ở các vùng quê hẻo lánh view triệu đô là phụ. Kết thúc hành trình, tụi mình sẽ mở lại và thêm Corona Virus vào menu. --------------------------------------------- Despite the #18HoursSmokingWithLove briskets are wearing masks, it's not safe for them from Corona virus. We'd close the restaurant and prepare a #CoronaVirusAway trip, bring the masks & fun to rural places where they're not aware of the virus. Any contribution to Vietnam rural places, pls let us know. Of course, #TexasDalatBBQ will open again and add the #Coronavirus drink to the menu. ------------------------------------------------- #StaysafefromCoronaVirus FOLLOW US for NEWS ON THE ROAD PLS ORDER BEFORE COMING: 0977726983 www.texasdalatbbq.com
2231707126271434178; 0; False; 1580260242; AKUN PRIBADI VIU PREMIUM SETAHUN (HARI INI SAMPE 24 JANUARI 2021) CUMA 40 ribu AJAH :smiling_face_with_heart-eyes::smiling_face_with_heart-eyes: *PROMO TERBATAAAS yaaa dearkuh* #testimurmershopdua . Cuma dengan :backhand_index_pointing_down: • Rp. 40.000 bank BCA saja/OVO • Rp. 50.000 Telkomsel/XL . Kamu dapet kelebihan dibawah ini :backhand_index_pointing_down: :blue_heart:Bisa untuk Android , IOS , PC/KOMPUTER. :blue_heart: Akun km yg saya premiumkan (PREMIUM DISINI BUKAN NONTON TANPA KUOTA YA, tapi semua FILM LOCK itu UNLOCK/TERBUKA) :blue_heart: AKUN NYA Terima beres, TINGGAL LOGIN TIDAK RIBET :blue_heart: Bukan via link:cross_mark: :blue_heart: Tidak ada jeda iklan:cross_mark: :blue_heart: Bisa download & nonton nanti :blue_heart: Subtitle indonesia jelas & rapi :blue_heart: Tidak Termasuk Kuota Data & Perpanjang Otomatis (NONTON TETAP PAKE KUOTA kamu ya) *sesuai paket dari viunya tidak termasuk kuota data:thumbs_up: . . WAKTU TERBATAS!! Buruan order, jangan sampe kehabisan, nangis lagi :winking_face_with_tongue: . Note: VIU adalah aplikasi nonton Online yaa dear :face_blowing_a_kiss: dan saya jual akun Premium untuk VIU nya :face_blowing_a_kiss: . . #jualviupremiumiosmurah#viupremiummurah#viupremiumandroidmurah#viupremiumandro#viupremiumiosmurah#likeforlike#viupremiummurah#explorebekasi#theextraordinary#kpopina#dramakorea#bts#exo#bandung#explorebandung#garut#manokwari#jakarta#sumatra#jualaplikasiviupremiumsetahun#starwarsriseofstarwalker#kfc#awkarin#viupremiumios#akunviupremiummurah#viupremiummurah#jualviupremiumiosmurah#bts#blackpink#jualviupremiummurah#viupremiummurah#daraarafah#coronavirus
2231707119365960138; 0; False; 1580260241; Readiness is our only protection . . . . #Emergency #Prepared #Gloves #Ethanol #Mask #Sanitize #Wuhan #China #Corona #CoronaVirus #WuhanCoronaVirus
2231707093765460228; 0; False; 1580260238; Assalamualaikum #sobatrumhat, kemarin pada hari Selasa, 28 Januari 2020 Tim LLG (Layanan Luar Gedung) Rumah Sehat BAZNAS Yogyakarta mengadakan aktivitas bersama masyarakat dalam program Unit Kesehatan Berbasis Masyarakat (UKBM) di Jatimulyo, Girimulyo, Kulon Progo. Aktivitas yang dilaksanakan ini bersinergi dengan BAZNAS kabupaten Kulon Progo yang bertujuan untuk mengontrol kesehatan masyarakat melalui upaya promotif dan kuratif. Rangkaian kegiatan yang dilakukan yaitu senam sehat, penyuluhan kesehatan bertemakan "Pencegahan Penyakit Corona Virus", penimbangan berat badan, cek tekanan darah, konsultasi dokter dan pelayanan obat sesuai indikasi, serta Pengecekan Golongan Darah. Kegiatan ini berlangsung mulai pukul 10.15 s/d 13.00 WIB dan dihadiri oleh 120 orang. Semoga kegiatan ini bisa bermanfaat bagi masyarakat, karna lebih baik upayakan mencegah dari pada mengobati. #ukbm #coronavirus #penyuluhankesehatan #girimulyo #kulonprogo #layananluargedung #semestakebajikanzakat #rsbjogja
2231703750720633909; 0; False; 1580260234; The Truth about the Corona Virus :white_small_square: Everything #CBD @AgarthaCBD :white_small_square: #TastyRecipes @GudPhood :white_small_square: #CannabisRecipes @TasteOfCanna :white_small_square: #SportsNutrition @BestDamnSups :white_small_square: #420Life @All420tv :white_small_square: Funny Ass #Memes @ThatSavageShyt :white_small_square: #ShrimpKeeping @FinsNthings :white_small_square: #LuxuryLifestyle @Astral.LLC :white_small_square: :white_small_square: :white_small_square: #ConspiracyTheory #ForbiddenKnowledge ##TheMoreYouKnow #KnowledgeIsPower #QuestionEverything #RealEyesRealizeRealLies #Conspiracy #InstaDaily #TheFirmament #FlatEarth #EpsteinDidntKillHimself #ConspiracyTheories #Motives #Vaxxed #BigPharma #AntiGovernment #Lies #CoronaVirus #Follow #:exploding_head: #:brain:
2231706808710410797; 0; False; 1580260234; Reposted from @cordova.media Jepang mengirimkan pesawat untuk mengevakuasi 200 warganya yang berada di tempat bermulanya wabah virus Corona. Ada sekitar 650 warga negara Jepang di Wuhan yang mengatakan ingin pergi meninggalkan kota itu. Jepang juga akan menerbangkan 1 atau 2 pesawat susulan untuk menjemput warga negaranya yang tersisa. Pesawat yang dicharter pemerintah Jepang itu juga membawa petugas medis lengkap dengan perlengkapannya. Ini adalah kali pertamanya Jepang mengevakuasi warganya dari luar negeri akibat mewabahnya penyakit menular. ⁣ ⁣ Virus Corona memiliki periode waktu inkubasi selama 14 hari dan bisa menyebabkan pneumonia. Virus ini bisa menyebar melalui batuk dan bersin ataupun melalui kontak langsung dengan penderita. Transmisi dari manusia ke manusia, selain di China juga telah terjadi di Jepang dan Jerman. Lebih dari 100 orang yang telah meninggal akibat virus ini.⁣ ⁣ Sumber: Japan Times, South Morning China Post, ANN News.⁣ ⁣ #jepang #jepun #japan #wuhan #china #coronavirus #viruscorona - #regrann Semoga pemerintah Indonesia segera mengevakuasi warganya dari Wuhan..!
2231707042469342808; 0; False; 1580260232; #Repost @tribunjakarta • • • • • Penyebaran virus baru yang disebut dengan Novel Coronavirus (NCoV) semakin meluas. Adapun virus yang mengakibatkan pneumonia berat ini diduga berasal dari Kota Wuhan, Tiongkok. Hingga Minggu (26/1/2020) telah terkonfirmasi lebih dari 2.700 kasus terinfeksi virus corona dan 80 diantaranya menyebabkan kematian. Setidaknya ada 12 negara lainnya selain Tiongkok yang melaporkan adanya temuan kasus virus corona, yaitu Kanada, Jepang, Simgapura, Malaysia, Thailand, Amerika Serikat, Vietnam, Nepal, Prancis, dan Australia. Guna mengantisipasi penyebaran virus tersebut di ibu kota, Pemprov DKI menyiapkan tiga rumah sakit rujukan bagi pasien siduga terinfeksi virus corona asal Kota Wuhan, Tiongkok ini. #pemprovdki #pemprovdkijakarta #infolesehatan #dinaskesehatan #aniesbaswedan #coronavirus #viruscorona #ncov #AniesBaswedan #DinkesDKI
2231706023044061266; 0; False; 1580260229; Não é brincadeira o que a China está passando, se não tiver uma ação imediata, todos nós correremos risco de passar por isso. Ainda mais aqui no Brasil que para se recuperar de algo demora mil anos, Zika vírus está aí e a mídia não fala, mas nunca mais se livraremos desse mosquito desgraçado. Imagina se tiver um surto dessa maldição aqui? um caso foi registrado em Minas Gerais. Que Deus tenha misericórdia de nós. . . #corona #coronavirus #china #hubei #wuhan #usa #vacina #saude #vacina #utilidadepublica #medicina #medicacao #hospital #surto #pandemia #illuminati #fatos #verdades #freemason #imunidade #limao #cenoura #viruscorona
2231706615269245164; 0; False; 1580260228; He is a cute little Asian boy and lord did he have us panicking for a good minute. It’s called jet lag my dude! #jetlag #hilarious #coronavirus #getalife #hobby #getahobby #wtf #memes #imakemyownmemes #schoolmemes #schoolsecretary #schoolsecretarylife #school
2231706966284490986; 0; False; 1580260223; :face_with_medical_mask: Coronavirus psychosis ??? Now I'm flying to Phuket Island. The view and atmosphere at the airport is not good. Maybe a pandemic is starting? Can Simple Medical Masks Protect Against Coronavirus? :face_with_hand_over_mouth::thinking_face: • #bangkok #bangkoklife #bangkokthailand #coronavirus #lifeislife
2231706847552176831; 0; False; 1580260221; Modelo Time:beer_mug: with the fellas cause only Lames drink Corona :prohibited::beer_mug::flexed_biceps::OK_hand::hundred_points::heavy_check_mark: #modelotime:beer_mug: #fuckcorona #coronavirus #nolames #goodfellas #m6bmw
2231706936790106027; 0; False; 1580260220; :face_with_tears_of_joy: #meme #dankmemes #memes:face_with_tears_of_joy: #memesdaily #memez #memepage #love #my #memes #instagood #photooftheday #followforfollowback #likeforlikes #like4likes #likeforlikeback #comment #comment4comment #commentforcomment #coronavirus #coronavirusmemes #coronavirusoutbreak
2231706829237634869; 1; False; 1580260217; Awkawkawkawkawkawk
2231706826253251538; 0; False; 1580260211; #CaricaturaPortafolio Esta es la caricatura de Guerreros: 'Epidemia local'. #Caricatura #Portafolio #Desempleo #Colombia #Empleo #Coronavirus
2231706661072707847; 0; False; 1580260210; No comments. :folded_hands_light_skin_tone: . #coronavirus #coronavirusoutbreak #virus #wuhan #wuhanvirus #coronaviruschina #wuhanchina #corona #coronovirus
2231706779117305627; 0; False; 1580260201; TANINO - nos últimos dias, de olhos fechados embora acordado, se nos apresentaram a folha da pitombeira fonte de tanino como cura para o #coronavirus : :backhand_index_pointing_down: Repost @drastephaniefekete (get_repost) ・・・ Amei esse post!!! Bora compartilhar o que é bom!!! :smiling_face_with_heart-eyes: @Regran_ed from @dra.anamacedo - É uma planta nativa dos cerrados brasileiros. Usada pelos índios, e tem como nome indígena ybá timõ que significa “árvore que aperta”. Interessante hein...vamos ver o que podemos ter de benefício nisso...kkkk :thinking_face::thinking_face: . Esta característica de “apertar”, se refere ao efeito adstringente que a planta tem, pela alta concentração de taninos. Você já comeu caju ou banana :banana: verdes? Sabe aquela sensação de “amarrar” a boca, então são os taninos!! . Atua como anti-inflamatório, antisséptico, analgésico, cicatrizante, antimicrobiano. Inclusive vários estudos já relatam sua ótima atuação no tratamento de leucorréia (corrimento), HPV, herpes, hérnia, feridas hemorrágicas, queimaduras, ulceras, hemorroidas. Atua como cicatrizante no pós-parto e feridas na vagina e vulva. . Usado na vaporização ou banho de assento, devido aos taninos, causa a contração das mucosas e vasos sanguíneos, dando uma sensação de “menininha bem fechadinha”, se é que vocês me entendem kkkk :winking_face::upside-down_face::relieved_face: !!! Um dos nomes populares da planta é “ planta da virgindade” justamente por suas propriedades. Para o banho de assento, faça um chá concentrado e dilua coado em bacia com água morna, permaneça sentada com a vulva totalmente imersa, por no mínimo 15 minutos. O uso de óvulos é indicado nestes casos (consulte um profissional habilitado). . Quer potencializar ainda mais o banho de assento com barbatimão, faça movimentos de pompoarismo, #ficaadica !! Em breve falaremos das técnicas de #pompoarismo, aguardem.:winking_face_with_tongue: . :megaphone: Não se recomenda o uso do barbatimão na forma de chá, pois os taninos em grande quantidade podem ser tóxicos.:memo: . Energeticamente, esta planta traz purificação da aura, elimina o sentimento de rejeição, baixa autoestima, menos valia, carência e dependência afetiva. . #barbatimao #ginecologianatural #draanamacedo #taninos #candidiase #sermulher #banhodeassento #fitoterapia #baixaautoestima #purificacaoaura - #regrann
2231706724161706048; 0; False; 1580260194; :wrapped_gift:HOLA LES TRAIGO UN SUPER SORTEO DE 3 IPHONES 11 - Los pasos son súper simples!:wrapped_gift: 1- sigue a @s0rteosmundiales y a todos los que sigue - 2- etiquetar a 3 amigos:collision: - 3- comenta muchas veces LISTO:collision: 4- el último paso es subir a tu historia que estamos sorteando estos 3 IPHONES :collision: - El ganador será elegido aleatoriamente. Estaremos verificando a quien haya hecho todos los pasos ¡mucha suerte! . . . . . . . . . . . . #threads #tips #selfcare #cute #followforfollowback #instagram #likeforlikes #belleza #memes #icons #fondos #frases #vintage #aesthetic #fashion #tumblr #vsco #baddie #soft #softgirl #softboy #fuerzafenix #china #coronavirus #sorteo #iphone #apple
2231706708309559495; 0; False; 1580260192; #coronavirus #china #corona #coronavirus #viral #viralvideos
2231706688328002314; 0; False; 1580260190; Be careful:grimacing_face: #coronavirus :microbe:
2231706416049818703; 0; False; 1580260185; Saranan Buat Rakyat Malaysia Ekoran Novel Coronavirus Sumber: Kementerian Kesihatan Malaysia #coronavirus #JabatanPenerangan #PeneranganPerak #JaPenKinta #perakdihatikome #perakkitapunya #SayangiMalaysiaku #MalaysiaBersih #KemakmuranBersama #SharedProsperity #Makmur2030 #KitaMalaysia #Malaysia
2231706532112990596; 0; False; 1580260171; Don’t let any of this down as your mood #medstudent #instagram #china #june6quotes #inspiration #writing #creative #life #family #relationship #friends #motivation #instadaily #coronavirus #humor #philosophy #success #poetsofinstagram #love #creative #inspirationalquotes #motivationalquotes #instaquote #quotes #dailyquotes #poetry #wordporn #writerscommunity #wordpress #writersofinstagramindianwriters
2231706519398190821; 0; False; 1580260170; கொரோனா வைரஸ் நோய்க்கான ஹோமியோ மருத்துவங்கள் அன்பிற்குரிய நண்பர்களே, கொரோனா வைரஸ் அல்லது வுஹான் வைரஸ் பற்றிய செய்திகளைப் பற்றி வெளிநாடுகளுக்குச் செல்லும் மக்களிடையே நிறைய பயமும் பதட்டமும் உள்ளது. அதை பற்றி கவலைப்பட வேண்டாம். தடுப்பதற்கும் குணப்படுத்துவதற்கும் ஹோமியோபதியில் சிறந்த மருந்துகள் ஆர்சனிக் ஆல்பி 30 தினசரி காலை 4 மாத்திரைகள் மற்றும் மாலை 4 மாத்திரைகள் 5 நாட்களுக்கு 6 வது நாளில் மருந்து இல்லை. PHOSPHORUS 30 அன்று 7 வது நாள் காலை 4 மாத்திரைகள். பின்வரும் ஹோமியோ மதர் டிங்க்சர்களை தினசரி பயன்படுத்துவதும் நோயைத் தடுக்கவும் குணப்படுத்தவும் உதவும். 15 நாட்களுக்கு பின்வரும் வழியில் பயன்படுத்தவும். 1. OCIMUM SANCTUM தாய் டிஞ்சர் (கிருஷ்ண துளசியின் சாறு). காலை 10 சொட்டு மற்றும் மாலை 10 சொட்டு 3 தேக்கரண்டி தண்ணீரில் குடிக்கவும். 2. டினோஸ்போரா கோர்டிபோலியா தாய் டிஞ்சர் (கன்னடத்தில் அமிர்த பல்லி மற்றும் தெலுங்கில் திப்பா தீகா சாறு). 3 தேநீர் கரண்டி தண்ணீரில் பிற்பகல் 10 சொட்டு மற்றும் இரவு 10 சொட்டு குடிக்கவும். முன்னெச்சரிக்கை: 1. தூய்மை மற்றும் சுகாதாரம் பற்றிய அனைத்து முன்னெச்சரிக்கை நடவடிக்கைகளையும் எடுத்துக் கொள்ளுங்கள். 2. குப்பை உணவு மற்றும் அசைவ உணவை உட்கொள்ள வேண்டாம். 3. பிற நபர்களுடன் நேரடி உடல் தொடர்பைத் தவிர்க்கவும். மூக்கு முகமூடியைப் பயன்படுத்துங்கள். 4. சில ஹோமியோ மருந்துகளை வைத்து, ஹோமியோபதி மருத்துவரின் ஆலோசனையின் பேரில் எப்போதாவது தேவைப்படும்போது பயன்படுத்தவும். 5. தேவைப்படும்போது தயவுசெய்து மருத்துவ உதவியை மேற்கொள்ளுங்கள். புறக்கணிக்காதீர்கள். அனைவரும் நல்ல ஆரோக்கியம்& மகிழ்ச்சிyudan வாழ அன்புடன் மற்றும் வாழ்த்துக்களுடன். #homoeopathy #coronavirus #remedy #medecine #prevention #ayush #indiansystem
2231706485681906087; 0; False; 1580260166; Compartí y segui la cuenta - - - - - - - - - #fernet#verano#videosrandom#humornegro#comedia#argentina#soycordobes#random#memes#2020#coronavirus#Rugbyers#Viral#Humor#Meme#Risa#china#TerceraGuerra#Like#Tusa#Kobe#VideosDerisa#VideosEspañol#MemesEspañol#humorArgentino#BuenosAires#MemesDiarios#Gamer#latinoamerica
2231706473838527199; 0; False; 1580260164; Keep safe. . .. #savewuhan #coronavirus #sandysuharjono #elisandy #jakarta #indonesia #2020
2231706453052735766; 0; False; 1580260162; Elegemos o Bolsonaro. Esperar o que mais de nós? #esquerdabiquense #coronavirus #corona
2231706416393885043; 0; False; 1580260158; #muse #musememe #musememes #coronavirus #chriswolstenholme #christopherwolstenholme
2231706389993313376; 2; False; 1580260154; so proud @superjunior panutanque :blue_heart: . . . . Cr newsen, oh_mes2 #SuperJunior#2YA2YAO#Timeless#leeteuk#Heechul#Yesung#eunhyuk#Shindong#Donghae#Siwon#ryeowook#Kyuhyun#elf#kpop#coronavirus
2231706379609774068; 0; False; 1580260153; Selamat pagi lemoner Lagi happening banget tentang penyakit yang sangat inveksius disebabkan oleh virus corona. Karena sangat cepat penularannya dan virulensi yang tinggi serta belum ditemukan obat anti virus nya maka penyakit ini menjadi momok di seluruh dunia sekarang ini. Lindungi diri kita dan keluarga kita dengan imunitas yang terjaga. Terapkan pola hidup sehat dan jangan lupa selalu berdoa dihindarkan dari marabahaya wabah yang mendera. #coronavirus #infeksicorona #coronaindonesia #lemonperas #minumanlemon #minumankesehatan #minumandiet #dietsehat #imunitastubuh
2231706372051634430; 0; False; 1580260152; Hong Kongers under the threats of #coronavirus aka #wuhanvirus #ShotoniPhone #streetphotography #HongKong
2231706128639819393; 1; False; 1580260146; Was a "fruit bat soup" like this responsible for the #Coronavirus??? Hit the link in bio to see why people are saying patient zero might have gotten it from this dish in China :speak-no-evil_monkey: - @itsfrankiep
2231706282293668184; 0; False; 1580260142; Coronavírus, saiu da China e já atinge vários países. Saiba um pouco do que se trata e quais as formas de Prevenção. #saúde #coronavirus #fisioterapia
2231706213127770035; 0; False; 1580260133; The blog will be published on word press at 10:30 am Beijing standard time. Link given below. https://june6quotes.wordpress.com/ Stay tuned, J6Q:speech_balloon: #medstudent #coronavirus #china #june6quotes #inspiration #creative #life #family #relationship #friends #loveyourself #motivation #instadaily #pain #suffering #success #poetsofinstagram #love #happy #inspirationalquotes #motivationalquotes #instaquote #quotes #life #words #thoughts #poetry #wordporn #writerscommunity #wordpress #writer
2231706202987674527; 0; False; 1580260132; We have officially infiltrated the @tobaccoplusexpo - playing it safe with a Modelo so we don’t get the #coronavirus #tpe2020 #barriosanto
2231706169987393364; 0; False; 1580260128; Reduce your risk of coronavirus :index_pointing_up::index_pointing_up::index_pointing_up::index_pointing_up::index_pointing_up::index_pointing_up::index_pointing_up::index_pointing_up::index_pointing_up::index_pointing_up::index_pointing_up::index_pointing_up::index_pointing_up::index_pointing_up:Read the instruction :backhand_index_pointing_right::backhand_index_pointing_right::backhand_index_pointing_right::backhand_index_pointing_right::backhand_index_pointing_right::backhand_index_pointing_right::backhand_index_pointing_right::backhand_index_pointing_right::backhand_index_pointing_right::backhand_index_pointing_right::backhand_index_pointing_right::backhand_index_pointing_right::backhand_index_pointing_right::backhand_index_pointing_right: :face_with_tears_of_joy::rolling_on_the_floor_laughing::face_with_tears_of_joy: #Humor #WorldHealthOrganization #coronavirus #wuhan #pandemic
2231706160347441837; 0; False; 1580260127; ¿Sabías que lavarte las manos puede evitar que contraigas enfermedades diarreicas, hepatitis A, influenza y el #coronavirus entre otras? Recuerda lavar con jabón tus palmas, el dorso de las manos, los espacios entre los dedos y las muñecas #Lafelab #AlCuidadoDeTuSalud
2231706148451420827; 0; False; 1580260126; Tiddy . . . . . . . . . . . . - Discord Server In Bio! - . . . . . . . #meme #memes #funny #dankmemes #memesdaily #funnymemes #lol #dank #humor #like #follow #lmao #dankmeme #edgymemes #offensivememes #anime #love #coronavirus #comedy #dailymemes #edgy #fun #xbox #metalmemes #ps4 #discord #discordserver #offensivememes #ww3memes #ww3
2231706154015563963; 0; False; 1580260126; Jam 09.00 - 12.00 slow response ya.. . :heavy_minus_sign::heavy_minus_sign::heavy_minus_sign::heavy_minus_sign::heavy_minus_sign::heavy_minus_sign::heavy_minus_sign::heavy_minus_sign::heavy_minus_sign::heavy_minus_sign::heavy_minus_sign: . Follow:down_arrow::down_arrow::down_arrow: . @kaldujamur_bogor @kaldujamur_bogor @kaldujamur_bogor . . Kaldu Alami cap Jamur merang :ballot_box_with_check:non MSG :ballot_box_with_check: Non pengawet :ballot_box_with_check: Halal :ballot_box_with_check: BPOM RI :ballot_box_with_check: Non perwarna :ballot_box_with_check: Dari Bahan alami berkualitas. . Info order: 0856-1442-892 . . #kaldujamur #kaldunonmsg #kaldujamurmerang #kaldusehat #kaldumpasi #jualkaldujamur #kaldujamurbogor #jualkaldujamurbogor #jualkaldujamurmerang #jualkaldunonmsg #tipsmasakan #tutorialmemasak #resepmasakan #jurussehatrasulullah #hidupsehatalami #masakansehat #mpasihomemade #bekalsuami #bekalanaksehat #masakanrumahsederhana #masakanbunda #foodprepation #kulinerbogor #oleholehbogor #bumbumasakan #sarapanpagi #penyedapmasakanalami #ellyrismanparenting #coronavirus #wuhan
2231706140643056792; 0; False; 1580260125; :microbe::microbe::microbe: (Follow me @memes_junkie) :syringe: :syringe: :syringe: :syringe: #memesjunkie #memesfordays #petty #share #laughdaily #savage #savageaf #meme #memes #follow #dead #pettymemes #viralmemes #viral #dankmemes #yikes #facts #triggered #love #oof #wish #coronavirus #coronavirusmemes #shipping #wishshopping
2231705517915353838; 0; False; 1580260105; Jepang mengirimkan pesawat untuk mengevakuasi 200 warganya yang berada di tempat bermulanya wabah virus Corona. Ada sekitar 650 warga negara Jepang di Wuhan yang mengatakan ingin pergi meninggalkan kota itu. Jepang juga akan menerbangkan 1 atau 2 pesawat susulan untuk menjemput warga negaranya yang tersisa. Pesawat yang dicharter pemerintah Jepang itu juga membawa petugas medis lengkap dengan perlengkapannya. Ini adalah kali pertamanya Jepang mengevakuasi warganya dari luar negeri akibat mewabahnya penyakit menular. ⁣ ⁣ Virus Corona memiliki periode waktu inkubasi selama 14 hari dan bisa menyebabkan pneumonia. Virus ini bisa menyebar melalui batuk dan bersin ataupun melalui kontak langsung dengan penderita. Transmisi dari manusia ke manusia, selain di China juga telah terjadi di Jepang dan Jerman. Lebih dari 100 orang yang telah meninggal akibat virus ini.⁣ ⁣ Sumber: Japan Times, South Morning China Post, ANN News.⁣ ⁣ #jepang #jepun #japan #wuhan #china #coronavirus #viruscorona
2231705962058083334; 0; False; 1580260103; The Coronavirus Is a Threat to the Global Drug Supply. https://www.wired.com/story/the-coronavirus-is-a-threat-to-the-global-drug-supply/ #coronavirus #coronavirusupdates #Coronavirus888
2231705654045015740; 0; False; 1580260093; #flushot #flushots #vaccine #vaccines #predictiveprogramming #statist #statism #rothschild #taxes #buildthewall #buildthatwall #endthefed #libertarian #corruption #falseflag #agenda21 #conspiracy #taxationistheft #donaldtrump #trump #government #makeamericagreatagain #maga #republican #illuminati #newworldorder #thesystem #liberal #democrat #coronavirus
2231705841025860263; 0; False; 1580260089; The probably just want me for my Coronas too... so sick:pensive_face: ~ Follow @baby_yodaboi for daily laughs :fire: . . . . . #BabyYodaBoi #babyyoda #babyyodamemes #coronavirus #epidemic #china #wuhan #asiangirls #downwiththesickness #savagememe #starwarsmemes #starwarsdaily #starwarsnerd #disneyplus #disneyfanatic #disneycharacters #corona #cerveza #beer #funnymemes
2231705826900741794; 0; False; 1580260087; #coronavirus #china #meme #piada #zueira #zueirasemlimites
2231705812572968604; 0; False; 1580260086; Amen :folded_hands_medium-light_skin_tone::red_heart::raising_hands: #Amen #Jesus #Church #Godisgood #blessed #Bible #Church #Christian #gym #coffee #sports #love #igdaily #reading #books #God #jesussaves #forgiven935 #jesuschrist #fishing #nba #coronavirus #war #saved
2231705796299076709; 2; False; 1580260084; Li Xian proposes New Year in the cloud Li Xian : Don’t go to crowded areas and don’t give viruses a chance! The condition is ruthless and the world is affectionate. Let us act for our own health and for the well-being of everyone! Wuhan fighting! @mr.lixian #Wohan #Coronavirus #ไวรัสโคโรน่า #电影抵达之谜 #TheEnigmaofArrival #李现抵达之谜 #lixian #mrlixian #李现 #李现ing #lixianthaifan #lixianthaifc #lixianthailandfc #lixianthfc #หลี่เซี่ยน李现lixianfcthailand #lixianthailandfanclub #หลี่เซี่ยนthfc #หลี่เซี่ยน
2231705351433472272; 3; False; 1580260077; When you owe her child support Tag your friends and share ________________________________________ #coronavirus #coronavirusmemes #coronavirusoutbreak #akissj #funnymemes #darkhumor #darkhumormemes #tiktokmemes #darkjokes #funnyhoodvidz #funnyhoodvids #funnyvideos #memedaily #dailymemes #vines #funnyvines #viralvideos
2231704646739937801; 0; False; 1580260076; Share this with friends and family to get them aware of this new virus! Concerns are growing about the deadly new virus behind a fast-spreading epidemic in China. The number of people ill with or dying of a viral pneumonia caused by the new coronavirus is rising rapidly. So far, this disease has infected more than 5,300 people and killed at least 130 people. The symptoms of wuhan coronavirus usually takes around 5 days to kick in; but it may take as long as 14 days. Symptoms include fever, cough, pneumonia, and a shortness of breath. However, it was noted that some people with this disease had very mild symptoms so that the virus is very difficult to detect. Furthermore, it’s observed that the virus can be spread even before the symptoms appear. This virus is likely spread through a cough, sneeze, kiss or other contact with saliva. Keep in mind that it’s also possible to get the virus when an infected person sneezes on a doorknob, you touch the doorknob, then lick your hand without washing it carefully with soap. So make sure to wear a mask in crowded places, wash your hands often, and avoid rubbing your eyes or touching your nose/mouth with your hands. Countries with Confirmed Cases: China (obviously) Thailand- 14 Hong Kong- 8 Japan-7 US,Taiwan,Australia,Macau- 5 each Singapore,S Korea,France,Malaysia-4 each Canada- 3 Vietnam- 2 Nepal, Cambodia, Germany- 1 each If you live in any of these countries, keep in mind that the symptoms can appear as late as 2 weeks after a person gets infected. This means that an infected person could spread the virus to many people before noticing the symptoms and going to the hospital. SO PLEASE STAY SAFE! #coronavirus #wuhancoronavirus
2231705699160066412; 0; False; 1580260072; WASPADA VIRUS CORONA Oleh : Ummi Sabil (Herbalist Consultant HNI) Cegah dengan langkah-langkah berikut ini: 1. Senantiasa cuci tangan agar tetap bersih (Gunakan Sabun Propolis) 2. Gunakan masker saat di luar rumah (Tempelken Hibis Panty untuk lebih segar) 3. Tubuh kuatkan imunitas dengan Herba HNI . :black_small_square:MADU MULTI/PREMI/SJ/HITAM Dosis 3x2 sdm /anak anak 3x1 sdm :black_small_square:SPIRULINA/ROSELA/EGM 1 Sachet Dosis 3X3 kps Anak Anak 3x1 kps . :black_small_square: PROCUMIN PROPOLIS/PROCUMIN HABBTS /HABBTS GEL Dosis 3x2 kps Anak Anak Disediakan . :black_small_square:GAMAT/DEEP SQUA 3X2 kps Insya Allah Diberi Kesehatan Dengan ikhtiar sebisa mungkin . Allah Maha Penyembuh Bismillah Biidznillah #hnihpai #vegancommunity #herbs #coronavirus
2231705658248713926; 1; False; 1580260067; #prayforchina :folded_hands: #coronavirusoutbreak #coronavirus #virus #world #punjab #alert #india #canada #mumbai #amritsar #viral #danger #humanbody #boy #men #girl #jarmannjatt #travel #airpot #city #town #science #knowledgeworld
2231705638072068583; 1; False; 1580260065; 9.04am Sai Ying Pun, HONG KONG :Hong_Kong_SAR_China: rush hour #coronavirus
2231705592488995181; 0; False; 1580260059; I’m actually scared :persevering_face: #corona #virus #viral #coronavirus #scared #meme #memes
2231705109431969230; 2; False; 1580260057; #Repost @cordova.media • • • • • • Tokyo, Japan Jepang mengirimkan pesawat untuk mengevakuasi 200 warganya yang berada di tempat bermulanya wabah virus Corona. Ada sekitar 650 warga negara Jepang di Wuhan yang mengatakan ingin pergi meninggalkan kota itu. Jepang juga akan menerbangkan 1 atau 2 pesawat susulan untuk menjemput warga negaranya yang tersisa. Pesawat yang dicharter pemerintah Jepang itu juga membawa petugas medis lengkap dengan perlengkapannya. Ini adalah kali pertamanya Jepang mengevakuasi warganya dari luar negeri akibat mewabahnya penyakit menular. ⁣ ⁣ Virus Corona memiliki periode waktu inkubasi selama 14 hari dan bisa menyebabkan pneumonia. Virus ini bisa menyebar melalui batuk dan bersin ataupun melalui kontak langsung dengan penderita. Transmisi dari manusia ke manusia, selain di China juga telah terjadi di Jepang dan Jerman. Lebih dari 100 orang yang telah meninggal akibat virus ini.⁣ ⁣ Sumber: Japan Times, South Morning China Post, ANN News.⁣ ⁣ #jepang #jepun #japan #wuhan #china #coronavirus #viruscorona
2231705496256419627; 0; False; 1580260056; Alhamdulillah kak mira jadi host #meletop Reposted by: @mylovelymf Kita just post one video jer for tonight sbb video nih I rasa paling cutee!!!!:smiling_face_with_heart-eyes::smiling_face_with_heart-eyes::smiling_face_with_heart-eyes: . . Meletop setiap hari selasa, 9.00 malam, Astro RIA dan RIA HD . . . #MiraFilzah:red_heart:#Meletop #nabilahmad #cute #astroria #astro #goodnight:sparkles: #sweetdreams #jujurlahnikahiaku #tolongsempurnakanceritamami #coronavirus #sakit
2231705520096832376; 1; False; 1580260051; Push Day! AKA Chest, Shoulders, Tris I’ve got some good news and I’ve got some bad news. Bad news: as probably all of you know that China (among some other countries) is experiencing a Coronavirus. Because of this, many places are closing down for a while...including my gym. So sad, I know. Good news: I will be recording more home videos now so let me know what you wanna see!!! :partying_face: This was the last workout I was able to record before the gym closed. Also, my tripod broke. I apologize for the strange angles! Push Day Workout: :spouting_whale: Bench Press 4x12-10-8-6 :spouting_whale: Cable OHP 4x10 :spouting_whale: Tricep Pressdown 4x12 :spouting_whale: SS Chest Press 4x8 :spouting_whale: SS Plate Press 4x8 :spouting_whale: SSS Lateral Raise 4x8 :spouting_whale: SSS Lateral Raise (Palms Towards) 4x8 :spouting_whale: SSS Front Raise 4x8
2231705489811514298; 0; False; 1580260047; @netflixbolada :red_heart: . #brasilmemes#bolsonaro #memes#sam#instagram #bbb20#comedia#engracado #trouxa#ciumes#facebook#memesbrasileiros #tinder #soueunavida#piadas#humor #quemnunca#memesbrasileiros#risadas #china #risos#dollypartonchallenge #boanoite#netlix#youtuber #tsunami #series#comedia #frasesengracadas #bbbxp2020 #coronavirus
2231705427014444189; 1; False; 1580260040; Fuck everyone who listens to Cardi B . . . . . . . . . . . - Discord Server In Bio! - . . . . . . . #meme #memes #funny #dankmemes #memesdaily #funnymemes #lol #dank #humor #like #follow #lmao #dankmeme #edgymemes #offensivememes #anime #love #coronavirus #comedy #dailymemes #edgy #fun #xbox #metalmemes #ps4 #discord #discordserver #offensivememes #ww3memes #ww3
2231703052016913737; 5; False; 1580260035; Chilll:loudly_crying_face: Follow me @lu_cio.intern . . . . . . . . . . . Ignore the tags . . . . . . . . . . . . . . . . . . #coronavirus #corona #cdc #china #jokes #memes #dailymemes #lmao:face_with_tears_of_joy::face_with_tears_of_joy::face_with_tears_of_joy: #toofunny #comedy #humor #explorepage #explore #funnyvideos #funnyvideosdaily #haha #dankmemes #zombies #callofduty #callofdutymemes #followme #instagood #hilarious
2231705375049374292; 0; False; 1580260033; China is able to build a hospital in 6 days! #武汉肺炎 #武汉肺炎病毒 #coronavirus #wuhanvirus# BBC# China#chinavirus# how worried should we be# believe in chinese##brave#
2231705341025067061; 0; False; 1580260029; Kaldu Original (Jamur) bisa untuk semua masakan . :heavy_minus_sign::heavy_minus_sign::heavy_minus_sign::heavy_minus_sign::heavy_minus_sign::heavy_minus_sign::heavy_minus_sign::heavy_minus_sign::heavy_minus_sign::heavy_minus_sign::heavy_minus_sign: . Follow:down_arrow::down_arrow::down_arrow: . @kaldujamur_bogor @kaldujamur_bogor @kaldujamur_bogor . . Kaldu Alami cap Jamur merang :ballot_box_with_check:non MSG :ballot_box_with_check: Non pengawet :ballot_box_with_check: Halal :ballot_box_with_check: BPOM RI :ballot_box_with_check: Non perwarna :ballot_box_with_check: Dari Bahan alami berkualitas. . Info order: 0856-1442-892 . . #kaldujamur #kaldunonmsg #kaldujamurmerang #kaldusehat #kaldumpasi #jualkaldujamur #kaldujamurbogor #jualkaldujamurbogor #jualkaldujamurmerang #jualkaldunonmsg #tipsmasakan #tutorialmemasak #resepmasakan #jurussehatrasulullah #hidupsehatalami #masakansehat #mpasihomemade #bekalsuami #bekalanaksehat #masakanrumahsederhana #masakanbunda #foodprepation #kulinerbogor #oleholehbogor #bumbumasakan #sarapanpagi #penyedapmasakanalami #ellyrismanparenting #coronavirus #wuhan
2231705231570183364; 0; False; 1580260016; Você sabe como se prevenir contra o novo CORONA VÍRUS? :hand_with_fingers_splayed:lave as mãos com sabão e água ou com álcool, principalmente antes de consumir algum alimento. Utilize lenço descartável para higiene nasal. Cubra nariz e boca quando espirrar ou tossir. Evite tocar mucosas de olhos, nariz e boca. Higienize as mãos após tossir ou espirrar Não compartilhe objetos de uso pessoal, como: talhares, copos, garrafas. Mantenha ambientes bem ventilados. Evite contato próximo a pessoas que apresentem sinais ou sintomas da doença. _____________ Humanizar Atendimento Especializado de Enfermagem. Rua Rosolino Ferreira Guimarães, 766 Centro Rio Verde/GO Plantão: 64 9.9247-9474 64 9.9986-1217 #coronavirus #humanozar #rioverde #goias
2231705152547646037; 0; False; 1580260007; Waspadai corona virus yang sedang melanda beberapa negara di berbagai belahan dunia . Apa itu Corona virus ? Apa saja gejala yang ditimbulkan? Dan bagaimana cara mencegahnya? Cari tahu infonya di postingan instagram Jimshoney yuk! Dan jangan lupa untuk selalu waspada dan jaga kesehatan kamu ya! . #staysafe #corona #coronavirus #jimshoney #jimshoneypekanbaru #pekanbaru
2231704218435496887; 0; False; 1580259947; Braapping News #Coronavirus • Part. 2 (Pencegahan) Hal² mudah sebagai upaya pencegahan penyebaran virus. Selamat mencoba :folded_hands:
2231704143584522487; 0; False; 1580259887; Standard protection gear against #coronavirus aka #wuhanvirus :microbe: #ShotoniPhone #streetphotography #HongKong #
2231704078235384256; 0; False; 1580259879; #sahabatprima, yuk, kita tingkatkan Kewaspadaan mengenai corona virus yang sedang melanda beberapa negara di berbagai belahan dunia. Apa gejala yang ditimbulkan? Dan bagaimana cara mencegahnya? yuk kita simak ! Semoga wabah ini segera mereda dan tidak menyebar semakin luas ya #sahabatprima _________________________________________ www.primamedika.com #primamedikahospital #virus #coronavirus #viruscorona #wuhan #denpasar #bali
2231703327531752953; 0; False; 1580259789; APAKAH ITU NOVEL CORONAVIRUS? . Menurut Pertubuhan Kesihatan Sedunia (WHO), wabak coronavirus dikesan selepas organisasi itu dimaklumkan terdapat beberapa kes radang paru-paru di bandar Wuhan, di wilayah Hubei, China . Virus baru itu adalah coronavirus, yang merupakan keluarga yang termasuk selsema biasa, dan virus seperti Sars dan Mers. Virus baru ini buat sementara waktu dinamakan sebagai 2019-nCoV . 3 LANGKAH PENCEGAHAN CORONAVIRUS YANG PERLU ANDA TAHU . Mengamalkan tahap kebersihan diri yang tinggi adalah antara langkah perlindungan boleh dilakukan orang ramai untuk mencegah jangkitan coronavirus 2019-nCoV . Langkah pertama yang dicadangkan Kementerian Kesihatan (KKM) kepada orang ramai adalah mengamalkan tahap kebersihan diri yang tinggi iaitu kerap mencuci tangan dengan menggunakan air dan sabun atau bahan pencuci tangan (hand sanitizer) . Langkah kedua adalah penting sekiranya tidak berada dalam tempoh lawatan ke lokasi-lokasi yang berlakunya wabak dan elakkan bersentuhan dengan individu yang mempunyai gejala ini . Jika perjalanan tidak dapat dielakkan, sentiasa bawa bersama penutup mulut dan hidung (mask) serta bahan pencuci tangan . “Elakkan dari melawat ladang haiwan, pasar menjual haiwan hidup, tempat sembelihan atau menyentuh sebarang jenis haiwan. Masak daging dan produk-produk tenusu lain dengan sempurna . Elak dari mengunjungi tempat tumpuan ramai dan bergaul rapat dengan individu yang mempunyai gejala serta elak dari makan sebarang produk haiwan mentah atau tidak dimasak dengan sempurna,” kata KKM yang berkongsi poster langkah pencegahan yang dikongsi bersama orang ramai menerusi sesawang Facebooknya . Langkah ketiga perlu diambil orang ramai adalah segera mendapatkan rawatan perubatan sekiranya jatuh sakit iaitu mengalami gejala jangkitan pernafasan seperti demam, batuk atau sukar bernafas dalam tempoh 14 hari selepas pulang dari lawatan dan maklumkan mengenai sejarah perjalanan kepada doktor yang merawat . Zatil:rose: WA +601123621457 Member ID: 21444717 Trusted Independent Distributor YOUNG LIVING MALAYSIA . #youngliving #younglivingshahalam #owldiffuser #desertmistdiffuser #ningxiared #thieveshandpurifier #thievesspray #coronavirus
2231702781994261257; 0; False; 1580259724; #dankmemes #memes #simpsonsmemes #coronavirus
2231702418205534509; 0; False; 1580259681; #dankmemes #memes #coronavirus
2231702162059375831; 0; False; 1580259650; #dankmemes #memes #coronavirus
2231693081987826698; 1; False; 1580258568; :sun: Arrogance:high_voltage: . . Pada saat pelayaran perdana Titanic, 10 April 1912, orang-orang kagum pada kemegahan kapal ini. Di koran The Star Line, berita launching kapal tersebut deberi tajuk.... "NOT EVEN GOD HIMSELF COULD SINK THIS SHIP" Namun ternyata kapal yang katanya "unsinkable" ini tenggelam hingga ke dasar Atlantik hanya setelah 4 HARI pelayarannya. . . Dan berikut adalah kutipan pidato presiden China, Xi Jinping saat anniversary 70 tahun perintahan komunis, sebelum wabah Corona di Wuhan.... "NO FORCE could stop Chinese people and the Chinese nation forging ahead." . . Well, I don't see any difference between those two. Sama-sama songong (btw, songong dan sombong itu artinya sama nggak sih? :beaming_face_with_smiling_eyes:). Sama-sama nantangin Allah. "Even God" dan "No force" pulak katanya! Astaghfirullah.... . . We see, sangat sering Allah menunjukkan ke-Maha Kuasaannya secara kontan pada orang-orang sombong. Supaya mereka dan manusia lainnya sadar bahwa daya upaya mereka hanya butiran debu. Sehebat apapun, jika Allah tak ridha maka tinggal menunggu kehancurannya. Kalau sudah begini, innocent people pun ikut jadi korban. Maka berhati-hatilah. Sombong itu jubahnya Allah. So, don't wear it! . . La hawla wala quwwata illa billah.... . . . . Pic. Cover quran motif floral yang klasik dan cantik, pesanan mba Ika (Legok). Syukran :bouquet: . . #cover403 #qurancover #sampulquran #sampulcantik #coverqurancantik #customsampulquran #suvenircoverquran #suvenirunik #kadonikah #kadounik #titanic #coronavirus #TheStarLine #sampul #cover #customorder #handmade
2231678420545575715; 1; False; 1580258155; Seems like an unlikely combination of subjects to speak to, but the Coronavirus is having a direct impact on mortgage rates in Canada. Watch to understand why.
2231633694503166041; 1; False; 1580251488; #우한힘내라#wuhanjiayou#武汉加油#코로나#코로나바이러스#corona#coronavirus
2227251441431988835; 0; False; 1579729083; Terimakasih yg telah memberi support saya selama mengerjakan ujian akhir ini dengan doa dan motivasi secara mendalam. #coronavirus #viruscorona #traintobusan #wuhan #hubei #beijing #uyghur #xinjiang #theflu #mers #sars #2019 #2020 #umm #ummmalang #esemkita #tibet #tulungagung #worldwarz #zombieland #plantsandzombies #thehouseofdead #residentevil #callofduty #malang #blitar #kediri #harusnyaaku #universitasmuhammadiyahmalang #rrc
2231705140862916897; 4; False; 1580260006; :rolling_on_the_floor_laughing::rolling_on_the_floor_laughing::rolling_on_the_floor_laughing::rolling_on_the_floor_laughing::rolling_on_the_floor_laughing: Me funciono en el banco. :face_with_tears_of_joy::face_with_tears_of_joy::face_with_tears_of_joy::face_with_tears_of_joy::face_with_tears_of_joy: Salió todo el mundo corriendo y me dejaron sola en la fila. #virus#corona #coronavirus
2231705140006737808; 0; False; 1580260005; Corona extra rn . . . . . . . . . . . . - Discord Server In Bio! - . . . . . . . #meme #memes #funny #dankmemes #memesdaily #funnymemes #lol #dank #humor #like #follow #lmao #dankmeme #edgymemes #offensivememes #anime #love #coronavirus #comedy #dailymemes #edgy #fun #xbox #metalmemes #ps4 #discord #discordserver #offensivememes #ww3memes #ww3
2231705065291004318; 0; False; 1580259997; Salam Sehat :folded_hands_medium-light_skin_tone: Yuk jaga kesehatan diri dan keluarga dengan GERMAS Berikut contoh perilaku GERMAS yang dapat anda terapkan sebagai langkah pencegahan #coronavirus #germas #phbs #cegahviruscorona #cegahcorona #coronavirus #perilakuhidupsehat
2231704985170998858; 1; False; 1580259987; First shot at Nashville Hot chicken :hot_pepper::hot_pepper::drooling_face::drooling_face: . . Wet brine overnight of buttermilk, pickle juice, salt, and hot sauce. . Dry brine of cayenne pepper, chili powder, smoked paprika, brown sugar, Cajun seasoning, and crushed red pepper. . Double dredged, and fried until 165 internal temp. Served over white bread to soak up juices. . 2 cups of hot oil mixed with dry seasonings for outer layer of Nashville hot sauce. . . . . . #nashvillehotchicken #hotchicken #friedchicken #deepfried #hotsauce #nashvillefood #eastvillagenyc #guyfieri #hattiebs #hattiebshotchicken #anthonybourdain #bobwhite #jamaica #earthquake #justinbeiber #bradleycooper #coronavirus #superbowl #superbowl2020 #foodporn #recipe #eeeats #cookingvideo
2231704952296017105; 0; False; 1580259983; Apakah dalam waktu dekat ini kamu (terpaksa) harus mengunjungi negara atau wilayah yang sudah terjangkit Novel Coronavirus? Sangat disarankan untuk tetap menjaga kesehatan serta kebersihan tubuh agar terhindar dari risiko Novel Coronavirus dengan cara di atas! Yuk bagikan informasi penting ini ke seluruh teman atau keluarga kamu lainnya! #denterprising_community #coronavirus #viruscorona #denterprising
2231704894153289877; 0; False; 1580259976; Waspadai corona virus yang sedang melanda beberapa negara di berbagai belahan dunia . Apa itu Corona virus ? Apa saja gejala yang ditimbulkan? Dan bagaimana cara mencegahnya? Cari tahu infonya di postingan instagram Jimshoney yuk! Dan jangan lupa untuk selalu waspada dan jaga kesehatan kamu ya! . #staysafe #corona #coronavirus #jimshoney #jimshoneypekanbaru #pekanbaru
2231704889457402033; 0; False; 1580259976; rest and relaxation #coronavirus #coronalove #healing #yearoftherat #divine #oprah #joelosteen
2231702365835961553; 0; False; 1580259974; Chinese authorities ramped up efforts on Friday to control the spread of a deadly novel coronavirus, turning a toll gate leading into the city of Wuhan into a makeshift checkpoint. Sourced via @globalnews⁠ #6ixviews #issating #movethecultureforward:double_exclamation_mark:⁠ #Coronavirus #Wuhan #Health
2231702524439959340; 0; False; 1580259974; Piralaaaaaaaaaaa, mi pana :face_with_tears_of_joy::face_with_tears_of_joy::face_with_tears_of_joy::face_with_tears_of_joy::man_facepalming_medium-light_skin_tone::man_facepalming_medium-light_skin_tone::man_facepalming_medium-light_skin_tone: #coronavirus #Nojuegacarrito #quelocura #comermurcielagos
2231704713909168350; 0; False; 1580259955; Koronavirus adalah virus dari familia Coronaviridae yang dapat menyebabkan penyakit pada burung dan mamalia (termasuk manusia). . Struktur tubuh virus (virion) ini terdiri dari membran, selubung lipid bilayer (envelope), glikoprotein yang menyerupai paku (spike), genom RNA positif, dan protein nukleokapsid. . Glikoprotein koronovirus dapat berikatan dengan glikoprotein permukaan sel inang secara spesifik untuk memulai terjadinya infeksi. . Koronavirus diklasifikasikan menjadi tiga golongan utama, golongan 1 dan 2 menginfeksi mamalia, mulai dari kelelawar hingga manusia, sedangkan golongan 3 hanya ditemukan pada spesies avian (burung). . Infeksi virus ini dapat menimbulkan gejala penyakit yang bervariasi, mulai dari hampir tidak timbul gejala apapun hingga gejala yang fatal dan cepat. . Infeksi koronavirus dapat menyebabkan berbagai penyakit, seperti bronkitis, ensefalitis, gastroenteritis, dan hepatitis. . Sumber : wikipedia #viruscorona #coronavirus #china #cina #tiongkok #kelelawar #mamalia #corona #virus #hottopic #kesehatan #infokesehatan #waspadaviruscorona #sehat #smkn1kademangan #skaneka_hits #skaneka
2231704651120504033; 0; False; 1580259947; #wuhan #coronavirus #cure #alcohol #funnymemes #memes #funny #funnyaf
2231704633141636289; 0; False; 1580259945; Waspadai corona virus yang sedang melanda beberapa negara di berbagai belahan dunia . Apa itu Corona virus ? Apa saja gejala yang ditimbulkan? Dan bagaimana cara mencegahnya? Cari tahu infonya di postingan instagram Jimshoney yuk! Dan jangan lupa untuk selalu waspada dan jaga kesehatan kamu ya! . #staysafe #corona #coronavirus #jimshoney #jimshoneypekanbaru #pekanbaru
2231704574205182286; 0; False; 1580259938; Bahwa #coronavirus Telah terlibat dengan lebih dari 2500terinfeksi + 290 orang
2231704539056436023; 2; False; 1580259934; #vaccine #coronavirus #prophecy #MDM #Catholic Their wicked plans also include a new global vaccination which will create disease all over the world. June 17, 2012 My dearly beloved daughter the plans of the Masonic groups to take over the world currencies are getting close to completion. Their wicked plans also include a new global vaccination which will create disease all over the world to cause suffering on a scale never seen before. Avoid any such sudden global vaccination announced for it will kill you. Their evil schemes would shock all those innocent souls who have no idea how powerful they are. Driven by a lust for power, wealth and a desire to be godlike in all they do, they believe they are invincible. They control banks, governments and are responsible for causing terror in the Middle East. They control much of the world’s media and the truth of their wickedness is hidden behind so called humanitarian organisations. Sadly very few of God’s children know of their plans. Know that the hand of My Father will fall so suddenly and swiftly on those nations who protect such evil leaders. They will be struck with Tsunamis and earthquakes of such a magnitude that they will be wiped out. Those who believe that they are so powerful will see fire falling from the skies just before My Second Coming. The seas will become lakes of fire and they will find it hard to hide from the hand of punishment poured out upon those wicked souls who will refuse My Cup. Defiant up to the end they will fight My Eternal Father and the power of the Heavens. Siding with the antichrist, from the groups from which he evolves, they will realise the error of their ways when it is too late for them. Many of these groups, including leaders of banks, governments, heads of large businesses all of them interlinked, and working together to make paupers out of ordinary people, will convert after The Warning. So this is good. The time for me to separate those souls who love me from those who side with the evil one is not far away. Be warned. There will only be so much time in which to convert. The souls most in need of My Mercy belong to these wicked groups who have no respect for
2231704482851576030; 0; False; 1580259927; #Nacionales | Alerta sobre un caso sospechoso de #Coronavirus en nuestro país. El titular de la cartera de Salud, Julio Mazolenni, en conferencia de prensa, descartó un caso de coronavirus. Sin embargo confirma que un ciudadano extranjero residente en el país que estuvo por China Continental y volvió de sus vacaciones hace unos pocos días, presenta un cuadro clínico de la enfermadad. De los 35 pasajeros provenientes de China, se encuentran en vigilancia, 13 de ellos están descartados sin desarrollar sintomas. El paciente con el caso sospechoso, se encuentra en su domicilio bajo vigilancia, colaborando con el Ministerio de Salud. La muestra se enviará mañana miércoles a Atlanta (Estados Unidos) para confirmar o descartar un posible caso de coronavirus en el país. Aunque por el momento solo hay un caso sospechoso, las autoridades sanitarias están prestando especial atención a la zona de Alto Paraná, donde existe más circulación de ciudadanos hacia China continental. Foto: Unicanal.
2231699671675783126; 0; False; 1580259919; Sobre quem sente medo e receio de ir para a Coréia do Sul :South_Korea::South_Korea::South_Korea: por conta do #coronavirus . Na coreia sempre vi muitas pessoas usando máscaras a caminho do trabalho por conta da poluição da #china e agora com medo do novo vírus corona, muitos produtos antibacterianos estão sendo utilizados, tais como álcool em gel e a máscara de rosto a todo momento, evitando contato direto pelo ar. De verdade a melhor maneira de evitar isso também, seria a lavagem da mão frequente, sabem que cuidado é válido!! E por fim, siiiim podemos aproveitar tomando esses cuidados principais :slightly_smiling_face::slightly_smiling_face: Ainda restam alguns meses e muita coisa pode acontece, mas sentem dúvidas sobre a VIAGEM DA CORÉIA?? :South_Korea::South_Korea::South_Korea: #Repost @marieclairekorea with @get_repost ・・・ 신종 코로나 바이러스의 공포로 출근길, 마스크를 쓴 모습이 많이 보이죠. 손 세정제와 알콜스왑 등의 소독제들도 불티나게 팔리고 있는데요. 최선의 예방법은 바로 올바른 손씻기! #인싸인턴 이 깨끗히 손 씻는 법을 영상으로 알려드릴게요. #EDITOR_HKH - Follow these steps to Wash Your Hands the Right Way. - #코로나바이러스 #예방 #손씻기 #우한폐렴
2231704407790959393; 0; False; 1580259918; #HastaMañana . . . Consciente de que su país libra una batalla contra el “demonio” del #Coronavirus, #XiJinping le pide transparencia a su propio gobierno en los esfuerzos para contener la #Epidemia ¡Entérate en el link de nuestra Bio! . . . #Actualidad
2231704310306889379; 3; False; 1580259917; Are you so selfish as to only stop eating the corpses of innocent animals solely out of fear of infectious diseases? ⁠ ⁠ The consumption of animal body parts has been linked to diseases like mad cow disease, bird flu, swine flu and, most recently, the coronavirus, whose origins are believed to trace back to a Chinese meat market in the city of Wuhan. ⁠ ⁠ The virus has infected more than 2,700 people and killed 80 as of last Sunday.⁠ ⁠ Do we need a pandemic for the most selfish people in modern times to stop consuming animal flesh and secretions? ⁠ ⁠ Some people have suggested going “vegan” due to these concerns, but here’s the thing: there are no vegans out of FEAR, just like there are no vegans "for health" or "the environment".⁠ ⁠ People go vegan for justice; plant-based for other reasons. ⁠ ⁠ Veganism is not a diet, but a rejection of all animal use and exploitation for human purposes. ⁠ ⁠ The reason why we defend the term veganism so vehemently is that the word is supposed to convey an ethical stance and defend the rights of the most innocent and oppressed: non-human animals.⁠ ⁠ #Coronavirus #health #virus #pandemic #meat #meatlover #ketodiet #carnivore #paleo #speciesism #animals #animalrights #vegan #vegansofIG
2231704387347063201; 0; False; 1580259916; Got to work today and it's like on the way there and back niggas had on masks! Get the fuck back home and a nigga dead caught the fuckin #Coronavirus :woman_facepalming_medium-dark_skin_tone:
2231704386063875723; 0; False; 1580259916; #coronavirus
2231704356017048554; 0; False; 1580259912; Mensaje del Ministerio de Salud sobre el #CoronaVirus
2231704321288073543; 0; False; 1580259908; FUNGSI UTAMA MUNCORD: • -Meningkatkan imunitas terhadap berbagai penyakit. -Mencegah tumor. -Menambah tenaga. -Meningkatkan kualitas tidur. -Menghilangkan rasa letih. -Meningkatkan fungsi seksual. -Mengatasi berbagai penyakit pernapasan. -Meningkatkan daya tahan tubuh terhadap radiasi. -Menghambat proses penuaan tubuh. -Menurunkan kadar lemak darah, mengurangi resiko penyakit pembuluh darah jantung dan otak. -Sebagai antibiotik alami yang dapat menyembuhkan berbagai penyakit infeksi tanpa adanya efek samping. -Memperbaiki berbagai penyebab gangguan fungsi liver dan penyakit diabetes. • SIAPA SAJA YANG DIANJURKAN UNTUK MENGKONSUMSI MUNCORD? • -Individu bertubuh lemah atau berdaya tahan tubuh rendah yang mudah terserang flu atau penyakit-penyakit umum. -Perokok, penderita batuk, batuk berdahak, dan penderita sesak napas. -Penderita berbagai penyakit atau yang berada dalam masa pemulihan setelah operasi. -Individu dengan gangguan fungsi seksual. -Penderita hiperlipidemia dan penyakit -pembuluh darah jantung. -Penderita diabetes. -Individu dengan gangguan fungsi liver. -Individu yang menjalani radioterapi dan/atau kemoterapi setelah operasi pengangkatan tumor. -Pekerja yang sibuk dan sering lelah. -Individu bertekanan hidup berat dan berpola tidur buruk. -Individu dengan waktu kerja lama di hadapan komputer, telpon genggam dan berbagai peralatan gelombang mikro. TERSEDIA jga : Peninggi badan Pelangsing Penggemuk Masker Spirulina Nutrisi Ibu hamil Paket Kesuburan Paket Herbal buat Kanker/tumor, diabet, stroke dll.. #coronavirus#kekebalantubuh#imunitas#muncordtiens#china#bayikembar#promil
2231704254305251388; 0; False; 1580259900; -Dia 319 -Ya callate ching chong tu fuiste el que me pego el virus no yo a ti- #sebachupalo #picopalquelee #coronavirus #nosvamoamorir
2231704236579062671; 0; False; 1580259898; Del #cuantico todo se puede esperar #msp #leninmoreno #elgobiernodetodos #presidenciaec #coronavirus #salud #oms #Guayaquil #Ecuador #Quito #cuenca
2231703818869742036; 1; False; 1580259896; Jepang mengirimkan pesawat untuk mengevakuasi 200 warganya yang berada di tempat bermulanya wabah virus Corona. Ada sekitar 650 warga negara Jepang di Wuhan yang mengatakan ingin pergi meninggalkan kota itu. Jepang juga akan menerbangkan 1 atau 2 pesawat susulan untuk menjemput warga negaranya yang tersisa. Pesawat yang dicharter pemerintah Jepang itu juga membawa petugas medis lengkap dengan perlengkapannya. Ini adalah kali pertamanya Jepang mengevakuasi warganya dari luar negeri akibat mewabahnya penyakit menular. ⁣⁣ ⁣⁣ Virus Corona memiliki periode waktu inkubasi selama 14 hari dan bisa menyebabkan pneumonia. Virus ini bisa menyebar melalui batuk dan bersin ataupun melalui kontak langsung dengan penderita. Transmisi dari manusia ke manusia, selain di China juga telah terjadi di Jepang dan Jerman. Lebih dari 100 orang yang telah meninggal akibat virus ini.⁣⁣ ⁣⁣ Sumber: Japan Times, South Morning China Post, ANN News.⁣⁣ ⁣.⁣ .⁣ repost @cordova.media⁣ .⁣ ⁣ #jepang #jepun #japan #wuhan #china #coronavirus #viruscorona
2231704206984071981; 0; False; 1580259894; Quien dijo yo??? :raised_hand_medium-light_skin_tone::raised_hand_medium-light_skin_tone::raised_hand_medium-light_skin_tone: #triviasv #tuza #sivarescuela #colegio #memeros #tusa #meme #añonuevo #memes #momos #momazos #hermanas #sivar #sanvalentin #usulutan #launion #elsalvador #hermanos #seguime #siganme #siganmeparamasrecetas #memes #nostalgia #vacaciones #pilsenervirus #adiosvacaciones #elsalvadormemes #regresoaclases2020 #elcherovacilon #coronavirus
2231704159513939305; 0; False; 1580259889; *CorOna virus enters chat* #meme #memes #dankmemes #dankmemesdaily #memesdaily #corona #coronavirus #memes:face_with_tears_of_joy:
2231704113972691028; 0; False; 1580259883; Wabah penyakit corona mengharuskan kita untuk lebih memproteksi diri. Kira-kira untuk pemilihan masker, pilih yang mana ya sobat Genta? . Untuk penyakit-penyakit yang ditularkan lewat udara (airborne diseases) contohnya: Tuberculosis, virus-virus influenza seperti common cold sampai virus influenza mematikan SARS, MERS, dan yang sedang wabah n-Cov, yang direkomendasi adalah masker N95. . Fungsi respirator dan masker sama. Sama-sama menyaring partikel-partikel berbahaya supaya tidak terhirup oleh kita. Dan mencegah partikel dari pengguna menyebar keluar. Bedanya ada di seberapa kecil partikel yang dapat disaring oleh masker dan respirator ini. . N95 dinyatakan cukup efisien untuk memproteksi diri dan mencegah penularan dari pengguna (sumber CDC). Bakteri atau virus2 yang gampang menyebar dan kamu tau efeknya bahaya sekali (seperti SARS, MERS, Tuberculosis) wajib menggunakan N95. Tapi kalau common cold (flu biasa) masker biasa masih bisa dipakai. . Prinsipnya: 1. Kalau sobat Genta sakit (flu, batuk) intinya mengeluarkan virus atau bakteri lewat mulut dan kamu hendak berpergian terutama ke daerah padat orang seperti rumah sakit, angkutan umum dll, WAJIB gunakan masker/respirator. 2. Just to protect yourself... kalau sobat Genta sedang di tempat ramai, minimal gunakan masker. Nah kalau kita ke bandara atau pesawat atau kapal laut dimana memang lagi wabah seperti sekarang, boleh gunakan N95 di area2 tersebut. . Zaman sekarang banyak sekali variasi masker. Ada yg sekali pakai, ada yang bisa dicuci, ada yg bisa dipakai 1-3 bulan. Cari yang sesuai jg yah dengan kantong kita. Pilihan banyak kok. . Yuk, cegah penularan penyakit-penyakit yang ditularkan lewat udara. . #coronavirus #wabahpenyakit #lebihbaikmencegahdaripadamengobati #yukhidupsehat
2231703843406886776; 0; False; 1580259881; #Coronavirus | En China :China: dos ciudadanos se pelearon para poder comprar una mascarilla, debido a que ya no hay suficientes :prohibited: y las que se consiguen las venden muy caras. #wa80 #venezuela #venezolanos #venezuelaencrisis #venezuelalibre #venezuelalucha #maracaibo #caracas #tachira #zulia #barquisimeto #chamosencolombia #venezolanosenespaña #guanareportuguesa #barinas #venezolanosenecuador #sembradaenvenezuela #venezuelaenmiami #venezolanoseneldoral #venezolanosenchile #venezolanosenbogota #venezolanosenuruguay #venezuelaenlamira #venezolanosenquito #venezolanoseneldoral #guanareportuguesa #jguaido #venezuelaencrisisoficial
2231704091499647002; 1; False; 1580259880; Saw a couple masks today . . . #coronavirus #sketch #drawing #draw #practice #art #daily #dailypost #artistsoninstagram
2231703596991235249; 1; False; 1580259873; Seorang pejabat Kemenlu China, bernama Lijian Zhao memposting di akun twitternya, video pembangunan rumah sakit yang dibangun untuk pasien yang terjangkit virus Corona. Rumah sakit yang dibangun selama 16 jam ini, berbentuk box dilengkapi dengan teralis besi di jendelanya dan dan kunci yang diletakkan di pintu bagian luar.⁣⁣ ⁣⁣ Di postingan tersebut, ia juga menuliskan, "Let's pray for Wuhan & China", mari berdo'a untuk Wuhan dan China. Sudah jamak diketahui bahwasanya pemerintah China dari Partai Komunis China menganut paham atheisme. Namun dalam kondisi darurat seperti ini, salah satu anggotanya mengajak berdo'a untuk Wuhan dan China yang saat ini dilanda wabah virus Corona. Sudah menjadi fitrahnya, manusia bahkan ateis sekalipun, ketika dalam kesulitan, membutuhkan pertolongan dari Tuhan Yang Maha Kuasa.⁣⁣ ⁣⁣ "Dan dia dibantah oleh kaumnya. Dia berkata: 'Apakah kamu hendak membantah tentang Allah, padahal sesungguhnya Allah telah memberi petunjuk kepadaku'. Dan aku tidak takut kepada [malapetaka dari] sembahan-sembahan yang kamu persekutukan dengan Allah, kecuali di kala Tuhanku menghendaki sesuatu [dari malapetaka] itu. Pengetahuan Tuhanku meliputi segala sesuatu. Maka apakah kamu tidak dapat mengambil pelajaran [daripadanya]?" [QS. Al-An'am: 151].⁣⁣ ⁣⁣ "Dan sesungguhnya Kami jadikan untuk [isi neraka Jahannam] kebanyakan dari jin dan manusia, mereka mempunyai hati, tetapi tidak dipergunakannya untuk memahami [ayat-ayat Allah] dan mereka mempunyai mata [tetapi] tidak dipergunakannya untuk melihat [tanda-tanda kekuasaan Allah], dan mereka mempunyai telinga [tetapi] tidak dipergunakannya untuk mendengar [ayat-ayat Allah]. Mereka itu sebagai binatang ternak, bahkan mereka lebih sesat lagi. Mereka itulah orang-orang yang lalai" [QS. Al-A'raf: 179] .⁣ ⁣ Revisi: di video tertulis 16 hari, yang benar adalah 16 jam sebagaimana yang tertulis di postingan Twitter tersebut.⁣ .⁣ repost @cordova.media⁣ ⁣⁣ #coronavirus #viruscorona #wuhan #china #ccp #xijinping
2231701819286339602; 2; False; 1580259871; Люди приехавшие из Ухань с подозрением на коронавирус отказались сотрудничать с медицинским персоналом, после чего им просто заколотили дверь, чтобы они не смогли выйти. People who arrived from Wuhan with suspected coronavirus refused to cooperate with medical personnel, after which they simply bounded the door so that they could not exit. #coronavirus #chinavirus #вирускитай #chinapneumonia #вирускорона #hongkong #посылкиизкитая #viruscorona #sacs #ухань #коронавирус
2231703985820471085; 0; False; 1580259868; BUMBU DAPUR . . Cloves = cengkeh Cardamon = kapulaga Anise = bunga lawang Mustard seed = biji sesawi /biji moster Dill seed = Adas sowa Black pepper = Lada hitam Fennel = jintan Manis Pimento = paprika . Sudah familiar dengan bumbu dapur di atas? Untuk masakan Asia, bumbu tersebut sering dijumpai ya.. . Tapi kalau Bumin sih cuma pakai kapulaga, bunga lawang, jintan, Lada hitam Aja:smiling_face_with_smiling_eyes: . .:heavy_minus_sign::heavy_minus_sign::heavy_minus_sign::heavy_minus_sign::heavy_minus_sign::heavy_minus_sign::heavy_minus_sign::heavy_minus_sign::heavy_minus_sign::heavy_minus_sign::heavy_minus_sign: . Follow:down_arrow::down_arrow::down_arrow: . @kaldujamur_bogor @kaldujamur_bogor @kaldujamur_bogor . . Kaldu Alami cap Jamur merang :ballot_box_with_check:non MSG :ballot_box_with_check: Non pengawet :ballot_box_with_check: Halal :ballot_box_with_check: BPOM RI :ballot_box_with_check: Non perwarna :ballot_box_with_check: Dari Bahan alami berkualitas. . Info order: 0856-1442-892 . . #kaldujamur #kaldunonmsg #kaldujamurmerang #kaldusehat #kaldumpasi #jualkaldujamur #kaldujamurbogor #jualkaldujamurbogor #jualkaldujamurmerang #jualkaldunonmsg #tipsmasakan #tutorialmemasak #resepmasakan #jurussehatrasulullah #hidupsehatalami #masakansehat #mpasihomemade #bekalsuami #bekalanaksehat #masakanrumahsederhana #masakanbunda #foodprepation #kulinerbogor #oleholehbogor #bumbumasakan #sarapanpagi #penyedapmasakanalami #ellyrismanparenting #coronavirus #wuhan
2231703957766420123; 0; False; 1580259865; :woman_health_worker_light_skin_tone: @pediatriahumanizada Respondendo as principais dúvidas: . :microbe:O que são coronavírus? Os coronavírus (CoV) compõem uma grande família de vírus, conhecidos desde meados da década 90. Podem causar desde um resfriado comum até síndromes respiratórias graves, como a síndrome respiratória aguda grave (SARS, do inglês Severe Acute Respiratory Syndrome) e a síndrome respiratória do Oriente Médio (MERS, do inglês Middle East Respiratory Syndrome). Os vírus foram denominados SARS-CoV e MERS-CoV, respectivamente. . :microbe:O que é este novo coronavírus? É uma nova variante do coronavírus, denominada 2019-nCoV, até então não identificada em humanos. . . :sneezing_face:A transmissão do coronavírus acontece entre humanos? Sim. Alguns coronavírus são capazes de infectar humanos e podem ser transmitidos de pessoa a pessoa pelo ar (secreções aéreas do paciente infectado) ou por contato pessoal com secreções contaminadas. Na maior parte dos casos, a transmissão é limitada e se dá por contato próximo, ou seja, qualquer pessoa que cuidou do paciente, incluindo profissionais de saúde ou membro da família; que tenha tido contato físico com o paciente; tenha permanecido no mesmo local que o paciente doente. . :face_with_thermometer:Qual é o período de incubação ? Ainda não há uma informação exata. Presume-se que o tempo de exposição ao vírus e o início dos sintomas seja de até duas semanas. . :woozy_face:Quais são os sintomas de uma pessoa infectada ? Pode variar desde casos assintomáticos, casos de infecções de vias aéreas superiores semelhante ao resfriado, até casos graves com pneumonia e insuficiência respiratória aguda, com dificuldade respiratória. Crianças de pouca idade, idosos e pacientes com baixa imunidade podem apresentar manifestações mais graves. . :test_tube:Como é feita a confirmação do diagnóstico ? Exames laboratoriais realizados por biologia molecular identificam o material genético do vírus em secreções respiratórias. . FONTES: Ministério da Saúde do Brasil / Organização Mundial da Saúde (OMS) / Centro de Controle e Prevenção de Doenças (CDC). . Continua no próximo post :winking_face:. . Bjs Dra Cris:rose:. . #coronavirus #pediatriahumanizada
2231703463268225124; 0; False; 1580259845; GEJALA VIRUS CORONA. Semoga Allah Subhanahu Wa ta'ala melindungi kita semua dari virus Corona... . . . . :movie_camera:@straight1809 .@kr1tik_ped4s . . #coronavirus #corona #penyakit #waspadaviruscorona #therevolutioners #videodakwah #video
2231703783436506265; 0; False; 1580259844; #BajaCalifornia está preparada ante contingencia de #coronavirus; la Secretaría de Salud del Estado informa se ha preparado con protocolos de atención, tal como se realizó con la influenza, por lo cual no hay motivos para alarmarse. #GobiernoEnMarchaBC #Salud @bc.ssalud
2231703774603551414; 0; False; 1580259843; O que é ? Como transmite ? Como previne ? #coronavirus #saudepublica
2231703698214617950; 0; False; 1580259834; “If this outbreak spares humans then humans should spare the wild life. If this outbreak is defeated by paramedics, then please be grateful. Don’t complain that you are bored for being quarantined at home - our health workers can’t go back home and they don’t even have beds to sleep on.” - Dr. Zhang #coronavirus #pray4wuhan #donatemasks
2231703690741726690; 0; False; 1580259833; Better get that fucking mask every Asian tourist seems to wear when they come to the US ~ #lol #comedy #comedymemes #humor #comedyvideos #dank #dankmemes #lmao #memestagram #lmao:face_with_tears_of_joy::face_with_tears_of_joy::face_with_tears_of_joy: #lmaomemes #wtfmemes #memed #wtfmemes #memer #stupid #stupidmemes #bruh #bruhmoment #school #schoolmemes #virus #coronavirus #coronavirusoutbreak #china #sick
2231690382777520471; 0; False; 1580259830; #Regional * Comunidad denunció como una madre agrede a su #hija con un palo en #Armenia * Cinco personas muertas y 14 heridas deja #accidente de #tránsito en la vía #Salamina #Pácora. #Nacional * #Incendio en #Cali arrasó con 12 viviendas en la #noche de este #domingo. #Internacional * #China aumenta medidas para contener la amenaza del #CoronaVirus.
2231703646859545180; 0; False; 1580259827; En visto Jajajajaja #coronavirus . . . . . . . #ElAlbanBorja
2231703622191110773; 0; False; 1580259825; #jajaja #coronavirus
2231703570633610102; 0; False; 1580259818; When two tragic stories intersect. Photographed 1.27.2020 at Staple Center. #kobe #coronavirus #photojournalism
2231703541331206887; 0; False; 1580259815; Struggling to find the N95 rated dusk masks that help protect against the Novel Corona Virus? Night Raptor Tactical has them in stock. Message us for pricing. #coronavirus #novelcoronavirus #kungflu #bettersafethansorry #amazonisoutbutwegotthem #n95mask #n95masks
2231703545292736011; 0; False; 1580259815; Teman2 sinar matahari atas seidzin Alloh bisa mematikan beberapa virus. Bersyukurlah yg tinggal di desa, dekat pantai, di pegunungan yang masih murni udaranya dan banyak pohon rindang. Beginilah suasana berjemur di kota dengan penduduk yg padat. Seadanya begini, smoga tetap dapat vitamin D :palms_up_together: #virus #coronavirus #antialergi #antikanker #sehat #diet #pelangsing #pelangsingbadan #pelangsingherbal #pelangsingampuh #pelangsingmurah #pelagsingaman #pelangsingtubuh #pelangsingperut #sehatalami #sehatitumahal
2231703541827176921; 0; False; 1580259815; #Repost @fisiomonicaferreira Segue as postagens. • • • • • • Fisioterapiaresp#fisiorespiratoria #fisioterapiaguarulhos #coronavirus #reabilitacaopulmonar #fisiomonicaferreira
2231703278733971587; 0; False; 1580259808; this may be the beginning of a far deadlier disease affecting the world. No decade new ushering of control, chaos, and enforcement. Resident Evil’s Umbrella Corporation translates to a real life biological research lab near the city where the Coronavirus outbreak originated and it has a familiar logo. Shanghai Ruilan Bao Hu San Biotech Limited seems to be linked to the Umbrella Corporation from Resident Evil. Another ironic coincident is that Corona is an anagram of ‘Racoon’, fans of Resident Evil know that the original outbreak in the game started in Raccoon city, and the outbreak was called the “T-Virus” #UnplugTheMatrix:globe_showing_Europe-Africa::electric_plug: #TrillSankofa #Coronavirus #ResidentEvil #TVirus #TCells #Biological #Chemical #BiologicalWarfare #Disease #Outbreak #TheMatrix #TheMatrix4
2231703478434902105; 0; False; 1580259807; Recuerda que en Ecuador no hay casos confirmados de #Coronavirus. Conoce varios tips que tenemos preparados para que tu estadía sea segura y placentera en el país de los cuatro mundos. ¡El Gobierno Nacional trabaja por tu salud y la de los ciudadanos y la de todos los visitantes! #PrevenciónEsSalud
2231703443469701946; 0; False; 1580259803; Yes a few people may have caused it, but there are many more that are as innocent as you but got infected. They are also suffering and devastated. Please don’t turn your anger towards a few politicians to racism or hatred. #prayforchina #coronavirus #godismerciful
2231703372763990137; 0; False; 1580259795; #coronavirus #cina #massa #assiandemassa #dialetto #dialettomassese #masseso #carrara #maleducato #satira #sars #media #tv #notizie #ansa #italia #apuane #versilia #dialettoitaliano #parole #asia #asiatica
2231703369096065684; 0; False; 1580259794; #Repost @who Here are some facts about the new #coronavirus (2019-nCoV) :downwards_button: INFORMASI PENTING DARI WHO :downwards_button: Bisakah hewan peliharaan di rumah menyebarkan virus corona baru (2019-nCOV)? - Saat ini, tidak ada bukti bahwa hewan peliharaan / hewan peliharaan seperti anjing atau kucing dapat terinfeksi virus corona baru. Namun, selalu ide yang baik untuk mencuci tangan dengan sabun dan air setelah kontak dengan hewan peliharaan. Ini melindungi Anda terhadap berbagai bakteri umum seperti E. coli dan Salmonella yang dapat berpindah di antara hewan peliharaan dan manusia. :downwards_button: Organisasi Kesehatan Dunia :downwards_button: @kopicat.groovy selalu menjaga kebersihan dengan menerapkan agar tamu selalu steril tangan sebelum dan sesudah masuk ke dalam cafe kami. Kebersihan dan Kesehatan Kucing2 kami selalu menjadi prioritas utama kami agar semua tamu kami nyaman saat berkunjung ke cafe kami :folded_hands_light_skin_tone: #who #nohoax #infoviruscorona #besmart #edukasiviruscorona #viruscorona #catcafe #kafekucing #kopicatgroovy #kopicatkemang #kopicatbintaro #kopicat #groovypetcenter #worldhealthorganization
2231702893302628264; 0; False; 1580259792; Thoughts? But according to one simulation run less than three months ago, things could get much, much worse. Less than three months ago, Eric Toner, a scientist at the Johns Hopkins Centre for Health Security, had run a simulation of a global pandemic involving the exact same type of virus, according to Business Insider. His simulation predicted that 65 million people could die "within 18 months". He commented: “I have thought for a long time that the most likely virus that might cause a new pandemic would be a #coronavirus.” As of now, the outbreak is not a pandemic, but it has been reported in eight different countries. Toner's simulation said that nearly "every country in the world" would have the virus after six months. He commented: “We don’t yet know how contagious it is. We know that it is being spread person to person, but we don’t know to what extent. An initial first impression is that this is significantly milder than SARS. So that’s reassuring. On the other hand, it may be more transmissible than SARS, at least in the community setting.” His analysis used a fictional virus called CAPS, which would be resistant to any modern vaccine and would be deadlier than SARS. The simulation involved a virus originating in #Brazil's pig farms. The outbreak started small, with farmers coming down with symptoms, before spreading to crowded and impoverished areas. The simulation also showed flights being cancelled and travel bookings falling by 45%, as people disseminated false information on social media. It also triggered a financial crisis around the globe, with global GDP falling 11% and stock markets falling 20% to 40%. No word on whether or not the simulation accounted for the modern monetary theory the Fed is essentially governing with now. He also claimed that the current coronavirus could have major economic impact if it the total cases hits the thousands. :hand_with_fingers_splayed_medium-dark_skin_tone:#FactsMatter
2231703315402751669; 2; False; 1580259788; A message of love #l4l #f4f #truth #coronavirus #australia #australiafires #samoa #measles #africa #locusts #china #fiji #phillipinesvolcano #nzcvolcano #kobebryant #planecrash #cyclonetino #hawaii #lava #usa #iran #war #donaldtrump #love #peace #message #truth #facts
2231703209913937993; 8; False; 1580259775; Así construyen en 10 días el #hospital para tratar a los infectados del #coronavirus en #China. Tendrá mil camas y será inaugurado el lunes 3 de febrero :face_with_medical_mask::hospital: #Fotos :camera: Xinhua
2231702960555715244; 0; False; 1580259774; PATUT DI CONTOH OLEH INDONESIA. Posted @withregram • @cordova.media Jepang mengirimkan pesawat untuk mengevakuasi 200 warganya yang berada di tempat bermulanya wabah virus Corona. Ada sekitar 650 warga negara Jepang di Wuhan yang mengatakan ingin pergi meninggalkan kota itu. Jepang juga akan menerbangkan 1 atau 2 pesawat susulan untuk menjemput warga negaranya yang tersisa. Pesawat yang dicharter pemerintah Jepang itu juga membawa petugas medis lengkap dengan perlengkapannya. Ini adalah kali pertamanya Jepang mengevakuasi warganya dari luar negeri akibat mewabahnya penyakit menular. ⁣ ⁣ Virus Corona memiliki periode waktu inkubasi selama 14 hari dan bisa menyebabkan pneumonia. Virus ini bisa menyebar melalui batuk dan bersin ataupun melalui kontak langsung dengan penderita. Transmisi dari manusia ke manusia, selain di China juga telah terjadi di Jepang dan Jerman. Lebih dari 100 orang yang telah meninggal akibat virus ini.⁣ ⁣ Sumber: Japan Times, South Morning China Post, ANN News.⁣ ⁣ #jepang #jepun #japan #wuhan #china #coronavirus #viruscorona
2231703179187634537; 1; False; 1580259772; O surto do coronavírus, que já matou 106 pessoas e supera os 4 mil infectados na China, coloca em alerta diversas modalidades esportivas. Competições estão sendo canceladas ou transferidas para outros países. O Comitê Olímpico Internacional (COI) acompanha a propagação da doença, a menos de seis meses da Olimpíada de Tóquio, que tem início em 24 de julho. Por enquanto, O Ministério da Saúde do Japão confirmou apenas um caso de coronavírus em um homem que não esteve na China. ⠀ Foto: Mark Ralston/AFP ⠀ #toquio #japão #olimpiadas #coronavirus
2231703172108770244; 0; False; 1580259771; TIDAK DIJUAL BEBAS HANYA ADA DI MEMBER AKTIF PT MELIA SEHAT SEJAHTERA . #MELIAPROPOLIS adalah Obat Alami yang terbuat dari air liur lebah yang sangat bermanfaat untuk menjaga kesehatan dan membantu mengobati berbagai jenis penyakit dalam dan luar terutama penyakit yang diakibatkan oleh serangan virus, bakteri dan jamur. BPOM RI: TI. 124 646 701 . Efek Melia Propolis pada Manusia: :ballot_box_with_check: Anti Virus, Bakteri & Jamur :ballot_box_with_check: Anti Infeksi, Radang, Alergi & Kanker :ballot_box_with_check: Memperkuat Daya Tahan Tubuh :ballot_box_with_check: Nutrisi yang Bergizi Tinggi . Manfaat Melia Propolis untuk Penyakit: :ballot_box_with_check: Membantu Program KEHAMILAN :ballot_box_with_check: Flu, Asma, Bronchitis, Sinusitis:ballot_box_with_check: Luka Bakar :ballot_box_with_check: Infeksi Kewanitaan :ballot_box_with_check:Penyakit Kulit :ballot_box_with_check: Jerawat, Bisul :ballot_box_with_check: Infeksi Telinga & Gigi :ballot_box_with_check: Wasir :ballot_box_with_check: Kanker, Katarak, Tumor, Gangguan Jantung, Ginjal, Hati & Diabetes :ballot_box_with_check: Hepatitis :ballot_box_with_check: Stress :ballot_box_with_check: Gangguan Pencernaan DLL . MELIA PROPOLIS sangat aman untuk : :ballot_box_with_check: Bayi dalam kandungan, :ballot_box_with_check: Bayi baru lahir, :ballot_box_with_check: Balita, :ballot_box_with_check: Anak-anak :ballot_box_with_check: Remaja :ballot_box_with_check: Dewasa :ballot_box_with_check: Ibu Hamil & Menyusui :ballot_box_with_check: Lansia dll . Melia Propolis : :ballot_box_with_check: 100% Herbal Alami :ballot_box_with_check: Tanpa Bahan Kimia :ballot_box_with_check: Aman :ballot_box_with_check: BPOM_RI :ballot_box_with_check: GMP (WHO) std :ballot_box_with_check: Reaksi Cepat :ballot_box_with_check: Tanpa Efek Samping. . . Pastikan Konsumsi yang Asli ya :) Info konsultasi dan pemesanan, hubungi : @a.taufik_am HP/WA : 0852 4226 9396 @melia.propolis.asli Jangan Lupa Follow : @melia.propolis.asli @melia.Propolis.asli @melia.propolis.asli #obatherbal #meliapropolis #meliastore #meliapropolisstore #propolisherbal #herbalmurah #kesehatan #sehatalami #propolismelia #meliapropolis #sehatitumahal #meliapropolisasli #likeforfollow #followforfollow #beautiful #instadaily #happy #followme #instagood #instagram #photooftheday #likeforlikes #coronavirus #sarvirus #wuhan #cina #china
2231703168988154282; 0; False; 1580259770; . #해외여행 후 #기침 과 #발열증상 이 있다면? . #신종코로나바이러스 의심 증상 발생 시, #병원 또는 #질병관리본부 #1339 로 전화해주세요 . #방역마스크 착용과 수시로 손세정 해주시기 바랍니다. . #인천 #부평역 12번출구 방향, #일호약국 . . #코로나바이러스 #바이러스 #coronavirus #우한폐렴 #우한 #폐렴 #황사마스크 #마스크 #mask #약국 #부평 #incheon #pharmacy #pharmacist
2231703125440401297; 1; False; 1580259765; --- Virus baru yang disebut corona virus telah membuat geger warga dunia. Sebab, selain dapat menyebar dengan sangat cepat, virus ini juga telah menyebabkan kematian pada banyak orang di beberapa negara dunia, utamanya di China . Berikut beberapa informasi dari Kemenkes terkait virus corona . Stay Healthy Teman Hermina . Jangan lupa untuk mendownload Hermina Mobile Apps untuk kemudahan booking dokter pilihan anda . #herminalebihdekat #herminahospitals #coronavirus #kemenkes
2231702994723236037; 1; False; 1580259750; ThE CoRONa ViRuS???? Nah just a booger flagella I created because I’m still SICK. #coronavirus
2231702976393017386; 0; False; 1580259748; #lol #hilarious #givemebeer #beer #corona #coronalightbeer #memedroid #true #sick #virus #coronavirus
2231702904360540319; 0; False; 1580259739; . . Corona virus :microbe: #coronavirus #virus #germs #sanitation #health #california #worldwide #instagram #keepclean #2020#usa #kids #adults #china cdc#newyorktimes
2231702866200799847; 1; False; 1580259734; #memes #ninja #victoryroyale #bushdid711 #cancermemes #idubbbz #iwanttodie #ninjaisgay #love #instagram #makeamericagreatagain #makeawish #lebronjames #wwe #awstenknight #kys #hashtag #mood #absworkout #tomandjerrymemes #area51 #fitz #mcnasty #raccooneggs #babyyoda #worldwar3 #ww3 #veteran #coronavirus
2231702843803703448; 1; False; 1580259732; How To Protect Yourself From Coronavirus? Tag Your Friends! Families & Everyone You Love Follow Me For More Tips:smiling_face_with_3_hearts: @kalishow #coronavirus #disease #SARS #mers #coronavirusmemes #coronavirusoutbreak #china #canada:Canada: #canada #unitednations #nationalmentalhealthday #bearlo #cnnnews #ctv #theguardian #aljazeera #bbc #globalwarming #global #globalnews #vancouver #yyj
2231702828670239654; 0; False; 1580259730; Overhaul just trying to survive the coronavirus :flushed_face::flushed_face: #overhaul #chisakikai #mha #bnha #coronavirus #anime #netflixadaptation #otaku #animeworld #follow #dankmemes #yaoi #animefanart #aesthetic #funny #cosplaygirl #mangaart #artwork #bnha #edits #animedrawing #echi
2231702799845282863; 1; False; 1580259726; DVlogy vol. 16: VIRUS CORONA VIRUS di AUSTRALIA . BREAKING NEWS: ilmuwan Australia di Doherty Institute Melbourne menjadi ilmuwan pertama di luar Cina yang mampu mengembangkan virus Corona untuk pembuatan vaksin. Semoga berhasil ya, yuk kita doakan bersama. (Sumber: https://www.smh.com.au/national/australian-scientists-first-to-grow-wuhan-coronavirus-outside-china-20200129-p53vme.html) . Hingga kini ada lima kasus positif virus Corona di Australia (Sumber: https://www.3aw.com.au/five-case-of-deadly-coronavirus-detected-in-australia/) . Hari ini adalah hari pertama anak-anak di negara bagian New South Wales kembali ke sekolah. Terkait maraknya penyebaran virus Corona, Pemerintah negara bagian tersebut meminta anak-anak yang baru saja berkunjung dari Cina untuk tidak langsung kembali ke sekolah hingga 14 hari sejak kepergiannya dari China. (Sumber: https://education.nsw.gov.au/news/latest-news/coronavirus-department-of-education-statement) . Meski peluang penyebaran virus Corona terhadap anak-anak sangat rendah, tapi pemerintah mengambil tindakan itu sebagai upaya pencegahan. . Persoalannya adalah bagaimana cara pihak sekolah tahu bahwa seorang anak kembali dari Cina kurang dari 14 hari atau tidak ya? . #viruskorona #coronavirus #indonesia #australia #nsw #sydney #dvlogy #wuhan #corona #melbourne
2231702780693893428; 0; False; 1580259724; :musical_notes::musical_note: "lá vou eu... lá vou eu...":musical_notes::musical_note: #carnaval2020 #coronavirus
2231702770930932914; 0; False; 1580259723; BANGKOK, 29 Jan - Enam kes baharu jangkitan Coronavirus dikesan menjadikan 14 kes dilaporkan di negara itu. Berikutan itu, Thailand akan membuat saringan terhadap semua pelancong yang datang dari China di semua lapangan terbangnya. Setiausaha Tetap Kementerian Kesihatan, Dr. Sukhum Kanchanapimai, berkata enam warga China itu yang berusia enam hingga 60 tahun disahkan dijangkiti Coronavirus. Lima daripada mereka dari wilayah Hubei, manakala seorang lagi dari bandar Chongqing. Thailand akan membuat saringan terhadap semua pelancong dari China. Saringan dilaksanakan di lima buah lapangan terbang iaitu, Suvarnabhumi, Don Mueang, Chiang Mai, Phuket dan Krabi. Hingga kini, 81 pesakit sudah dikuarantin di beberapa buah hospital kerana disyaki dijangkiti Coronavirus. Thailand kini turut menghadapi rasa tidak puas hati daripada rakyatnya, berikutan penularan wabak Coronavirus semakin membimbangkan. China adalah sumber pelancongan terbesar Thailand dan mempunyai hampir 11 juta pelawat dari negara itu tahun lepas. #RTM #BeritaRTM #Coronavirus
2231702410422565147; 5; False; 1580259715; Jepang mengirimkan pesawat untuk mengevakuasi 200 warganya yang berada di tempat bermulanya wabah virus Corona. Ada sekitar 650 warga negara Jepang di Wuhan yang mengatakan ingin pergi meninggalkan kota itu. Jepang juga akan menerbangkan 1 atau 2 pesawat susulan untuk menjemput warga negaranya yang tersisa. Pesawat yang dicharter pemerintah Jepang itu juga membawa petugas medis lengkap dengan perlengkapannya. Ini adalah kali pertamanya Jepang mengevakuasi warganya dari luar negeri akibat mewabahnya penyakit menular. ⁣ ⁣ Virus Corona memiliki periode waktu inkubasi selama 14 hari dan bisa menyebabkan pneumonia. Virus ini bisa menyebar melalui batuk dan bersin ataupun melalui kontak langsung dengan penderita. Transmisi dari manusia ke manusia, selain di China juga telah terjadi di Jepang dan Jerman. Lebih dari 100 orang yang telah meninggal akibat virus ini.⁣ ⁣ Sumber: Japan Times, South Morning China Post, ANN News.⁣ ⁣ #jepang #jepun #japan #wuhan #china #coronavirus #viruscorona
2231702703084375076; 2; False; 1580259715; Ay Dios mío:face_with_tears_of_joy: ¿Qué harías tú? (métete en el papel :beaming_face_with_smiling_eyes:)⁣ ⁣ ⁣ #coronavirus #xiaomi #xiaomiglobal #xiaomicolombia #xiaomiespaña #xiaomienméxico
2231702680048577885; 0; False; 1580259712; SINGAPURA, 29 Jan - Kementerian Kesihatan (MOH) mengesahkan dua lagi jangkitan Coronavirus Wuhan di republik itu, menjadikan jumlah keseluruhan sebanyak tujuh kes. Hasil ujian yang mengesahkan jangkitan dan kes terbaharu itu tiada kaitan dengan kes-kes import yang disahkan sebelum ini. Menurut MOH, jangkitan keenam membabitkan seorang lelaki warga China berumur 56 tahun dari Wuhan yang tiba di Singapura bersama keluarganya pada 19 Januari. Beliau kini berada di Wad Isolasi, Changi General Hospital. Kes ketujuh yang disahkan pula, membabitkan lelaki warga China berumur 35 tahun dari Wuhan yang tiba di Singapura pada 23 Januari bersama keluarga dan rakan-rakannya. Pesakit kini berada di Wad Isolasi Pusat Nasional bagi Penyakit Berjangkit. MOH memulakan penyiasatan epidemiologi dan pengesanan sentuh untuk mengenal pasti individu yang mempunyai hubungan rapat dengan dua kes terbaharu itu. #RTM #BeritaRTM #Coronavirus
2231700623882195604; 0; False; 1580259708; 1. Menghindari makanan yang haram atau tidak jelas kehalalannya, misalnya kelelawar dan ular. Hal ini didasarkan pada firman Allah: وَيُحِلُّ لَهُمُ الطَّيِّبَاتِ وَيُحَرِّمُ عَلَيْهِمُ الْخَبَائِثَ Artinya : “Dan dihalalkan bagi mereka segala yang baik dan diharamkan bagi mereka segala yang jelek (khobits)” (QS. Al A’raf : 157) . 2. Selalu menjaga Wudhu. Selain kondisi kita selalu dalam keadaan suci untuk beribadah, Wudhu juga membuat kita sering membasuh tangan dan wajah sehingga tetap bersih. 3. Ketika bersin, pastikan menunduk, menutup mulut dan hidung dan ucapkan Alhamdulillah. Hal ini dapat mecegah penyebaran penyakit sekaligus saling mendoakan sesuai dengan hadits Rasulullah: . “Jika seseorang di antara kalian bersin, maka ucapkanlah ALHAMDULILLAH (segala puji bagi Allah). Hendaklah saudaranya mengucapkan YARHAMUKALLAH (semoga Allah merahmatimu). Jika ia mengucapkan YARHAMUKALLAH, ucapkanlah YAHDIKUMULLAH WA YUSHLIH BAALAKUM (semoga Allah memberikan petunjuk dan memperbaiki keadaanmu). . 4. Selalu Berdo'a agar dijauhkan dari penyakit wabah dan marabahaya. Doa untuk menangkal wabah penyakit adalah: "Ya Allah, Angkat dari kami penyimpangan, malapetaka, zina, riba, gempa bumi, bencana, dan segala cobaan yang buruk, baik yang nyata maupun yang tersembunyi, dari negeri kami ini khususnya, dan dari semua negeri kaum Muslimin, dengan Rahmat-Mu, Duhai Yang Maha Penyayang." . tag dan komen sahabat2 tercintamu ya ukhti . . semoga bermanfaat #BelajarIslam #AlQuran #Hadits #Ulama #Doa #Aqidah #Ibadah #Akhlaq #Wudhu #Sholat #Zakat #Puasa #Haji #Sholawat #viruskorona #coronavirus
2231702611867201960; 0; False; 1580259704; China officially announced that as of the 28th at 24:00, China had reported a total of 5974 confirmed cases and 132 deaths . . Hong Kong, Macao and Taiwan have reported confirmed cases: #HongKong : 8 #Macau : 7 #Taiwan : 8 . . . #China #Wuhan #Pneumonia #Virus #CoronaVirus #Epidemic #Corona #Medical #Hospital #Flight #Healthy
2231702566333545269; 0; False; 1580259699; Der Link: https://www.imperial.ac.uk/mrc-global-infectious-disease-analysis/news--wuhan-coronavirus/ . Eine hervorragende Einführung in die medizinische Statistik ist Weiß, Christel (2013): Basiswissen Medizinische Statistik. 6., überarb. Aufl. Springer: Berlin, Heidelberg. . #coronavirus #epidemie #epidemiologie #2019ncov #medizin #wissenschaftstheorie #statistik #studium #medizinstudium #wissenschaftstheorie #medizintheorie #virus #nachdenken #aufklärung #wissen #wissenschaft #philosophie #philosophiestudium #nachrichten #news #naturwissenschaften #mathematik
2231702572446904390; 0; False; 1580259699; #coronavirus
2231702567329861788; 0; False; 1580259699; Not taking any chances #meme#ralph#simpsons#gasmask#china#coronavirus#corona
2231702547876283117; 0; False; 1580259696; #Kobe #24 #8 #lakers #ripkobe #kobebryant #france #coronavirus #kobebryant24 #:broken_heart: #lakersnation #paris #mambamentality #mambaforever
2231702536939374337; 0; False; 1580259695; #Repost @merito.consultoria • • • • • • Porto Alegre, Rio Grande do Sul Um novo tipo de coronavírus, até então desconhecido, surge na China, infectando milhares de pessoas (5.578 até agora), causando um número significativo de mortes (131). . Essas epidemias sempre geram muito pânico ao redor do mundo, especialmente porque a movimentação de pessoas, e consequentemente, dos vírus, é muito rápida. Hoje de manhã eram 16 países com casos confirmados da doença, agora à noite, são 18. . No Brasil, atualmente, estamos lidando com 3 casos suspeitos, todos relacionados a viagens à China. . Mas o que isso tem a ver com Segurança de Alimentos? Bem, primeiramente, TUDO! . O hábito dos chineses de comercializar animais vivos em feiras, comercializar carnes e pescados em temperatura ambiente, somados à constante aglomeração de pessoas nessas feiras é um prato cheio pra um micro-organismo “se transformar” e se adaptar ao corpo humano. . Mas ATENÇÃO! Encontramos essas feiras, com carnes e outros produtos de origem animal sem procedência ou mal acondicionados, facilmente aqui no Brasil! . Sabe aquele queijo colonial cheio de furinhos irregulares? Aquele salame úmido, que ainda não tá bem maturado? E aquele mel no vidro de café? Sabe quando é bem baratinho, abaixo do valor de mercado??? Produtos clandestinos. Eles podem esconder vírus, bactérias e todo tipo de perigo à saúde humana. . #saudenamesa #alimentoseguro #foodsafety #coronavirus #fiscalizacaosanitaria #inspeçãosanitária #boaspraticasdefabricacao #boaspraticasdemanipulação #china #vigilanciasanitaria #restaurante #restaurantesportoalegre #bareserestaurantes #alimentosebebidas #meritoconsultoria
2231702530597303359; 0; False; 1580259694; WUHAN, 29 Jan - Pihak berkuasa China menghantar hampir 6,000 kakitangan perubatan dari seluruh negara ke wilayah Hubei untuk membendung penularan wabak Novel Coronavirus (2019-nCoV). Hospital di seluruh wilayah tersebut dilaporkan menerima hampir 32,000 pesakit yang mengalami simptom demam. Jurucakap Suruhanjaya Kesihatan Kebangsaan (HNC), memaklumkan seramai 4,130 kakitangan di bawah 30 kumpulan sudah tiba di wilayah terbabit dan baki seramai 1,800 lagi akan menyusul. Pasukan perubatan dihantar untuk memberi bantuan kepada kakitangan perubatan di Hubei yang mempunyai jumlah jangkitan Coronavirus paling tinggi. Sebelum itu, stesen penyiaran CCTV melaporkan, para doktor telah tiba di lapangan terbang di Wuhan dengan membawa bekalan perubatan. Beribu-ribu doktor telah digerakkan dari seluruh negara China untuk membantu pasukan perubatan di Wuhan. Kerajaan juga memanjangkan cuti Tahun Baharu dan mengarahkan lebih banyak perniagaan ditutup bagi mengekang penyebaran wabak Coronavirus. Kerajaan China turut mengumumkan penggantungan visa dan pasport bagi 11 penduduk Wuhan. #RTM #BeritaRTM #Coronavirus
2231702493409075177; 0; False; 1580259690; #coronavirus warnings in England
2231702482998903516; 0; False; 1580259689; :warning:CORONAVÍRUS!:warning: Fique atento! #coronavirus #clinicabemestarpinhao #pinhaopr #saude #prevencao
2231702462799413009; 1; False; 1580259686; Shameful ...ppl selling reused surgical masks.. #Wuhanvirus
2231702422066034606; 0; False; 1580259681; 真的是觉得自己蠢到家了，平时用的N95都是别的样子的，突然搞来个新品种，完全懵了，找了好久才发现了绳子...这个智商真的是没救了:face_with_rolling_eyes: Hope this pandemic will be under control soon, praying goes out to those medical staffs for fighting against this horrible Coronavirus at the very front line. Hope we’ll never get our first confirmed case in NZ. Keep good hand hygiene, wash your hands properly. Though the exact mode of transmission of this Coronavirus remains undiscovered. It could be the combination of airborne, droplet and contact, so normal hand sanitizer might not work against this virus. Be really mindful about hand washing instead of using hand gel. Hope everyone stay safe and well. #coronavirus #handhygiene #washyourhands #keepwell #prayingforwuhan #prayingforchina
2231702412351419731; 0; False; 1580259680; CHINA, 29 Jan - Suruhanjaya Kesihatan Kebangsaan China-NHC melaporkan 26 kes kematian dilaporkan menyebabkan jumlah pesakit yang maut meningkat kepada 106 orang manakala hampir 7,000 lagi adalah suspek kes coronavirus. Bagi menampung kes virus itu yang semakin meningkat lebih 10,000 katil ditempatkan untuk merawat kes novel coronavirus di bandar Wuhan. Menurut Suruhanjaya Kesihatan Kebangsaan China-NHC, 1,771 kes baharu dilaporkan sekaligus menjadikan jumlah keseluruhan 4,515 kes. Berikutan jumlah kes yang semakin meningkat, terdapat kebimbangan kekurangan katil hospital. Susulan itu, Timbalan Ketua Pentadbiran NHC, Jiao Yahui berkata lebih banyak kemudahan perubatan ditempatkan untuk merawat pesakit. Ketika ini terdapat 600 katil di 2 hospital khusus untuk merawat coronavirus di Wuhan. Selain itu 2 lagi hospital baharu khusus untuk kes coronavirus yang mampu menempatkan 2,300 katil. Begitu juga beberapa lagi kemudahan di hospital universiti sekaligus menjadikan keseluruhannya 10,000 katil. #RTM #BeritaRTM #Coronavirus
2231702316017495868; 0; False; 1580259676; Palawan provincial board member Ryan Maminta is proposing a temporary ban on the entry of Chinese visitors and other foreigners with a history of travel to Wuhan, China, and other countries with positive cases of the novel coronavirus (2019-nCoV). FULL STORY HERE: http://ow.ly/UVup50y7zwT #PalawanNews #IfItsNewsItsPalawanNews #CoronaVirus #PuertoPrincesa #PDRRMO #MHO For more updates, follow us on our social media pages: Facebook Palawan News Twitter @news_palawan Instagram @palawan_news_official
2231702177486326560; 27; False; 1580259670; Residentes de la ciudad epicentro del coronavirus se dan ánimos para seguir luchando En la Red se han viralizado algunos videos en los que se ve a residentes de Wuhan (China) darse ánimos entre sí para afrontar la cuarentena que vive la ciudad por el coronavirus. · · · #rtenespañol #actualidadrt #rtplayes #noticias #news #coronavirus #china #wuhan
2231702215880820464; 4; False; 1580259657; Esperando el Metro durante la Gran Cuarentena Coronavirus en Ciudad de Panamá. Foto proveniente del futuro cuántico tomada en Año 1, Día 115 del calendario post-apocalíptico. Ya, dejando el relajo, este Cosplay de Master Chief fue creado por :artist_palette: @thebabychief
2231702161104268001; 0; False; 1580259650; Amen :folded_hands_medium-light_skin_tone::red_heart::raising_hands: #Amen #Jesus #Church #Godisgood #blessed #Bible #Church #Christian #gym #coffee #sports #love #igdaily #reading #books #God #jesussaves #forgiven935 #jesuschrist #fishing #nba #coronavirus #war #saved
2231702135744125755; 3; False; 1580259647; #coronavirus #wuhanchina #mediadownplay They have run out of test kits Bioweapon
2231702113741966964; 0; False; 1580259645; SAÚDE | Coronavírus: é preciso dar a dimensão adequada à situação, por Natália Araújo. Para a OMS, atual epidemia requer urgência mas não se trata de uma emergência internacional. O coronavírus já matou 81 pessoas na China e infectou 3 mil pessoas; Para infectologista, não é preciso alarde no Brasil. Leia na íntegra a coluna no brasildefato.com.br. Link na bio. Foto: Nicolas Asfouri - AFP #CoronaVirus #OMS #Saude #SUS
2231701499024790292; 1; False; 1580259643; Corona virus. Chinos extremos... :thumbs_up:
2231461272377829209; 0; False; 1580259641; If you dont believe any International Hidden Agenda, So please explain how is the story on the movie, that come up first then become a Reality after long time its just occur the event exactly the same plot.. :white_medium_star: #mindcontrol #predictiveprogramming #coronavirus #wuhan #911 #biologicalweapons #populationcontrol #hiddenagenda #vaccine #wakethefuckup #secretsociety #bigpharma #monsanto #ebola #manipulation #programming #mindcontrol #depopulation #consciousness #conscious #awakening #awakethesoul #holistichealing #symbolism #occult #truth #truthseeker #nwo #newworldorder #mkultra #woke
2231702048446304388; 1; False; 1580259637; Ditasea
2231702044360404965; 0; False; 1580259636; I’ve got a sick little one at home....She missed school today :sad_but_relieved_face: I hope it’s not the flu- we did get flu shots - but also nervous about #coronavirus ⠀⠀⠀⠀⠀⠀⠀⠀⠀ I’m glad she’s generally healthy and think of the little ones who aren’t. Here’s hoping she feels better soon (and doesn’t infect the rest of us!!⁣) ⁣ I’m still loving this summer maxi dress… and dreaming of a warm weather place to wear it! So comfortable that I’m thinking of ordering the long sleeve version that they have… Will report back⁣ ⁣ ⁣ ⁣ #summermaxi #summervibe #cheapclothes #under10dollars #sexyback #tback #health #thankful #ifounditonamazon
2231702018313324933; 0; False; 1580259633; CORONAVÍRUS NO BRASIL O Ministério da Saúde investiga mais dois casos suspeitos de coronavírus no Brasil, Em São Leopoldo, no Rio Grande do Sul, onde um homem de 40 anos procurou atendimento na UPA da cidade e outro em Curitiba, onde um homem de 29 anos, que estava em Xangai, a mais de 685 km de distância de Wuhan, também apresentou sintomas. Os pacientes se enquadraram na atual definição de caso suspeito para NCOV-2019 (o novo coronavírus), apresentando febre e pelo menos um sinal ou sintoma respiratório. Ambos os casos estão sendo investigados. Em nota, o Ministério da Saúde reforçou entre as orientações que viagens para a China sejam realizadas apenas em casos de extrema necessidade. Com quase três mil casos confirmados, segundo o último boletim da OMS (Organização Mundial de Saúde), todo o território chinês passa a ser considerado área de transmissão ativa da doença. #coronavirus #oms #brasil
2231702003398848282; 0; False; 1580259632; CORONA VIRUS :white_heavy_check_mark:Keep your household clean and sanitized :backhand_index_pointing_left: (Read the chart):thinking_face: **If you need an additional hand please give us a call, we would live to help. :waving_hand:Stay vigilant, clean surfaces, clean your hands, maintain universal health precautions :white_medium_star: #coronavirus #coronaviruscdc #coronavirususa #maidservicestampa #newtampacleaning #newtampa #tampa #tampabay #landolakes #florida #floridabusiness #realtors #serranocleaning #officecleaning #tampaofficecleaning #tampacleaningservices #tampamaidservices #tampacleaningservices
2231701998918252353; 7; False; 1580259631; Well, I aint risking. :face_with_medical_mask: X :steaming_bowl::bat::nauseated_face::face_vomiting: Just pretend I like KPOP #coronavirus #china #fuckcommunism
2231701975506285569; 0; False; 1580259628; Current Mood. #moodybearblues #moodybear #benjirich #benjirichdesigns #coronavirus #illustration #illustrator #torontoart #torontoartist #jamaicanartist #comicbook #health #the6ix #tuesdayvibes #fashion #90skid #artofinstagram #artoftheday #streetart #streetwear #hypebeast #sketchbook
2231701929017131994; 2; False; 1580259623; Exams are finally over and i have the next 5 days off so i should be active for awhile • • • • #tiktok #tiktoks #tiktokboys #tiktokgirls #tiktokmemes #foryoupage #foryou #fyp #tiktokers #tiktokcringe #tiktokfunny #darkmemes #darkhumor #tiktokviral #darkhumormemes #karenmemes #ww3 #ww2 #charlidamelio #hypehouse #virus #coronamemes #wuhan #wuhanvirus #corona #coronavirus #china #virus #ontario
2231701845307063061; 0; False; 1580259613; Você sabe como se prevenir contra o novo CORONA VÍRUS? :hand_with_fingers_splayed:lave as mãos com sabão e água ou com álcool, principalmente antes de consumir algum alimento. Utilize lenço descartável para higiene nasal. Cubra nariz e boca quando espirrar ou tossir. Evite tocar mucosas de olhos, nariz e boca. Higienize as mãos após tossir ou espirrar Não compartilhe objetos de uso pessoal, como: talhares, copos, garrafas. Mantenha ambientes bem ventilados. Evite contato próximo a pessoas que apresentem sinais ou sintomas da doença. _____________ Humanizar Atendimento Especializado de Enfermagem. Rua Rosolino Ferreira Guimarães, 766 Centro Rio Verde/GO Plantão: 64 9.9247-9474 64 9.9986-1217 #coronavirus #humanozar #rioverde #goias
2231701743735934942; 1; False; 1580259601; No Joe!!! Don't do it!!! . . . #makeliberalscryagain #maga #maga2020 #magababes #magacountry #makeamericagreatagain #trans #trumpbabes #trump #trending #theleftcantmeme #thisismagacountry #trump2020 #joebiden #coronavirus #rightwing #raisedright
2231701748200678793; 0; False; 1580259601; Bagi sahabat PMI yang mau tahu informasi yang benar tentang #coronavirus bisa kontak ke hotline @kemenkes_ri. Jadilah netizen cerdas yuk. Jangan sebar hoax dan kepanikan. Tetap waspada dan selalu jaga kesehatan ya teman-teman #PMISiapBantu. @dwi_saputra456
2231701396925951664; 0; False; 1580259593; :warning:¿Qué es el #coronavirus?, ¿cómo se transmite? :thinking_face: :up-right_arrow:Conoce más sobre este virus originado en China y sigue nuestras recomendaciones en caso estés próximo a viajar o retornando al país.
2231701651437961243; 1; False; 1580259590; Just delay the fight Dana...this is highly irregular!
2231701624207083889; 1; False; 1580259586; //latepost: terpaksa pakai masker sampai didalam pesawat dari @kuala_lumpur_airport...beritanya di malaysia sdh mulai beredar #coronavirus . . smoga Allah melindungi dan senantiasa memberiku kesehatan.. aamiin #corona #coronavirus
2231699972523335037; 0; False; 1580259585; Hate when that happens smh • #freememeskids #freememeskidsyt #memesdaily #memesdailybestmemes #dankmemes #coronavirus #offensivememes:sweat_droplets::eyes::hundred_points::face_with_tears_of_joy::face_with_tears_of_joy::gem_stone::fire::face_with_steam_from_nose::sweat_droplets::OK_hand::hundred_points::face_with_tears_of_joy::folded_hands::face_with_tears_of_joy::face_with_tears_of_joy::gem_stone::gem_stone::fire::face_with_steam_from_nose::sweat_droplets::eyes::eyes: #offensivememes #offensive #shit #dragonballzmemes #vegeta #vegetamemes #dankmemez #post #memes:face_with_tears_of_joy:
2231701568651384990; 0; True; 1580259580; Coronavirus cure. #coronavirus
2231701478624741496; 0; False; 1580259569; Tua, Muda, Dewasa, Pria dan Wanita semua konsumsi Melia Propolis:smiling_face_with_heart-eyes: Melia Propolis bisa dan aman digunakan oleh semua orang, baik orang sehat ataupun sakit, pria maupun wanita, dewasa maupun anak-anak dan lansia. BAGI ANAK-ANAK / BALITA : 1. Meningkatkan Kecerdasan Anak 2. Meningkatkan Nafsu Makan Anak 3. Meningkatkan Ketahanan Tubuh Anak ( Anak Tidak Mudah Sakit ) 4. Mencegah Keterbelakangan Anak 5. Meningkatkan Hormon Pertumbuhan Anak dll BAGI ORANG SEHAT : 1. Menghambat Radikal Bebas Yang Masuk ke Dalam Tubuh Karena Asap Rokok dan Knalpot 2. Meningkatkan Nafsu Makan 3. Meningkatkan Ketahanan Tubuh 4. Mencegah Seringnya Sakit 5. Mencegah Segala Macam Penyakit Masuk Ke Dalam Tubuh Kita BAGI PRIA DEWASA: 1. memulihkan stamina 2. meningkatkan daya tahan tubuh dan kesuburan 3. melancarkan BAB 4. mencegah dan mengobati penyakit pinggang, prostat, batu ginjal, tumor, kangker, kencing tidak lancar dll. BAGI WANITA DEWASA: 1. menambah kesuburan 2. melancarkan haid 3. mencegah dan mengobati berbagai penyakit kewanitaan (kanker rahim dan payudara, keputihan, kista, miom, Tokso, Rubella) 4. menjaga agar tetap awet muda dll. BAGI WANITA HAMIL: 1. meningkatkan daya tahan tubuh 2. membersihkan rahim dari jamur, bakteri dan virus 3. membantu pertumbuhan janin 4. melindungi janin dari penyakit Microchepalus-Hidrochepalus-bibir sumbing dll 5. membantu melancarkan persalinan. BAGI LANSIA : 1. meningkatkan daya tahan tubuh 2. mencegah dan mengobati reumatik, asam urat, prostat, gagal ginjal, diabetes, stroke, darah tinggi, jantung koroner, katarak dll. BAGI BAYI: 1. untuk membantu pertumbuhan tubuh dan perkembangan otak 2. sebagai IMUNISASI ALAMI yang halal, alami dan aman. (HATI-HATI MELIA PROPOLIS PALSU) Untuk info dan pemesanan, hubungi DISTRIBUTOR RESMI : :necktie: @a.taufik_am :mobile_phone_with_arrow: WA: 0852 4226 9396 :honeybee: @melia.propolis.asli #meliapropolis #meliastore #propolismelia #propolismeliaasli #propolismeliamurah #meliasehatsejahtera #meliapropolismurah #jualpropolis #jualpropolisasli #propolisterbaik #propolispremium #propolisbone #propolismakassar #propolisherbal #propolisanak #propolismeliaoriginal #herbalalami #dietsehat #obatsegalamacampenyakit #coronavirus #sars
2231701420609262188; 0; False; 1580259562; Sort of makes you want to cough into the spout,eh? #CoronaVirus
2231701410593121304; 0; False; 1580259561; #coronavirus Grupo de vírus (CoV) de genoma de #RNA simples de sentido positivo,desde os anos #1960 é conhecido.A maioria das pessoas se infecta com os coronavirus comuns ao longo da vida.Eles são uma causa comum de infecções respiratórias brandas e moderadas de curta duração.#Wikipedia.Coronavírus comuns são#alpha-229E e NL63,Coronavírus comuns #beta-OC43 e HKU1.(SARS)#SevereAcuteRespiratorySyndrome (SRAG)#SindromeRespiratoriaAgudaGrave (MERS)#MiddleEastRespiratorySyndrome (SROM)#SindromeRespiratoriadoOrienteMedio #SARS-CoV #MERS-CoV A cidade de #wuhan na #China foi o epicentro deste novo vírus que fica na província de #hubei .
2231701366710137352; 0; False; 1580259556; China prohíbe el comercio de vida silvestre en todo el país debido al #coronavirus. Las autoridades sanitarias de la nación asiática creen que el virus se originó en un mercado de mariscos de la ciudad de Wuhan que vendía ilegalmente animales exóticos.
2231701367817511809; 0; False; 1580259556; Waspada Corona Virus , tingkatkan daya tahan tubuh dengan Nu Vit dari MCI #mci #mcijakarta #mciindonesia #nuvit #nuvitmci #vitamin #dayatahantubuh #coronavirus #coronavirus
2231701360184064427; 1; False; 1580259555; are you protecting your lungs like you should be? #MaskUP Learn more at BIOdefensesolutions.com
2231701353105667283; 1; False; 1580259554; Nice Follow @flopi800 Follow @flopi800
2231701328509647531; 0; False; 1580259551; Amen :folded_hands_medium-light_skin_tone::red_heart::raising_hands: #Amen #Jesus #Church #Godisgood #blessed #Bible #Church #Christian #gym #coffee #sports #love #igdaily #reading #books #God #jesussaves #forgiven935 #jesuschrist #fishing #nba #coronavirus #war #saved
2231701315440308751; 0; False; 1580259550; El #CORONAVIRUS es un virus :microbe: MORTAL. Aún no tiene una vacuna :syringe: ó cura. En mi canal de YouTube subí un video con todo lo que necesitas saber y cómo prevenirlo. El link está en la biografía de mi perfil. Ó simplemente me buscas en YouTube como Quillera en USA #QuilleraEnUsa #coronavirusoutbreak
2231701312002061509; 0; False; 1580259549; Waspadai corona virus yang sedang melanda beberapa negara di berbagai belahan dunia. Apa itu Corona virus ? Apa saja gejala yang ditimbulkan? Dan bagaimana cara mencegahnya? Cari tahu infonya di postingan instagram Jims Honey yuk! Dan jangan lupa untuk selalu waspada dan jaga kesehatan kamu ya! . . . #corona #coronavirus #Jimshoney #jimshoneysunter #viruscorona #staysafe
2231701296581673152; 1; False; 1580259547; Omg...ppl washing surgical masks for reuse:face_with_medical_mask::astonished_face::flushed_face:
2231701273110678851; 0; False; 1580259544; Follow @learngymfacts . Coronavirus info . #coronavirus #coronavirus2020 #getinfo . @info.coronavirus @coronavirus._
2231701235237808903; 0; False; 1580259540; Waspadai corona virus yang sedang melanda beberapa negara di berbagai belahan dunia. Apa itu Corona virus ? Apa saja gejala yang ditimbulkan? Dan bagaimana cara mencegahnya? Cari tahu infonya di postingan instagram Jims Honey yuk! Dan jangan lupa untuk selalu waspada dan jaga kesehatan kamu ya! . . . #corona #coronavirus #Jimshoney #jimshoneysunter #viruscorona #staysafe
2231701209365329742; 17; False; 1580259537; Want to protect you and your family against the outbreak of #coronavirus ? Then make sure you get a batch of #KarensOils, premium, vegan essential oils that will last you through the year! These carefully designed oils will make sure none of your vulnerable family members head to the grave! I know for a fact @susantheweed is coughing up blood with flu like symptoms! #stayawayfromsusan Get your batch while stocks last, or get fucked by a disease from China #LOL #BUYMYOILS #divorcemoneyisrunninglow #davepaythechildsupport #christian #vegan
2231701151525790051; 2; False; 1580259530; #china #coronavirus :folded_hands::folded_hands::folded_hands:
2231701146895060817; 0; False; 1580259529; Um vírus pertencente à família dos coronavírus, grupo que reúne desde agentes infecciosos que provocam sintomas de resfriado até outros com manifestações mais graves, como os causadores da Sars (sigla em inglês para Síndrome Respiratória Aguda Grave) e da Mers (Síndrome Respiratória do Oriente Médio). ⠀ Os coronavírus normalmente são transmitidos pelo ar, por meio de tosse ou espirro, contato pessoal próximo ou com objetos e superfícies contaminadas. ⠀ Para os brasileiros, cabe frisar: a maioria dos casos da doença tem relação direta com os territórios chineses acometidos, que inclusive já foram isolados. Mas todo cuidado é bem-vindo. ⠀ :heavy_check_mark:Evite aglomerações e contato próximo com outras pessoas. :heavy_check_mark:Cubra o nariz e a boca com lenço descartável ao tossir ou espirrar (e descarte o material em local adequado). :heavy_check_mark:Lave as mãos a cada duas horas e principalmente após passar por estabelecimentos ou transportes públicos. :heavy_check_mark:Procure não tocar olhos, nariz e boca Não compartilhe copos, toalhas e objetos de uso pessoal. :heavy_check_mark:Dependendo do local, compre e use máscaras que cobrem boca e nariz. ⠀ Os principais sintomas dessa doença são: tosse, febre, dificuldade em respirar, síndrome respiratória grave e insuficiência renal. Caso apresente algum destes sintomas, deve-se procurar serviços médicos imediatamente e evitar contato com outras pessoas. ⠀ Aqui na Manipulação Stevia temos as melhores formulações magistrais para você! Entre em contato com nossas atendentes pelo Whatsapp (11) 99571-3136 ou ligue para (11) 4435-3399. Fazemos entregas para todo Brasil. ⠀ #coronavirus #china #gripe #tosse #resfriado #sintomas #epidemia #saude #doença #asma #pneumonia #santoandre #saopaulo #brasil #grandeabc #abcpaulista #cuidado
2231701120270344171; 0; False; 1580259526; #Coronavirus Ministro de Salud informó un caso sospechoso en Paraguay. Un joven que ingresó al país el 25 de enero es sospechoso de haber contraído el virus, fue sometido a análisis cuyo resultados estarían entre 5 a 7 días, se encuentra bajo observación en su domicilio particular. Además, Julio Mazzoleni descartó el posible caso de un joven asistido en el Hospital Bautista de Asunción. #650AM
2231701088075871115; 0; False; 1580259522; #corona:beer_mug: #coronavirus #dankmemes
2231701081709426619; 0; False; 1580259522; Waspadai corona virus yang sedang melanda beberapa negara di berbagai belahan dunia. Apa itu Corona virus ? Apa saja gejala yang ditimbulkan? Dan bagaimana cara mencegahnya? Cari tahu infonya di postingan instagram Jims Honey yuk! Dan jangan lupa untuk selalu waspada dan jaga kesehatan kamu ya! . . . #corona #coronavirus #Jimshoney #jimshoneysunter #viruscorona #staysafe
2231700805654807647; 0; False; 1580259519; :mountain::Mexico::police_car_light::Mexico::police_car_light::Mexico::police_car_light::Mexico::police_car_light::Mexico::police_car_light: :rolling_on_the_floor_laughing::rolling_on_the_floor_laughing::rolling_on_the_floor_laughing::raised_fist::raised_fist::rolling_on_the_floor_laughing::rolling_on_the_floor_laughing::rolling_on_the_floor_laughing::Mexico::Mexico: . . . . #coronavirus #mexico #cheve #cerveza #bromas #jokes #chistesmalos #chistesnegros #chistesrojos #mamon #bañado #ojete #monterrey #comedyclub #comedycentral #peda #nuevoleon #mexicano #laraza
2231700992436922113; 0; False; 1580259511; Daripada membebani pemerintah dengan cara menuntut ini itu lah kurang tanggaplah atau apalah bahkan sampe nyinyirin, ketahuilah pemerintah itu hanya manusia sama seperti kita yang terbatas pemikiran dan sudut pandangnya maka sudah sepantasnya kita bertaubat dan menyerahkan segala urusan ke Dzat yang Maha Kuasa, Maha Mengetahui, Maha Menjaga karena-Nyalah semua itu akan aman. Insyallah. — Rumaysho.com / Musibah Datang Karena Maksiat dan Dosa⠀ — #typographydesign #typogram #dakwahvisual #dakwahsalaf #psikologid #antidepressants #motivasihijrah #hijrahstory #creativemultipost #instagrammagazine #corona #coronavirus
2231698050771290825; 0; False; 1580259511; Люди приехавшие из Ухань с подозрением на коронавирус отказались сотрудничать с медицинским персоналом, после чего им просто заколотили дверь, чтобы они не смогли выйти. People who arrived from Wuhan with suspected coronavirus refused to cooperate with medical personnel, after which they simply bounded the door so that they could not exit. #coronavirus #chinavirus #вирускитай #chinapneumonia #вирускорона #hongkong #посылкиизкитая #viruscorona #sacs #ухань #коронавирус
2231700817818611325; 0; False; 1580259501; #武汉加油 #wuhanchina #wuhancoronavirus #2019ncov #спасиисохрани #wuhan #nocoment #wuhanuniversity #coronavirus #武汉大学
2231700841065558340; 0; False; 1580259493; Dois casos suspeitos de coronavírus são notificados no Sul do Brasil. #HCNoticias #coronavirus #Sul #saude
2231700839034390098; 4; False; 1580259493; #repost @empoweringallshadesofbrown #coronavirus
2231700826777354394; 0; False; 1580259491; #coronavirus
2231700822064783454; 5; False; 1580259491; Totally savage! :astonished_face: #coronavirus #coronavirusoutbreak #trump ##trump2020 #trumptrain #trumpsupporters #warrior12 #warrior12apparel #maga #makeamericagreatagain
2231700800227483227; 0; False; 1580259488; Las autoridades de salud de Estados Unidos están ampliando las revisiones a los viajeros internacionales en busca de señales de un nuevo virus originado en China, aunque sostienen que el riesgo para los estadounidenses es bajo. Miami Mundo / AP Para el “estadounidense individualmente, esto no debe afectar su vida cotidiana”, dijo el martes el secretario de Salud, Alex Azar, a la prensa. Hasta el momento se han confirmado cinco casos del coronavirus en Estados Unidos y no hay señales de que hayan contagiado la enfermedad respiratoria a quienes los rodean. Si bien los informes desde China indican que algunas personas pueden haber transmitido la enfermedad antes de exhibir los síntomas, no hay muestras de ello en Estados Unidos, dijo el doctor Robert Redfield, director de los Centros de Control y Prevención de Enfermedades (CDC). . @miamimundonews . #EEUU #amplía #revisiones #viajeros #coronavirus #MiamiMundo
2231700381033786425; 0; False; 1580259479; Jepang mengirimkan pesawat untuk mengevakuasi 200 warganya yang berada di tempat bermulanya wabah virus Corona. Ada sekitar 650 warga negara Jepang di Wuhan yang mengatakan ingin pergi meninggalkan kota itu. Jepang juga akan menerbangkan 1 atau 2 pesawat susulan untuk menjemput warga negaranya yang tersisa. Pesawat yang dicharter pemerintah Jepang itu juga membawa petugas medis lengkap dengan perlengkapannya. Ini adalah kali pertamanya Jepang mengevakuasi warganya dari luar negeri akibat mewabahnya penyakit menular. ⁣ ⁣ Virus Corona memiliki periode waktu inkubasi selama 14 hari dan bisa menyebabkan pneumonia. Virus ini bisa menyebar melalui batuk dan bersin ataupun melalui kontak langsung dengan penderita. Transmisi dari manusia ke manusia, selain di China juga telah terjadi di Jepang dan Jerman. Lebih dari 100 orang yang telah meninggal akibat virus ini.⁣ ⁣ Sumber: Japan Times, South Morning China Post, ANN News.⁣ . . Jepang siap sampe 2 kali balikan landing di china demi evakuasi warganya,,laaah di indo malah sibuk soal "bagaimana caranya....":face_with_medical_mask::sleeping_face::sleeping_face::sleeping_face::sleeping_face: ⁣ #jepang #jepun #japan #wuhan #china #coronavirus #viruscorona - #regrann
2231700704036508696; 1; False; 1580259477; Sounds like me Follow @dewpy20 Follow @dewpy20
2231700649795814291; 1; False; 1580259470; None
2231700601527682538; 3; False; 1580259464; Who lives in a :pineapple: under the :water_wave:?
2231698680996874902; 0; False; 1580259235; The very first Corona Virus patient cured! Unbelievable. #corona #coronavirus #blogging
2231691769522034110; 0; False; 1580258412; Diversos estudios, apoyan la eficacia de los ginsenósidos en la proliferación de los linfocitos, que resulta muy util en ancianos y pacientes con la capacidad inmunologica deprimida. :leaf_fluttering_in_wind::leaf_fluttering_in_wind::leaf_fluttering_in_wind::leaf_fluttering_in_wind::leaf_fluttering_in_wind::leaf_fluttering_in_wind::leaf_fluttering_in_wind::leaf_fluttering_in_wind::leaf_fluttering_in_wind::leaf_fluttering_in_wind::leaf_fluttering_in_wind::leaf_fluttering_in_wind::leaf_fluttering_in_wind::leaf_fluttering_in_wind::leaf_fluttering_in_wind::leaf_fluttering_in_wind: Nuestro tratamiento, aumenta la capacidad de las defensas contra agentes toxicos como virus de la gripe, catarros y potencia los efectos de la vacuna antigripal.:microbe::prohibited: :Ecuador::mobile_phone_with_arrow::Ecuador::mobile_phone_with_arrow:0962674807 Riobamba-Ecuador #naturalmaster #natural #coronavirus #salud #Riobamba #ecuador #sistemainmune
2231690141294225208; 0; False; 1580258217; he looks like having coronavirus . . . . . #meme #coronavirus #funnymemes #memesdaily #jokes #dontgetmad #justfun
2231644043100440140; 0; False; 1580252815; :eyes::face_with_monocle::thinking_face: Como si se tratara una película de invasión zombie :woman_zombie: :man_zombie:: Uno de los infectados por el Coronavirus de Wuhan intenta escapar partiendo el vidrio donde había sido aislado para más estudios #28Ene ⠀⠀⠀⠀⠀ ⠀⠀⠀ ⠀⠀⠀⠀⠀⠀ ⠀⠀⠀⠀⠀⠀ ⠀⠀⠀⠀⠀⠀ ⠀⠀⠀ ⠀⠀⠀⠀⠀⠀ ⠀⠀⠀ ⠀⠀⠀⠀⠀⠀ ⠀⠀⠀⠀⠀⠀ ⠀⠀⠀⠀⠀⠀ ⠀⠀⠀ ⠀⠀⠀⠀⠀⠀ ⠀⠀⠀⠀⠀⠀ ⠀⠀⠀ ••••••••••••••••••••••••••••••••••••••••••••••••••••••••••••••• ⠀ @doblemoralrd noticias #actualidad #internacional #republicadominicana #view #alerta #novedad #viral #rd #dominicannetflix #doblemoralrd #dominicana #jamaica #japon #jamaica #japon #franklinmirabal #licey #cuba #haiti #toros #faride #miami #angelestevez #hanley #bonilla #ericfilia #china #epidemia #coronavirus #pujeazul #seriefinallidom2020
2231700580515082406; 0; False; 1580259462; :Italy: #instagood #tb #summer #lake #garda #gardalake #picoftheday #photooftheday #instagood #traveler #travels #coronavirus #italy #landscape #paradise #traveling #wild #muscle #wanderlust #fit #mountains #nature #beach #love #fitnessaddict #fitnessboy #tattoo #memories
2231700560877120642; 0; False; 1580259460; Se confirman seis casos de coronavirus en Norteamérica. Cinco en los EE.UU y uno en Canadá. Las autoridades norteamericanas y canadienses confirman nuevos casos de coronavirus. En EE.UU suman cinco en total: uno en el estado Arizona, dos en California, uno en el estado de Washington y otro más en Illinois. El único caso canadiense fue registrado en la ciudad de Toronto. Nueva York, Los Ángeles, Bostón y Atlanta son algunas de las ciudades que cuentan con profesionales en sus aeropuertos para examinar y comprobar que los pasajeros llegados de la región de Wuhan en China, no hayan sido victima del brote epidémico. #coronavirus #epidemia #ee.uu #china #Canadá
2231700562353342459; 0; False; 1580259460; Conseguí está #infografia del #coronavirus que ahora comparto con ustedes. :woman_health_worker_light_skin_tone: - - Si alguien conoce el autor de la imagen, por favor me avisan. :winking_face: #MdAlejandraAlvarezFranco #PediatraIntegral
2231700447511743211; 0; False; 1580259456; Yuk, kita sejenak berdoa untuk Wuhan. Berdoa untuk #mahasiswaindonesia di sana agar dapat dievakuasi, berdoa untuk proses penelitian #coronavirus, berdoa untuk Rumah Sakit-Rumah Sakit yang ada di sana agar dapat #tetapkuat menghadapi pasien-pasien mereka dan ada persediaan obat dan tenaga medis. Please, jangan komentar azab-azab di akun gue. Toh kalau memang ini azab, apa memang mereka gak pantes mendapat belas kasihan Tuhan? Toh di sana banyak warga awam dan WNI juga, lho. #prayforwuhan #prayforchina
2231700341792289176; 2; False; 1580259439; Ight imma head out- ~ ~ #SuperSmashBros / #SORAFORSMASH ~ :pencil: < @Matthew.Niverse / @DrPhil > ~ Source < @Pokemon / @OfficialAnnieLennox > - - Follow My Art Acc! @Matthew.Niverse.Art - - #disney #cartoons #shitpost #kingdomhearts #nintendoswitch #nintendo #smashultimate #supermario #pokemon #pokemonswordshield #pokemonswordandshield #zelda #kirby #meme #memes #anime #nostalgia #onward #marvel #gamer #gaming #finalfantasy #pikachu #mysterydungeon #pokemonmysterydungeon #coronavirus #wuhanvirus #SORA4SMASH
2231691021938159051; 1; False; 1580259437; UPDATE ON CORONAVIRUS :microbe: :microscope: 1. Follow trustworthy information on the CORONAVIRUS :microbe:, OMS reports and health systems 2.Symptoms: Fever, cough, nasal congestion and respiratory difficulties 3. Transmission: animals to humans and humans to humans. 4. Prevention: face mask, wash your hands often-water and soap ———————————————- 1. Escuchemos y guiémonos de información oficial, no de noticias falsas y alarmantes. La OMS presenta constantemente actualizaciones sobre este virus y sus complicaciones. 2. Los síntomas principales de este virus se confunden con aquellos de enfermedades respiratorias: tos, cansancio, congestión nasal, signos de dificultad respiratoria y lo que nos sirve como alarma: LA FIEBRE cuantificada mayor a 38 grados centígrados. 3-4. Transmisión y prevención: el CORONAVIRUS no se tiene certeza de cómo se logra transmitir, por tanto, es necesario una prevención adecuada como el uso del tapabocas, lavado de manos constante y lo principal es la higiene :soap: corporal. #medicine #coronavirus #tiktok #prevention #colombia
2231700356354535480; 0; False; 1580259435; Curitiba é uma das três cidades brasileiras com casos suspeitos de coronavírus. Ontem, pela manhã, foi confirmada a primeira suspeita de uma paciente de Belo Horizonte (MG). No começo da noite o Ministério informou que foram notificados, até às 17 horas, outros dois casos suspeitos, em Curitiba e Porto Alegre (RS). E já no meio da noite, as secretarias de saúde do Paraná e de Curitiba confirmaram um segundo caso suspeito na Capital. (Foto: Reprodução) Saiba + no bemparana.com.br link na Bio. #coronavirus #coronavirusemcuritiba #casodecoronavirus #2cadosdecoronavirus
2231700198185573093; 0; False; 1580259416; INILAH.COM, Jakarta - Menteri Kesehatan (Menkes) RI, Terawan Agus Putranto menyebut kondisi kesehatan turis China dipantau ketat secara terus menerus selama berlibur di Indonesia untuk pencegahan penularan virus corona tipe baru atau novel coronavirus (2019-nCov). "Kita punya dua clearance kesehatan, dari negara China juga keluarkan clearance untuk warganya yang berjalan ke sini," kata Menkes Terawan di Jakarta, Selasa (28/1/2020). Terawan menjelaskan pemerintah memperketat pengawasan dikarenakan informasi terbaru yang dirilis Organisasi Kesehatan Dunia (WHO) bahwa virus corona bisa menular ke orang lain walaupun orang yang terinfeksi tidak memiliki gejala seperti demam dan batuk. Dia mencontohkan tujuh turis China di Manado Sulawesi Utara yang tidak melakukan pengecekan kesehatan ketika berangkat dari China ke Indonesia. Turis tersebut kemudian dikarantina terlebih dulu di dalam pesawat untuk dilakukan pengecekan kesehatan sebelum benar-benar turun dari pesawat. Ketika dinyatakan sehat, para turis China tersebut diperbolehkan berkunjung ke destinasi wisata taman laut Bunaken. Namun selama berada di Manado turis tersebut tetap dipantau kondisi kesehatannya walaupun sudah dinyatakan sehat pada pengecekan sebelumnya. Direktur Jenderal Imigrasi Kementerian Hukum dan HAM Ronny F Sompie mengatakan hingga saat ini tidak ada warga negara asing, termasuk WNA China, yang ditolak masuk ke Indonesia dan dikembalikan ke negaranya. Berdasarkan pengecekan petugas karantina kesehatan, tidak ada warga negara asing yang terdeteksi mengalami gangguan kesehatan saat sampai di bandara internasional, pelabuhan internasional, dan pos lintas batas negara. "SOP sudah dikoordinasikan, kita mengandalkan komunikasi dan koordinasi antar kementerian-lembaga, karena tiap bandara, pelabuhan, PLBN pasti ada bea cukai, imigrasi, dan karantina baik karantina ksehatan, tanaman dan hewan. #kemenkes #turis #china #coronavirus
2231700174546309357; 0; False; 1580259414; Stay healthy :woman_fairy::woman_fairy::woman_fairy::woman_fairy::woman_fairy: #coronavirus #coronavirusoutbreak #coronavirusprevention #singleparenting #health #selfcare #parenthood #welness #healthylifestyle #cutekids #diseaseprevention #healthymotivation #healthygoals #healthly #redcarpet #grammys :woman_fairy::woman_fairy::woman_fairy::woman_fairy::woman_fairy:
2231700152334585346; 0; False; 1580259411; Amen :folded_hands_medium-light_skin_tone::red_heart::raising_hands: #Amen #Jesus #Church #Godisgood #blessed #Bible #Church #Christian #gym #coffee #sports #love #igdaily #reading #books #God #jesussaves #forgiven935 #jesuschrist #fishing #nba #coronavirus #war #saved
2231700148384080928; 1; False; 1580259410; Decided to grab another $5 of #sbux right before closing today since it sank along with other #stonks on the #coronavirus “fears”... looking for a run to $100
2231700136589641783; 0; False; 1580259409; On a mission to get face masks and hand sanitizers ...... Everything sold out, we tried everywhere:face_with_rolling_eyes: #coronavirus #bkk
2231700127570753546; 0; False; 1580259408; Made in China #coronavirus#mulan#breath#mask#air
2231699395782716043; 5; False; 1580259407; *GRAPHIC FOOTAGE* Mass amounts of seizures supposably caused by the Corona virus. (This video is not confirmed) Purchase N95 Respirator Masks using the link in my bio to protect yourself. Stay safe everyone. Do you think this is from the coronavirus? #coronavirus #wuhan #china #wuhanvirus #coronavirusleaks #wuhannews #coronavirusnews #virusleaks #coronaleaks #wuhanleaks #wuhanvirusleaks #scary #chinesevirus #sarsvirus FOLLOW @coronavirusleaks FOR MORE UPDATES Turns out this video is a HOAX
2231700103462924258; 0; False; 1580259405; The Novel Coronavirus (2019-nCov) is the talk of the town now. Here are some common symptoms and ways to prevent getting infected. Stay calm, safe and vigilant, guys! #corona #coronavirus #fransiskahagency #staysafe #prayforwuhan
2231699982321295886; 5; False; 1580259391; I've literally have had this can of lysol for about 4 months right.... So how did the Lysol company known that it kills the Coronavirus???? :thinking_face::thinking_face::thinking_face::thinking_face: Pay attention Family:eye: #coronavirus #rizzaislam #depopulation #lysol
2231699955429792890; 0; False; 1580259387; Crítico y en terapia intensiva se encuentra el paciente chino sospechoso de tener #coronavirus, según el ministerio de @Salud_Ec. Ayer el director del equipo que lo atiende, Eduardo Castro, indicó que tiene infiltraciones en los pulmones y podría requerir de ventilación mecánica.
2231699945681139923; 0; False; 1580259386; Amen :folded_hands_medium-light_skin_tone::red_heart::raising_hands: #Amen #Jesus #Church #Godisgood #blessed #Bible #Church #Christian #gym #coffee #sports #love #igdaily #reading #books #God #jesussaves #forgiven935 #jesuschrist #fishing #nba #coronavirus #war #saved
2231699936001702638; 2; False; 1580259385; Un sindicato que representa a los trabajadores médicos en Hong Kong exige que el gobierno cierre su frontera con China para evitar la propagación del coronavirus de Wuhan. - En una declaración, la Alianza de Empleados de la Autoridad Hospitalaria dijo que si bien está de acuerdo con las medidas anunciadas por la presidenta ejecutiva Carrie Lam, exige el rechazo de todas las entradas a Hong Kong a través de China. - El grupo también pidió al gobierno que publique el número de flujos de pasajeros que ingresan a Hong Kong a través de China. - El sindicato, que dice que representa a 6.000 trabajadores médicos en Hong Kong, está amenazando con huelga si el gobierno no cierra su frontera con China para evitar la propagación del virus. • • #venezuela #venezolanos #noticias #maracaibo #islademargarita #valera #puertocabello #merida #caracas #puertolacruz #internacional #hongkong #china #coronavirus #salud #virus #cojedes # #cactus24 #puntofijo #valencia #maracay
2231699927545078032; 2; False; 1580259384; :rolling_on_the_floor_laughing::face_with_tears_of_joy: #corona #coronavirus #savage #gordonramsey #ramsey #sick #dirtymemes #banta #lol #humour #meme #memes #lmao #wtf #funny #f4f #l4l #s4s #follow #like #funnyvideos #funnymemes #funnyshit #memepage #newmemepage #comment #c4c #laughs #jokes #lool
2231697541079418544; 13; False; 1580259375; ¿Yo por qué soy tan bobo? :face_with_tears_of_joy: :face_with_tears_of_joy: :face_with_tears_of_joy: Se me perdió la monedita... . #Sexy #man #mujeres #hombresguapos #Tusa #DanceMonkey #corona #coronavirus #broma #humor #risa #Colombia #PEREIRA #cali #Medellin
2231699611990668739; 1; False; 1580259375; [CORONAVIRUS] . . En China los ciudadanos llegaron al extremo de pelearse por las mascarillas. . . Puesto que por la enfermedad que afecta al país asiático, las también conocidas tapa bocas se vendieron muy rápido, y las que encuentran son muy costosas. . . #InternacionalesET #28Ene #China #Coronavirus
2231698896634313616; 1; False; 1580259372; Udah deh,, biar nggak bingung pilih yang mana, sesuaikan aja standard perbuatan kita dengan standard nya Allah SWT. Jika Allah halalkan, lakukan. Jika diharamkan, tinggalkan . Sebuah inspirasi pagi dari juragan kopi. Mending minum kopi daripada sakit hati. Eh? . #coronavirus #corona #wuhan #china #uighur #hijrah
2231699809566225122; 0; False; 1580259370; Off to Paris for attending an international medical conference :kissing_face: Wearing a mask :face_with_medical_mask: for preventing corona virus infection:exclamation_mark: ・ 国際学会出席のためパリに行ってきます:kissing_face: 空港はほとんど全員マスク装着してる:exclamation_mark: 装着率90％以上:face_with_hand_over_mouth: ・ #airport#mask#coronavirus#hanedaairport #paris#conferance #medicalconference #aoiclinicginza#あおいクリニックギンザ#中野あおい#あおい先生#国際学会#パリ
2231699735177912196; 0; False; 1580259361; Well damn :face_with_tears_of_joy::face_with_tears_of_joy: :bat: #corona #coronavirus #china #flu #epidemic #pandemic #bats #kag #maga
2231699668318957345; 0; False; 1580259353; :double_exclamation_mark:ATTENTION ALL MA PEOPLE:double_exclamation_mark: it’s a must watch & if you got anything to say please let me know! #coronavirus #explore #viral #coronavirusoutbreak
2231699642123641181; 3; False; 1580259350; :glass_of_milk: Jaga kesehatan ya kaka. . Udah minum brp gelas hari ini kak? . . . ● Share ke teman2mu, . #mengenalSTIFIn #mengenalSTIFIn #kenaliduluaja #belajarfokussatuhebat #fokussatuhebat #stifininstitute #stifinguebanget #stifinjaktim #ambyar #sobatambyar #didikempot #bucin #jakarta #denpasar #psikologi #eragenetik #stifin #stifinparenting #stifinbisnis #sirkulasistifin #stifincouple #tesstifin #teststifin #tesstifinjabodetabek #coronavirus #corona #viruscorona
2231699552447477811; 0; False; 1580259339; #prevention #awareness #coronavirus
2231698999394511265; 0; False; 1580259339; EL CORONAVIRUS???? :flushed_face::flushed_face::flushed_face::flushed_face::flushed_face: @djchrisrd #coronavirus
2231699500857366635; 1; False; 1580259333; Spending the Chinese New Year in Nagasaki was explosive #radioactive #coronavirus
2231699494197860309; 62; False; 1580259332; #Coronavirus death toll rises to 131 people with nearly 5,500 confirmed cases. #China.
2231699201897968354; 0; False; 1580259298; Los coronavirus son un grupo numeroso de virus pertenecientes a la familia Coronaviridae. Se descubrieron en la década de los 60 pero su origen es todavía desconocido. En la actualidad se han registrado 39 especies de coronavirus. El coronavirus debe su nombre al aspecto que presenta, ya que es muy parecido a una corona o un halo. Se llaman así por sus puntas en forma de corona en la superficie del virus. La mayoría de las personas contraen en algún momento de su vida un coronavirus; los diferentes tipos de coronavirus provocan desde un resfriado hasta bronquitis, bronquiolitis, neumonía o un síndrome respiratorio grave. Un alto porcentaje de los coronavirus no son peligrosos y se pueden tratar satisfactoriamente. Sin embargo se han registrado 3 brotes epidémicos importantes causados por coronavirus: •El síndrome respiratorio agudo y grave (SRAS-CoV) en el 2002 •El síndrome respiratorio de Oriente Medio (MERS-CoV) en el 2012 •La neumonía de Wuhan (2019nCoV) el brote más reciente y en desarrollo actualmente. Se ha confirmado que este coronavirus se transmite no solo de los animales a las personas, sino de humano a humano. Se está trabajando arduamente para conseguir la vacuna y el tratamiento específico para combatir la infección por coronavirus. Todos podemos colaborar a no propagar a los coronavirus manteniendo una higiene básica: •Lavarse las manos con frecuencia con agua y jabón •Limpiar y desinfectar las superficies que toca con frecuencia •Cubrirse la tos y los estornudos con un pañuelo de papel •Evitar el contacto cercano con personas enfermas o usar mascarillas •Quedarse en casa cuando está enfermo. Cada acción cuenta para mantener el bienestar de todos. #Coronavirus #NeumoniadeWuhan #SRAS #MERS #PneumonieWuhan #Wuhanpneumonia #UnitedDoctorsLasTerrenas #UnitedDoctors #LasTerrenas #LasTerrenasEnSalud
2231699159593557253; 0; False; 1580259293; Additional information: A Japanese airlift has succesfully evacuated 200 passengers from Wuhan that were not infected. This morning a US-Airlift has also brought back their citizens from Wuhan. Australia might be next to airlift their citizens back home. - According to some people, the scanning at the airports might be non-effective due to the fact that the Virus has no symptoms for 7 days. What do you think about that?:thinking_face::down_arrow: - #follow4follow #l4l #followforfollow #fff #f4f #instalike #instalikesandfollowers4u #cute #tbt #like4like #followme #instagood #photography #photooftheday #likeforlike #love #instadaily #followback #lfl #picoftheday #germany #infection #coronavirus #virus #bavaria #confirmed #case #wuhan #china #instagram
2231698919175527497; 2; False; 1580259288; Makyaj yaparken depreme yakalanan kız. Gülsek mi ağlasakmı? [Kız Jokere Döndü] :face_with_tears_of_joy: #corona #coronarvirus #koronavirus #virüs #deprem #çin #Wuhan #türkiye #almanya #istanbul #izmir #adana #gaziantep #salgın #hastalık #coronavirues #CoronaVirus #takipçikazan #joker #antalya #trabzon #afad #küba #SonDakika #aztagram #followme #likeme #video #mizah #çin . Dünya'da Olan En Güncel Olay ve Gelişmelerden herkesten önce haberdar olmak istemezmisiniz? @reflexhaber Bizi Takip Edebilirsiniz.
2231699108196189326; 0; False; 1580259286; Personal de nuestra Dirección de Salud se adhieren a los protocolos de prevención por el #Coronavirus, mediante capacitaciones realizadas por el Ministerio de Salud Público. ¡Estamos siempre preparados y dispuestos a aportar por el bienestar ciudadano!
2231699061732694048; 0; False; 1580259281; #Repost @mcindonesia.shop with @repostsaveapp ・・・ Bentengi diri kita dari virus corona dengan Nu Vit NU VIT (Menguatkan Sistem Imun Tubuh) NO REGISTRASI BPOM : SI184310021 Kandungan : • Vitamin B6 • Vitamin B12 • Vitamin C • Selenium • Carrot Powder Manfaat : • Meningkatkan sistem imun tubuh • Meningkatkan ketahanan tubuh melawan penyakit, infeksi, dan kanker • Memberikan energi penuh sepanjang hari sepanjang waktu Rekomendasi penggunaan : Usia 5-15 tahun 1 kapsul 2 kali sehari sebelum atau sesudah makan Usia 16 tahun keatas 2 kapsul 2 kali sehari sebelum atau sesudah makan ISI 120 KAPSUL Sherly mci WA. 087822410589 #viruscorona #coronavirus #wuhan #supplement #multivitamin #nuvit #anticorona
2231699055616450172; 0; False; 1580259280; Por si acaso soy mujer #coronavirus
2231699013573177448; 0; False; 1580259275; Çin'in #Coronavirus ile mücadele politikasına dair afişler hazırlanmış. Beklenir onlardan #Wuhan #coronaviruschina #WuhanSARS
2231699007256531150; 0; False; 1580259274; Ahora si! No queremos nada que diga “made in China” #aeropuerto #avion #coronavirus #memes #momos
2231698956430604211; 0; False; 1580259268; Guess it’s not as bad as we thought. #corona #virus #coronavirus #twitter #china #wuhanvirus #wuhan #wuhanchina
2231698957562407237; 1; False; 1580259268; #coronavirus #oms
2231698896451281013; 0; False; 1580259261; All a test so keep on moving :smiling_face_with_smiling_eyes: #ww3 #coronavirus #taalvolcano #kobebryantsdeath #kobebryantsdaughterdeath #Jadinesbreakup #januaryobstacle
2231698899259733876; 0; False; 1580259261; O Ministério da Saúde informou na terça-feira que o Brasil tem três casos suspeitos de infecção pelo novo coronavírus, localizados em Belo Horizonte, Porto Alegre e Curitiba. "Os pacientes se enquadraram na atual definição de caso suspeito para NCOV-2019 (o novo coronavírus), estabelecido pela OMS (Organização Mundial de Saúde), ou seja, apresentou febre e pelo menos um sinal ou sintoma respiratório e viajou para área de transmissão local nos últimos 14 dias", disse o ministério em nota. "A Organização Mundial da Saúde (OMS) aumentou o nível de alerta para alto em relação ao risco global do novo coronavírus, por isso, o Ministério da Saúde orienta que viagens para a China devem ser realizadas em casos de extrema necessidade. Com quase três mil casos confirmados, segundo o último boletim da OMS, todo o território chinês passa a ser considerado área de transmissão ativa da doença", acrescenta a nota. O ministério não deu detalhes sobre os pacientes de Porto Alegre e Curitiba e tampouco informou sobre o estado de saúde de ambos. De volta ao Brasil, após viagem à Índia, o presidente Jair Bolsonaro disse a jornalistas nesta terça que iria procurar o ministro da Saúde para se inteirar da situação no país. "A OMS está dando grau máximo à possibilidade desse vírus se espalhar pelo mundo. Isso já aconteceu em outros momentos, como o H1N1, então temos que ficar preocupados", disse Bolsonaro. "Vou agora de manhã atrás do Mandetta tomar pé do que está acontecendo no momento." Foto: Reuters Passageiros vindos da China chegam ao aeroporto de Guarulhos, em São Paulo Acesse o nosso site na seção de notícias > Brasil para ler a matéria completa :backhand_index_pointing_right: www.alternativa.co.jp #alternativaonline #brasil #coronavirus #coronavirusnobrasil #mg #pr #rs #belohorizonte #portoalegre #curitiba #oms
2231698872896742257; 0; False; 1580259258; 황제팽귄 #유머 #유머스타그램 #유머짤 #유머감각 #개그 #공감 #웃자 #스마일 #웃음 #ㅋㅋㅋㅋㅋ #짤 #짤스타그램 #웃긴짤 #웃긴영상 #웃긴사진 #웃긴 #humor #joke #instahumor #comedy #humorous#coronavirus#virus#anime #animal #penguin #선팔맞팔#선팔하면맞팔#맞팔
2231698860305286768; 0; False; 1580259257; A masked day :grinning_face_with_sweat: #coronavirus #n95mask #feelingweird
2231698785226936631; 0; False; 1580259248; #Repost @karmagawa with @get_repost ・・・ :warning:WARNING GRAPHIC IMAGES:warning: Please share this URGENT post about the coronavirus epidemic with your followers as the origin of the virus has been traced to the zone of the Wuhan market where live wild animals like snakes, rats, bats and monkeys were traded before China instituted a temporary ban yesterday. But a temporary ban is NOT enough, WE MUST use our social media platforms to spread awareness and BAN WILD ANIMAL TRADING WORLDWIDE as this is EXACTLY what caused the SARS virus that killed nearly 800 people in 2003! SARS was 17 years ago and yet these markets are doing the exact same thing, selling live wild animals in unhygienic conditions that create diseases with devastating consequences for the entire human race! This new virus, which has no vaccine, has killed 82 people with 2,887 confirmed cases in 15 countries, numbers which have increased 50% SINCE YESTERDAY and 60 million more people are on lockdown to prevent further spreading. To stay updated in real-time our US followers can now text us at 323-310-1679 and also follow @karmagawa on Instagram too. Please pray for the world and share this URGENT post with your followers and tag people, celebrities, influencers and news media that need to see this and let’s work together to PERMANENTLY ban the trading of wild animals that create these deadly viruses! #coronavirus #endanimalcruelty #coronavirusoutbreak #karmagawa
2231698156575640097; 0; False; 1580259229; Corona Virus outbreak turns Wuhan into a ghost town. Purchase N95 Masks using the link in my bio. #coronavirus coronavirus #wuhan #china #wuhanvirus #coronavirusleaks #wuhannews #coronavirusnews #virusleaks #coronaleaks #wuhanleaks #wuhanvirusleaks
2231698582507847577; 0; False; 1580259224; #explorepage #explore #meme #memes #coronavirus
2231698562735845677; 0; False; 1580259221; :face_with_medical_mask:If you are concerned you may have come in contact with the coronavirus, or may be showing symptoms, you are encouraged to contact local health authorities at www.fraserhealth.ca. . . . . . . . #safe #staysafe #coronavirus #prepared #knowledge #wearmasks #prevention #community #virus @goufv @philufv @ufvarts @ufvbookstore @ufvfrenchclub @ufvbusinfo @sustainableufv @streatssusufv @ufvwsoc @ufv_ reslife @ufv_international @ufvarts @ufvmbb @ufvgdd @ufv_mycampuslife @ufvcirclek
2231698540833735178; 0; False; 1580259219; Nearly no people in Shanghai going out these days. 大年初三的无人上海 #coronavirus #Shanghai
2231698437158375795; 0; False; 1580259206; #coronavirus
2231698399586366794; 0; False; 1580259202; #coronavirus #china #chinaeats
2231698296045804985; 0; False; 1580259190; #facemask #influenza #coronavirus
2231698286960431460; 0; False; 1580259189; Apakah dalam waktu dekat ini kamu (terpaksa) harus mengunjungi negara atau wilayah yang sudah terjangkit Novel Coronavirus? Sangat disarankan untuk tetap menjaga kesehatan serta kebersihan tubuh agar terhindar dari risiko Novel Coronavirus dengan cara di atas! Yuk bagikan informasi penting ini ke seluruh teman atau keluarga kamu lainnya! #HelloSehat #coronavirus #viruscorona #sehat #corona
2231698272330700613; 0; False; 1580259187; [CORONAVIRUS] #28Ene Cómo se contagia y cuáles son las recomendaciones para evitarlo Aunque hasta hace unos días la Organización Mundial de la Salud (OMS) creía que la actual cepa del coronavirus solo se contagia de animales a humanos, luego se confirmó que entre personas también se transmite. En China, donde se originó la enfermedad, había 6000 casos confirmados hasta este lunes. La doctora Nathalie MacDermott, del King's College de Londres, apuntó que el virus podría transmitirse por vía aérea cuando la persona infectada tose o estornuda. Hasta ahora se sabe que el coronavirus es menos mortal que el SRAS (Síndrome Respiratorio Agudo Severo), pero más transmisible -al parecer incluso antes de la aparición de los síntomas- mientras que la comparación con su pariente arroja pistas sobre cómo combatir la epidemia. :heavy_large_circle:Así se transmite el coronavirus Especialmente, usted puede contagiarse si comparte el mismo espacio con una persona contagiada También se produce el contagio por contacto directo con una persona infectada. Aunque aún se investiga cómo se transmite el virus entre humanos, también se cree que podría ser a través de: :round_pushpin:Agua :round_pushpin:Fluidos sexuales :round_pushpin:A esto hay que apuntar que el virus no sobrevive más de tres horas en un ambiente seco. :heavy_large_circle:Cómo evitar el contagio del coronavirus Entre las principales recomendaciones, están: :round_pushpin:Taparse la nariz con la parte interna del codo al toser :round_pushpin:Lavarse las manos frecuentemente :round_pushpin:Usar pañuelos desechables :round_pushpin:Usar máscara quirúrgica, en caso de contagio (aunque aún no se ha confirmado que eso evite la propagación del virus a otras personas) . . . #VenezuelaInforma #VenezuelaInformaHoy #Coronavirus #China #Recomendaciones #Venezuela #Venezolanos
2231698260794298731; 0; False; 1580259185; Prevention is better than cure. :face_with_medical_mask::face_with_medical_mask::face_with_medical_mask: Keep safe from the #coronavirus, everyone! :heart_decoration:
2231698250167926756; 0; False; 1580259184; #PorFavor NO REPRODUZCAN TODO LO QUE LES LLEGA por las redes SIN CONFIRMAR: Mucha de esta información es #FALSA #coronavirus
2231698136937360679; 0; False; 1580259171; selfies in ya grandpappys room is def the way to go#coronavirus #staysafe
2231698053956797061; 0; False; 1580259161; Tune in to Face to Face at 11.15am #rtm #traxxfm #facetoface #MOH #coronavirus
2231698032190474277; 0; False; 1580259158; amen :folded_hands::folded_hands::folded_hands: . . . #ironymemes #onjah #okbuddyretard #bruhmoment #offensivememes #offensivememes:sweat_droplets::eyes::hundred_points::face_with_tears_of_joy::face_with_tears_of_joy::gem_stone::fire::face_with_steam_from_nose::sweat_droplets::OK_hand::hundred_points::face_with_tears_of_joy::folded_hands::face_with_tears_of_joy::face_with_tears_of_joy::gem_stone::gem_stone::fire::face_with_steam_from_nose::sweat_droplets::eyes::eyes: #deepfriedmemes #ironicmemes #surrealmemes #jujuonthatbeat #blackpeoplememes #weliveinasociety #cringememes #coronavirus #tiktokmemes #twittermemes #yeetusthatfetus #obamamemes #politicsmemes #gamermemes #nonormies #normiememes #okbuddyirony #edgymemes #guccigang #epicmemes #memeedits #roblox #redditmemes #fortnitememes
2231698017751392533; 1; False; 1580259156; :heavy_check_mark: |SaFe•FrOm•CoRoNa|:microbe: Hopefully. #coronavirus #mustanggt #fiveoh #slowaf #coyote #woods #savethemanuals #ihateyou
2231698003893450213; 0; False; 1580259155; Corona virus :skull_and_crossbones:... Please share this for humanity :folded_hands::disappointed_face: . #coronavirus #danger #precautions #besafe #share
2231697895581354327; 0; False; 1580259142; Vai ser só explosão de #doencasraras skskskskssisjsk . . #coronavirus #coronavirusmemes #coronavírus #coronaviruses #coronaviruschina #dengue #denguemata #memesdayli i #memes:face_with_tears_of_joy: #memes #memesespañol #memesbrasil #memedaily #memesenespañol #memesbr #memesdaily #memess #memesquad #memess #memesrlife #memesgraciosos #memestar #zoeira #zoeirasemlimites #zoeiradavida #zoeiraneverends #zueirasemfim #southamericamemes icamemes #southamericamemes10 . . @southamericamemes @southamericamemes.sam @samemes.com.br @naoeasam @saporra_radio @saporrasincero @saporra_nordestino @saporramita_ @memesbrr1
2231694786411160727; 1; False; 1580259139; :SOS_button:LÜTFEN LÜTFEN DIKKAT EDIN HERSEY BIRDEFA OLUYOR :double_exclamation_mark::double_exclamation_mark: - AGZINIZA MASKE TAKIN -ELLINIZI SUREKLI YIKAYIN -MEYVE YIYIN VITAMINLER ALIN -COK INSAN OLAN YERLERDEN UZAK KALIN :thumbs_up_medium-light_skin_tone: KENDINIZE IYI BAKIN :thumbs_up_medium-light_skin_tone: ALLAH HEPIMIZI KORUSUN INSALLAH :palms_up_together_light_skin_tone: . . ARKADASLARINIZI ETIKETLEYIN VE PAYLASIN COOK ÖNEMLI HERKEZ BILSIN :double_exclamation_mark::double_exclamation_mark::double_exclamation_mark::double_exclamation_mark: #koronavirus #koronavirüsü #coronavirus
2231697652697536346; 0; False; 1580259131; • Menteri Terawan : "Penyakit Coronavirus bisa sembuh sendiri" • Semoga Rakyat china melihat Video Menkes ini, Agar mereka tetap Tenang, Enjoy, Aman.. :beaming_face_with_smiling_eyes: ____________________________ @piisangmanis #wuhanchina #wuhan #coronavirus #menkes
2231697314334247887; 0; False; 1580259129; Reposted from @sestelares Pois é, triste ter que abordar esse assunto diante de tantas coisas que vemos no mundo, mas a intenção não é causar medo, mas sim para que possamos estar :police_car_light: alerta ao que está acontecendo ao redor do mundo e nos laboratórios :test_tube: sem sabermos de fato a verdade que nos cerca. Diante de tudo isso,não temos muitos recursos, apenas fé e orar para que o divino possa ter controle sobre as ações [des]humanas. Isso não se trata de um julgamento, mas a dúvida é que esse vírus que estava “inativo” desde 1960 não pode ter sido reativado do nada. O provável fato seja de que a própria China em seus possíveis estudos tenha perdido controle da contenção do vírus em algum momento, a segunda possibilidade é diminuir a população e a terceira é que pode ter sido enviado pelos EUA, mas isso são apenas suposições, não sabemos a verdade, a única coisa que sabemos é que a realidade dos filmes já está acontecendo e o futuro da humanidade está nas mãos do poderosas materialistas, infelizmente. Mas não pensem que isso está acontecendo sem ser visto, pois os irmãos estelares estão sim a parte de tudo e estão se movimentando nas esferas siderais e em suas naves para previnir que algo de cunho pior aconteça. O grande medo era a guerra nuclear, mas o invisível aos olhos pode ser mais perigoso e bélico. Estejamos alertas e preparados. - :folded_hands_light_skin_tone::folded_hands_light_skin_tone::folded_hands_light_skin_tone::folded_hands_light_skin_tone:Oremos :folded_hands_light_skin_tone: nada está perdido, e devemos entender que as vezes o que parece mau, surge a cura! :folded_hands_light_skin_tone::folded_hands_light_skin_tone::folded_hands_light_skin_tone::folded_hands_light_skin_tone: Jesus está guiando a terra. Confiemos sempre. - COMPARTILHE COM SEUS AMIGOS:recycling_symbol: - :warning:MARQUEM SEUS AMIGOS:warning: - :double_exclamation_mark:Ative as notificações :double_exclamation_mark: - -- - - #despertar #nibiru #anunnaki #ufo #ufologia #alien #aliens #like4likes #likeforfollow #instalikes #ovni #extraterrestrials #confederacaodemundos #novaera #thematrix #espiritualidade #historian #ufologia #alien #reptilianos #likeforfollow #instalikes #chemtrail #coronavirus #chemtrailspraying #coronavirusoutbreak #followforfollowback #instagram #virus #china:China: #orion #fema #alertamundial #china
2231697778608911418; 0; False; 1580259128; #coronavirus @minsaude #BiomedicosGenteBoa #biomedica #biomedico #bioquimica #urinalise #urina #analisesclinicas #analisesclinicasporamor #biomedicina #farmacia #laboratorio #laboratorioclinico #analistaclinico #saude #hematologia #liquidoscorporais #imunologia #whatsapp #redesocial #virus
2231697576502167337; 0; False; 1580259108; #:eyes:previouspost Repost Coronavirus outbreak turns Wuhan into ghost town #Wuhan #China #coronavirus #coronavirusoutbreak #coronaviruschina
2231697597836074873; 0; False; 1580259106; Biasa nya ijo identik sama kesegaran. Betul apa bener? Kalau kamu jawab betul ya emang bener:beaming_face_with_smiling_eyes: Liat deh, BODYWASH SR12 . Baru di lihat udah kerasa kesegaran nya:smiling_face_with_heart-eyes: Gimana di aplikasikan ke tubuh? Jangan heran kalau nanti nya kamu akan merasakan mandi mu beda dari biasa nya. Selain membuat tubuh mu segar sepanjang hari, Butiran scrub yang terkandung di dalam nya juga mampu membuat kotoran / daki di tubuh mu rontok gaees. Jadi mandi udah kaya luluran ceritanya. Lebih hemat uang, waktu dong pasti nya:winking_face: #bodywash #sr12skincareherbal #sr12ciamis #sr12cosmeticskincare #sr12skincarebpom #coronavirus
2231697148120946995; 0; False; 1580259100; #IG_CORDOVA_MEDIA Jepang mengirimkan pesawat untuk mengevakuasi 200 warganya yang berada di tempat bermulanya wabah virus Corona. Ada sekitar 650 warga negara Jepang di Wuhan yang mengatakan ingin pergi meninggalkan kota itu. Jepang juga akan menerbangkan 1 atau 2 pesawat susulan untuk menjemput warga negaranya yang tersisa. Pesawat yang dicharter pemerintah Jepang itu juga membawa petugas medis lengkap dengan perlengkapannya. Ini adalah kali pertamanya Jepang mengevakuasi warganya dari luar negeri akibat mewabahnya penyakit menular. ⁣ ⁣ Virus Corona memiliki periode waktu inkubasi selama 14 hari dan bisa menyebabkan pneumonia. Virus ini bisa menyebar melalui batuk dan bersin ataupun melalui kontak langsung dengan penderita. Transmisi dari manusia ke manusia, selain di China juga telah terjadi di Jepang dan Jerman. Lebih dari 100 orang yang telah meninggal akibat virus ini.⁣ ⁣ Sumber: Japan Times, South Morning China Post, ANN News.⁣ ⁣ #jepang #jepun #japan #wuhan #china #coronavirus #viruscorona
2231697538426292139; 0; False; 1580259099; Punyamu Kecil? Tidak tahan lama? Kurang puas melayani istrimu? Sekarang kamu bisa menyelesaikannya dgn paket STRONG SUPLEMEN DARI TIENS. ALAMI HERBAL, AMAN, BPOM, FDA AMERIKA, TGA AUSTRALIA, HALAL MUI, TOP 500 ASIA BRAND !!! DAN REKOMENDASI TERAPI HERBAL DARI PARA DOKTER !! Khasiat : :fire:Memperbesar Mr.p :fire:Memperpanjang Mr.p :fire:Mengeraskan Mr.p (ereksi tahan lama) :fire:Mengatasi Ejakulasi dini :fire:Mengatasi Impotensi :fire:Menambah stamina jadi kuat dan tahan lama. . UNTUK INFORMASI SEPUTAR PRODUK, KONSULTASI & ORDER SILAHKAN HUBUNGI : WA : +6288223682110 Pemesanan Bisa COD #politikindonesia #coronavirus #tenis:tennis: #vollyball
2231697449188255900; 0; False; 1580259089; Punyamu Kecil? Tidak tahan lama? Kurang puas melayani istrimu? Sekarang kamu bisa menyelesaikannya dgn paket STRONG SUPLEMEN DARI TIENS. ALAMI HERBAL, AMAN, BPOM, FDA AMERIKA, TGA AUSTRALIA, HALAL MUI, TOP 500 ASIA BRAND !!! DAN REKOMENDASI TERAPI HERBAL DARI PARA DOKTER !! Khasiat : :fire:Memperbesar Mr.p :fire:Memperpanjang Mr.p :fire:Mengeraskan Mr.p (ereksi tahan lama) :fire:Mengatasi Ejakulasi dini :fire:Mengatasi Impotensi :fire:Menambah stamina jadi kuat dan tahan lama. . UNTUK INFORMASI SEPUTAR PRODUK, KONSULTASI & ORDER SILAHKAN HUBUNGI : WA : +6288223682110 Pemesanan Bisa COD #politikindonesia #coronavirus #tenis:tennis: #vollyball
2231697048514859516; 0; False; 1580259085; Reposted from @cordova.media Jepang mengirimkan pesawat untuk mengevakuasi 200 warganya yang berada di tempat bermulanya wabah virus Corona. Ada sekitar 650 warga negara Jepang di Wuhan yang mengatakan ingin pergi meninggalkan kota itu. Jepang juga akan menerbangkan 1 atau 2 pesawat susulan untuk menjemput warga negaranya yang tersisa. Pesawat yang dicharter pemerintah Jepang itu juga membawa petugas medis lengkap dengan perlengkapannya. Ini adalah kali pertamanya Jepang mengevakuasi warganya dari luar negeri akibat mewabahnya penyakit menular. ⁣ ⁣ Virus Corona memiliki periode waktu inkubasi selama 14 hari dan bisa menyebabkan pneumonia. Virus ini bisa menyebar melalui batuk dan bersin ataupun melalui kontak langsung dengan penderita. Transmisi dari manusia ke manusia, selain di China juga telah terjadi di Jepang dan Jerman. Lebih dari 100 orang yang telah meninggal akibat virus ini.⁣ ⁣ Sumber: Japan Times, South Morning China Post, ANN News.⁣ ⁣ #jepang #jepun #japan #wuhan #china #coronavirus #viruscorona - #regrann
2231697387599138496; 0; False; 1580259081; Punyamu Kecil? Tidak tahan lama? Kurang puas melayani istrimu? Sekarang kamu bisa menyelesaikannya dgn paket STRONG SUPLEMEN DARI TIENS. ALAMI HERBAL, AMAN, BPOM, FDA AMERIKA, TGA AUSTRALIA, HALAL MUI, TOP 500 ASIA BRAND !!! DAN REKOMENDASI TERAPI HERBAL DARI PARA DOKTER !! Khasiat : :fire:Memperbesar Mr.p :fire:Memperpanjang Mr.p :fire:Mengeraskan Mr.p (ereksi tahan lama) :fire:Mengatasi Ejakulasi dini :fire:Mengatasi Impotensi :fire:Menambah stamina jadi kuat dan tahan lama. . UNTUK INFORMASI SEPUTAR PRODUK, KONSULTASI & ORDER SILAHKAN HUBUNGI : WA : +6288223682110 Pemesanan Bisa COD #politikindonesia #coronavirus #tenis:tennis: #vollyball
2231697330515762513; 0; False; 1580259074; Peringatan Kementerian Kesihatan Malaysia #sinarharian #coronavirus #China #virus #sars #WuhanCoronavirus #CoronovirusOutbreak #wuhan #koronavirus Sumber: Kementerian Kesihatan
2231696947432379312; 3; False; 1580259073; Jepang mengirimkan pesawat untuk mengevakuasi 200 warganya yang berada di tempat bermulanya wabah virus Corona. Ada sekitar 650 warga negara Jepang di Wuhan yang mengatakan ingin pergi meninggalkan kota itu. Jepang juga akan menerbangkan 1 atau 2 pesawat susulan untuk menjemput warga negaranya yang tersisa. Pesawat yang dicharter pemerintah Jepang itu juga membawa petugas medis lengkap dengan perlengkapannya. Ini adalah kali pertamanya Jepang mengevakuasi warganya dari luar negeri akibat mewabahnya penyakit menular. ⁣ ⁣ Virus Corona memiliki periode waktu inkubasi selama 14 hari dan bisa menyebabkan pneumonia. Virus ini bisa menyebar melalui batuk dan bersin ataupun melalui kontak langsung dengan penderita. Transmisi dari manusia ke manusia, selain di China juga telah terjadi di Jepang dan Jerman. Lebih dari 100 orang yang telah meninggal akibat virus ini.⁣ ⁣ Sumber: Japan Times, South Morning China Post, ANN News.⁣ . Repost @cordova.media ⁣ #jepang #jepun #japan #wuhan #china #coronavirus #viruscorona
2231697298495462001; 9; False; 1580259071; Сахалинская туристка Олеся К. рассказала astv.ru об отдыхе в Китае :China: во время эпидемии коронавируса. ⠀ Сейчас девушка находится на острове Хайнань, куда прилетела 25 января. ⠀ Сотрудники туристической фирмы предупредили, что она может полететь, но никакой ответственности за последствия компания нести не будет. ⠀ Олеся рассказала, что сейчас в курортном городе мало туристов. Достопримечательности на острове закрыты для посещений из-за распространения инфекции. Можно съездить только на обзорную экскурсию. Самостоятельные прогулки по городу еще возможны. ⠀ Местные жители, сотрудники отеля и туристы используют респираторные маски. Чтобы минимизировать вероятность заражения, Олеся не планирует покидать территорию района, в котором живет, посещать места скопления людей. И попытается не вступать в контакт с местным населением. ⠀ Также сахалинка связалась со своим туроператором и ждет решения вопроса о вывозе туристов с территории китайского острова в Россию. ⠀ Отметим, что в аэропорту Южно-Сахалинска у пассажиров, прилетевших из Азии, проверяют температуру тела. ⠀ Все туристы также имеют право сдать купленные путевки в Китай с полным возвращением своих денег. Такое решение озвучили в Федеральном агентстве по туризму. ⠀ Напомним, первые сообщения о новом коронавирусе появились 31 декабря 2019 года. Болезнь обнаружили в китайском городе Ухань. ⠀ Около 100 человек скончались от пневмонии. Инфицирование новым коронавирусом подтвердили в Южной Корее, Японии, Таиланде, США, Австралии, Сингапуре, Малайзии, Франции, Вьетнаме, Непале, Канаде, передает «Интерфакс». ⠀ В связи с санитарно-эпидемиологической обстановкой авиакомпания AZUR air 27 января приостановила завоз русских туристов на остров Хайнань и организует вывоз отдыхающих в кратчайшие сроки. ⠀ #коронавирус #аств #хайнань #китай #coronavirus #china #astv
2231697289285876262; 0; False; 1580259070; SOROGLOBULIN MAX Es un suero hiperinmune que contiene anticuerpos específicos para actuar en la prevención y tratamiento de las siguientes enfermedades: • MOQUILLO • CORONAVIRUS • PARVOVIROSIS SOROGLOBULIN MAX neutraliza estos virus circulantes, evitando la progresión de los síntomas. Su agilidad en la administración evita la evolución del cuadro clínico, ofreciendo una mayor probabilidad de cura. Por tanto, al observar los primeros síntomas: • Fiebre • Pérdida de apetito • Descarga nasal • Diarrea • Vómitos • Deshidratación • Tos • Dificultad para respirar Consultar al médico veterinario quien diagnostica y procede rápidamente al tratamiento. La capacidad de reconocer y neutralizar los virus de la misma manera que los anticuerpos naturales de un perro, es una ACCIÓN INMEDIATA de SOROGLOBULIN MAX. @mis4paticas distribuye cuidando todos los protocolos de conservación #suero #serum #anticuerpos #enfermedades #diseases #dog #healthy #veterinary #clinicaveterinaria #veterinaryclinic #dogs #dogsofinstagram #animals #animallovers #health #instagood #tips #instaphoto #information #medicine #vet #venezuela #coronavirus #moquillo #parvovirus #instalike #instafollow
2231688089841983540; 0; False; 1580259061; Fuente : @lapostaec . . #coronavirus #informacion #quito #ecuador #salud #health #laposta #new #guayaquil #wuhan #uio
2231697211498298925; 5; False; 1580259060; If you haven’t had your ice cream in a Hong Kong Bubble Waffle you are missing out !
2231694826608695925; 0; False; 1580259053; :woman_facepalming: . . . . . . . . . . #meme #dank #dankmeme #funnyshit #hilariousmemes #hilarious #funnymemes #funnyvideos #tiktok #tiktokmemes #corona #mexicomemes #hispanicmemes #coronavirusmemes #coronavirus #takis #elsamemes #babyyoda #relatablememes #relatable
2231697122756281962; 0; False; 1580259050; Menteri Kesehatan (Menkes) Terawan Agus Putranto menegaskan hingga kini tidak ada penderita (suspect) yang positif terkena virus korona di Indonesia. . Hal itu dikemukakan Terawan di sela kegiatan Ramah Tamah dan Silaturrahmi dengan jajaran tim kesehatan RS Wahidin Sudirohusodo, RS Pusat Jantung Koroner dan Dinas Kesehatan setempat di Makassar, Minggu (26/1/2020). "Tidak ada yang disuspek, ayo hidup sehat, jaga kesehatannya tidak akan ketularan," ujar Terawan Agus Putranto . . #dokterterawanagusputranto #menterikesehatan #Kutipan #Menkes #VirusKoronoa #CoronaVirus #Berita #BeritaTerkini #InstaNews #News #Info #Indonesia #Viral #NewsUpdate #BeritaSatu #regrann @beritasatu
2231697103084344411; 0; False; 1580259047; El mundo está en alerta ante la aparición de un nuevo virus mutado en China, que ya se empieza a expandirse por el mundo, y que causa la muerte de muchos de aquellos que son infectados. . . Las naciones de Asia, Europa y de América se alistan para realizar cercos epidemiológicos, las laboratorios del mundo trabajan incesantemente en una vacuna o tratamiento que le ponga un alto al denominado "Coronavirus". China declaró en cuarentena a 16 ciudades, limitó el transporte público y cerró sus aeropuertos. Aproximadamente 46 millones de personas impedidas de movilizarse desde el pasado sábado. . . La humanidad, en los últimos años, ha sido golpeada por una serie de enfermedades nuevas que cada cierto tiempo ponen en vilo a todas las sociedades del mundo. . . Oremos para que las naciones encuentren rápido una cura o tratamiento a este mal; pidamos a Dios que salga de alguna mente sabia una vacuna o la elaboración de un tratamiento efectivo. . . . . . . . #coronavirus #corona #virus #china #wuhan #sintomas #prevencion
2231697100014292460; 0; False; 1580259047; #FastAndCoronaVirus #CoronaVirus #Memes
2231696630034019401; 0; False; 1580259046; [Waspada] Coronavirus (CoV) adalah keluarga besar dari virus yang menyebabkan penyakit, mulai dari flu biasa hingga penyakit yang lebih parah, seperti Middle East Respiratory Syndrome (MERS-CoV) dan Severe Acute Respiratory Syndrome (SARS-CoV). Sebagian besar coronavirus adalah virus yang tidak berbahaya. :thinking_face: . Coronavirus adalah virus zoonosis, artinya virus ini disebarkan melalui hewan dan manusia.:face_with_raised_eyebrow: . Dikutip dari WHO, investigasi menunjukkan bahwa SARS-CoV ditularkan dari musang ke manusia, sementara itu MERS-CoV ditularkan dari unta dromedaris ke manusia. Terdapat pula beberapa CoV lain yang terdapat pada hewan, tapi belum menginfeksi manusia. :relieved_face: . CoV pada manusia (HCoV) pertama kali ditemukan pada tahun 1960 di hidung pasien yang terkena flu biasa.:thinking_face: . Dua coronavirus pada manusia, yaitu OC43 dan 229E, adalah yang bertanggung jawab atas terjadinya sebagian flu biasa.:winking_face: . Virus ini diberi nama berdasarkan proyeksi mirip mahkota di permukaannya. “Corona” dalam bahasa Latin berarti “halo” atau “mahkota”.:slightly_smiling_face: . Penyebaran coronavirus adalah sama seperti virus yang penyebab flu lainnya, seperti dari batuk dan bersin, atau dari sentuhan orang yang terinfeksi. :grinning_face: . Hampir semua orang pernah terinfeksi CoV setidaknya sekali seumur hidupnya, biasanya terjadi pada anak-anak.:thinking_face: . Coronavirus adalah virus yang umumnya muncul pada musim gugur dan dingin di Amerika Serikat. Namun, semua orang bisa terkena virus ini kapan pun.:smiling_face_with_smiling_eyes::folded_hands: . sumber : hellosehat.com . . #salingmengingatkan #DanangismeIndonesia #DanangismeSupportDanang #dmdmversidanang #danangisme #danang_official91 #host #singer #geniusofdangdut #pagipagipastihappy #jalansoresore #kilaudmd #dacademyasia #5thanniversary #viruscorona #coronavirus #corona #virus #korona#VirusKorona #infokemanusiaansosial #kemanusiaan #sosial
2231696987739205220; 0; False; 1580259034; THIS is why I get my flu shot #flu #vaccine #flushot #coronavirus #vaccineswork
2231696976189970860; 0; False; 1580259032; #coronavirus #china:China:
2231696961927466478; 0; False; 1580259031; Untuk sahabat promosi kesehatan kerja dan Olah Raga, yuk kita cegah terinfeksi Coronavirus dengan melakukan pola hidup bersih dan sehat seperti berikut ini. #ncov #coronavirus #viruscorona #gejalacoronavirus #vaksincoronavirus #germas #phbs
2231696949095383870; 1; False; 1580259029; #Repost @robertosomocurcio ・・・ Información importante sobre el #coronavirus . :microbe: . . Personas con enfermedades crónicas que afecten las vías respiratorias, o las que causan disminución en las defensas, bebés prematuros y ancianos. . . Los demás si nos contagiamos, tendremos un gran resfrío. . . A lavarse las manos, cubrirse al toser y guardar cama si estamos enfermos. . Ante cualquier signo de alarma: fiebre constante, dificultad para respirar, vomitos constantes.... acudir al centro de salud más cercano, sobretodo si ha viajado cercanamente a lugares donde el virus está circulando. . . Esperemos con paciencia y sin alarma las indicaciones del @minsa_peru . . . #pacienciaybuenhumor #pediatraypapá #coronavirus #niños #infecciones #gripe #alertaepidemiológica
2231696939884082882; 0; False; 1580259028; A ideia não é detectar casos de coronavírus ainda no aeroporto, já que os sintomas levam até 15 dias para se manifestarem. O propósito é fazer com que os passageiros fiquem informados e saibam identificar os sintomas. Matéria completa em nosso site. Link na bio. #coronavirus #prevenção
2231696840687194915; 0; False; 1580259016; Corona virus warning, please be cautious; pray for all. Stay healthy #coronavirus #corona #virus #china:China: #danger #washhands
2231696760954667336; 0; False; 1580259007; Jimat beli zink plus bulan ni sebab beli 1 PERCUMA 1 hanya rm56 dapat 2 botol. 20mg zink sehari boleh bantu kuatkan sistem imun badan lawan #coronavirus. Ambil bersama #vitaminc, Vitamin E, ostematrix sebab ada magnesium dan vitamin D (ikut kajian terkini). . Zink ni adalah salah satu mineral yang kerjanya fight infection dan penghasilan sel dalam badan. . Walaupun murah, banyak sekali kelebihan zink ni terutama mereka yang ada #jerawat, pasangan yang sedang merancang zuriat dan ibu2 hamil dan yang bakal bersalin. Grab yours today. Sediakan perisai badan secukupnya, itu usaha kita. . #shakleekuantan #codshakleekuantan
2231696732784343198; 0; False; 1580259003; Virus kebencian lebih berbahaya dari virus corona. Hanya karena satu berita, di antara kita langsung menyimpulkan... Musibah apapun banjir, gempa, utamakanlah empati pada korban, bukan dipolitisasi. Selengkapnya baca di. https://www.tempo.co/read/1300328/hormati-korban-netizen-diminta-tidak-melucu-soal-virus-corona #human #humanity #corona #coronavirus #viruscorona #china #influencer #hariqo #komunikonten #socialmedia #mediasosial #smtmedsos #digitalempathy #virus #awareness
2231696718517213574; 0; False; 1580259002; :police_car_light:#LOÚLTIMO | Los pacientes recién fallecidos eran de la provincia de Hubei, donde se originó el brote del mortal virus. Las nuevas víctimas mortales de la enfermedad, así como los que recién la han adquirido, son de la provincia de Hubei, que alberga a Wuhan, el epicentro del brote que ya totaliza 131 muertos y más de 5340 infectados. Vía @larepublica_pe . . . . . #China #wuhan #coronavirus #photojournalism #Photographer #Photography #Canon #Documentaryphotography #documentary #filmphotography #filmmaker
2231696485145618092; 0; False; 1580258974; We Carry BIOESQUE!!! All natural chemical free products with proven results. CDS Construction Distribution Supply 416-665-8006 or 1-877-380-7655 #Bioesquesolutions #Bioesque #allnatural #chemicalfree #cleaning #chemicalshurt #safecleaning #safecleaningproducts #restorationproject #cds.guru #restoration #moldkiller #killsmoldbacteriavirus #coronavirus #degreaser #cdsconstruction #lysoleverything #chemicalfree #thymox #breatheasy #chemicalshurt #nontoxic
2231696483340518267; 0; False; 1580258973; O Coronavírus 2019-nCoV tem feito a gente tremer!! Já temos 3 casos suspeitos no Brasil! O Center for Systems Science and Engineering (CSSE) da Johns Hopkins University (JHU) @johnshopkinsu divulga um visualização de dados em tempo real do avanço da doença! Confira no link http://shorturl.at/arwH2 #estatistica #datascience #cienciadedados #datascientist #cientistadedados #analisededados #inteligenciaartifici #bigdada #grandesdados #rstats #rstudio #python #programming #programando #aprendizadodemaquina #aprendizagemdemaquina #machinelearning #dataanalytics #dataanalysis #coding #coder #programador #deeplearning #artificialintelligence #dados #analisededados #imeufba #ledufba #coronavirus #2019ncov #health
2231696438629627968; 0; False; 1580258968; Make this go #viral @lowkeysucces5 #coronavirus
2231696432582928523; 0; False; 1580258967; 2020 is the year of preliminary actions for 2021-2030...Saddle up folks, the next 9+ years is about to be wild and beyond the average imagination. :folded_hands::eye::om::eye::folded_hands: #agenda21 #billgates #coronavirus #vaccineagenda #bigpharma #snakeoil #healthiswealth #fluoridefreehumans #freethinkers #decalcifyyourpinealgland #pinealgland #truthinplainsight #antimatrix #plantsnotpills #higherfrequency #higherchannel #inlakech
2231696424370670793; 0; False; 1580258966; Thanks to @jocameron_coach for sharing this, the fear mongering makes much more sense when you realize the World Bank is withholding aid and profiting off these pandemics. #coronavirus #worldbank https://foreignpolicy.com/2019/07/22/the-world-bank-has-the-money-to-fight-ebola-but-wont-use-it/ https://www.worldbank.org/en/news/press-release/2017/06/28/world-bank-launches-first-ever-pandemic-bonds-to-support-500-million-pandemic-emergency-financing-facility?fbclid=IwAR0iETMAtA7bsz-DUcR1oLbTrSOO-nFdfbe9uywF4Rb5-njDvCGcZQuV1hE
2231696411821151280; 0; False; 1580258965; Info On Wheels Pejabat Penerangan Daerah Pokok Sena 28 Januari 2020 Unit Hebahan Bergerak Jabatan Penerangan Malaysia merupakan platform yang digunakan untuk menyampaikan maklumat dan dasar-dasar kerajaan secara bersemuka kepada seluruh lapisan masyarakat. Fokus penyampaian maklumat pada hari ini adalah berkenaan: :large_blue_diamond: Novel Coronavirus (2019-nCoV) :large_blue_diamond: Langkah-langkah Pencegahan :large_blue_diamond: Tanda & Gejala :large_blue_diamond: Inisiatif-inisiatif kerajaan Kawasan yang terlibat: Sekitar Pekan Pokok Sena #coronavirus #JabatanPenerangan #SayangiMalaysiaku #MalaysiaBersih #KemakmuranBersama #Makmur2030 #KitaMalaysia #Malaysia #Japenkedah #Japensena
2231696396871784731; 2; False; 1580258963; Mejor Prevenir que lamentar... #Coronavirus Por favor, cuidate #Urólogo #Endourólogo #Tumores #CálculosRenales _ ¡Cerca de ti! #ClinicaSanatrix Miér y Vier 8am - 3pm :telephone:0212-2659594
2231696365860624806; 0; False; 1580258959; Se espera que los estadounidenses lleguen al aeropuerto de internacional de Ontario, en el estado de California Washington.- Un avión con personal diplomático de Estados Unidos y otros ciudadanos estadounidenses ya ha salido de la ciudad china de Wuhan, epicentro del brote de coronavirus, informó este martes a Efe un portavoz del Departamento de Estado. ‘El vuelo de Wuhan ha salido’, se limitó a decir la citada fuente. Se espera que los estadounidenses lleguen al aeropuerto de internacional de Ontario, en el estado de California y a unos 65 kilómetros de Los Ángeles, aunque por el momento no hay confirmación oficial por parte de las autoridades federales, explicó a Efe David Wert, portavoz del condado de San Bernardino, donde se halla el aeropuerto. ‘Estamos preparados para que, si llegan aquí, podamos darles toda la asistencia que puedan necesitar y para separarlos del resto de la población’, indicó Wert, que aseguró que también están preparados para atender a los niños que puedan venir en el vuelo. Este fin de semana, el Departamento de Estado anunció que estaba organizando un vuelo chárter expresamente destinado a evacuar a su personal diplomático de Wuhan. Además, en esa aeronave, podrán viajar los ciudadanos estadounidenses que quieran costearse el billete a título personal. El Gobierno de EE.UU. ha aconsejado a sus ciudadanos evitar los viajes a China y, expresamente, recomienda no trasladarse a la provincia china de Hubei, cuya capital es Wuhan. De momento, las autoridades han confirmado la existencia de cinco casos de coronavirus. Se trata de personas que habían viajado recientemente a Wuhan y por el momento no se han detectado casos de propagación de persona a persona. Además, United Airlines este martes anunció en un comunicado la suspensión de algunos vuelos desde EE.UU. con destino a Pekín, Shanghái y Hong Kong entre el 1 y el 8 de febrero debido a un ‘significativo descenso en la demanda’ de billetes. El nuevo coronavirus, causante de la neumonía de Wuhan, ya ha dejado 132 muertos entre los cuales al menos 4.515 infectados diagnosticados tan solo en China. #coronavirus #eeuu:United_States: #estadosunidos #diplomaticos
2231696353041160524; 0; False; 1580258958; Ooouuu #memes #coronavirus
2231696319603442646; 0; False; 1580258954; What’s going on with the #coronavirus sounds oddly familiar anybody seen the movie #contagion
2231696316518693236; 0; False; 1580258954; 29.01.2020 this going so fast #coronavirus #wuhan #hubei #china #virus
2231696281378317661; 0; False; 1580258949; Rekaman video yang menunjukkan seorang turis asal China mengamuk gara-gara harus menjalani serangkaian tes untuk mencegah masuknya virus Corona dari Wuhan di Bandara Senai, Malaysia.Melansir dari World of Buzz, Senin 27 Januari 2020, turis tersebut tampak ditempatkan di sebuah ruang. . Kemungkinan besar untuk menjalani screening dari otoritas bandara. Terlihat di video itu, dia menggedor dinding kaca yang ‘mengurungnya’. . Bukan cuma itu, dia bahkan mencoba untuk memanjat dinding kaca tersebut guna menarik perhatian otoritas Bandara Senai, Distrik Kulai, Johor, Malaysia. Tak pelak, polah turis tersebut membuat geger bandara. . Sekadar informasi, Malaysia kini berada di tengah kekhawatiran besar masuknya wabah virus Corona dari Wuhan, China. Alhasil, sejumlah alat screening ditempatkan untuk menyasar turis-turis yang datang dari negara tersebut. . Artikel : Makassarterkini.id . . Dm/Tag :right_arrow: @wartabhineka #infowarta #beritaterkini #wartabhineka #viral #trending #trendingtopic #news #berita #virus #coronavirus #viruscorona #china #tiongkok #wuhan
2231696243831370273; 0; False; 1580258945; Se espera que los estadounidenses lleguen al aeropuerto de internacional de Ontario, en el estado de California Washington.- Un avión con personal diplomático de Estados Unidos y otros ciudadanos estadounidenses ya ha salido de la ciudad china de Wuhan, epicentro del brote de coronavirus, informó este martes a Efe un portavoz del Departamento de Estado. ‘El vuelo de Wuhan ha salido’, se limitó a decir la citada fuente. Se espera que los estadounidenses lleguen al aeropuerto de internacional de Ontario, en el estado de California y a unos 65 kilómetros de Los Ángeles, aunque por el momento no hay confirmación oficial por parte de las autoridades federales, explicó a Efe David Wert, portavoz del condado de San Bernardino, donde se halla el aeropuerto. ‘Estamos preparados para que, si llegan aquí, podamos darles toda la asistencia que puedan necesitar y para separarlos del resto de la población’, indicó Wert, que aseguró que también están preparados para atender a los niños que puedan venir en el vuelo. Este fin de semana, el Departamento de Estado anunció que estaba organizando un vuelo chárter expresamente destinado a evacuar a su personal diplomático de Wuhan. Además, en esa aeronave, podrán viajar los ciudadanos estadounidenses que quieran costearse el billete a título personal. El Gobierno de EE.UU. ha aconsejado a sus ciudadanos evitar los viajes a China y, expresamente, recomienda no trasladarse a la provincia china de Hubei, cuya capital es Wuhan. De momento, las autoridades han confirmado la existencia de cinco casos de coronavirus. Se trata de personas que habían viajado recientemente a Wuhan y por el momento no se han detectado casos de propagación de persona a persona. Además, United Airlines este martes anunció en un comunicado la suspensión de algunos vuelos desde EE.UU. con destino a Pekín, Shanghái y Hong Kong entre el 1 y el 8 de febrero debido a un ‘significativo descenso en la demanda’ de billetes. El nuevo coronavirus, causante de la neumonía de Wuhan, ya ha dejado 132 muertos entre los cuales al menos 4.515 infectados diagnosticados tan solo en China. #coronavirus #eeuu:United_States: #estadosunidos #diplomaticos
2231696187459594269; 0; False; 1580258938; ¿Que debes saber del Coronavirus? #coronavirus #coronavirusoutbreak #info #noticias #coronaviruses
2231696144500896328; 0; False; 1580258933; The jug heads begin to descend on the city. #coronavirus #wuhancoronavirus #wuhanpneumonia #武汉 #北京 #上海 #南京 #深圳 #香港 #澳门 #生病 #机器人
2231696144450552871; 0; False; 1580258933; Watch out Vegas! We had symptoms come in today of the dreaded #coronavirus #youhearditfirst #decon
2231696115358877567; 0; True; 1580258930; Aku memang tak mengenal kalian, tapi aku salut pada kalian semuah yang sudah berjuang berada di garis depan untuk menyembuhkan saudara kita yang terkena wabah virus #Coronavirus di Kota Wuhan China. . Virus yang mematikan yang sejauh ini telah merenggut 106 nyawa di Cina dan menginfeksi lebih dari 4.515 kasus di seluruh dunia, dengan ratusan dokter dan petugas kesehatan lainnya. . Kalian membatalkan perayaan Tahun Baru #imlej untuk mengendalikan virus yang berasal dari Wuhan. Semangat yaa:flexed_biceps:. @stevan.firman @chinaxinhuanews @who . #coronavirus #Viruscorona #china #healthdoctor #who #prayhuwan
2231696100182824287; 0; False; 1580258928; #prevention #awareness #coronavirus
2231696093371405630; 0; False; 1580258927; :paperclip: MEMOHON AMPUNAN DAN KASIH SAYANG ALLAH . رَبَّنَا آمَنَّا فَاغْفِرْ لَنَا وَارْحَمْنَا وَأَنْتَ خَيْرُ الرَّاحِمِيْنَ . . “Ya Rabb kami, kami telah beriman, maka ampunilah kami dan berilah kami rahmat dan Engkau adalah pemberi rahmat yang paling baik.” (Qs. Al-Mu’minun: 109) . . :right_arrow: Ingin mencetak Poster diatas? Yuk download versi high resolution : https://shahihfiqih.com/3g2x . . __________________ . :globe_showing_Asia-Australia: Web | shahihfiqih.com. :desktop_computer: Youtube : youtube.com/shahihfiqih. :globe_with_meridians: Telegram : @shahihfiqih - bit.ly/1S3K8sW . :mobile_phone: Instagram : Instagram.com/ShahihFiqih . :television: Twitter : twitter.com/shahihfiqih. :laptop_computer: Facebook : facebook.com/shahihfiqih. . . #serialdoashahihfiqih #doa #kumpulandoa #doamustadjab #ampunan #shahihfiqih #kasihsayangAllah #rahmatallah #dosa #maksiat #wabah #wuhan #taubat #corona #coronavirus #dosa #bencanaakibatdosa #dosamaksiat #syirik #bertaubat #kasihsayang #muhasabah
2231696012205352246; 0; False; 1580258917; Se espera que los estadounidenses lleguen al aeropuerto de internacional de Ontario, en el estado de California Washington.- Un avión con personal diplomático de Estados Unidos y otros ciudadanos estadounidenses ya ha salido de la ciudad china de Wuhan, epicentro del brote de coronavirus, informó este martes a Efe un portavoz del Departamento de Estado. ‘El vuelo de Wuhan ha salido’, se limitó a decir la citada fuente. Se espera que los estadounidenses lleguen al aeropuerto de internacional de Ontario, en el estado de California y a unos 65 kilómetros de Los Ángeles, aunque por el momento no hay confirmación oficial por parte de las autoridades federales, explicó a Efe David Wert, portavoz del condado de San Bernardino, donde se halla el aeropuerto. ‘Estamos preparados para que, si llegan aquí, podamos darles toda la asistencia que puedan necesitar y para separarlos del resto de la población’, indicó Wert, que aseguró que también están preparados para atender a los niños que puedan venir en el vuelo. Este fin de semana, el Departamento de Estado anunció que estaba organizando un vuelo chárter expresamente destinado a evacuar a su personal diplomático de Wuhan. Además, en esa aeronave, podrán viajar los ciudadanos estadounidenses que quieran costearse el billete a título personal. El Gobierno de EE.UU. ha aconsejado a sus ciudadanos evitar los viajes a China y, expresamente, recomienda no trasladarse a la provincia china de Hubei, cuya capital es Wuhan. De momento, las autoridades han confirmado la existencia de cinco casos de coronavirus. Se trata de personas que habían viajado recientemente a Wuhan y por el momento no se han detectado casos de propagación de persona a persona. Además, United Airlines este martes anunció en un comunicado la suspensión de algunos vuelos desde EE.UU. con destino a Pekín, Shanghái y Hong Kong entre el 1 y el 8 de febrero debido a un ‘significativo descenso en la demanda’ de billetes. El nuevo coronavirus, causante de la neumonía de Wuhan, ya ha dejado 132 muertos entre los cuales al menos 4.515 infectados diagnosticados tan solo en China. #coronavirus #eeuu:United_States: #estadosunidos #diplomaticos
2231695993799980755; 0; False; 1580258915; Ga mesti malam jum'at aja kan ya cari pahala? :rolling_on_the_floor_laughing::rolling_on_the_floor_laughing::rolling_on_the_floor_laughing::rolling_on_the_floor_laughing:. Dah pada gede paham lah ya. Namanya juga ikhtiar biar kaya penganten baru terus aja gitu :grinning_squinting_face::grinning_squinting_face::grinning_squinting_face: #sr12skincareherbal #manjakani #minyakbulus #sr12skincareherbal #sr12cosmeticskincare #sr12skincarebpom #sr12ciamis #coronavirus
2231695986290577825; 0; False; 1580258914; #coronavirus #wuhan #wuhanvirus
2231694565311831794; 1; False; 1580258914; Houston????? Why isn’t everyone wearing a mask in the #iahairport #coronavirus
2231695978960683631; 0; False; 1580258913; The corona virus is here in bc #coronavirus #green #hulk #mask #readyforvirus
2231695637502277497; 0; False; 1580258912; Seorang pejabat Kemenlu China, bernama Lijian Zhao memposting di akun twitternya, video pembangunan rumah sakit yang dibangun untuk pasien yang terjangkit virus Corona. Rumah sakit yang dibangun selama 16 jam ini, berbentuk box dilengkapi dengan teralis besi di jendelanya dan dan kunci yang diletakkan di pintu bagian luar.⁣ ⁣ Di postingan tersebut, ia juga menuliskan, "Let's pray for Wuhan & China", mari berdo'a untuk Wuhan dan China. Sudah jamak diketahui bahwasanya pemerintah China dari Partai Komunis China menganut paham atheisme. Namun dalam kondisi darurat seperti ini, salah satu anggotanya mengajak berdo'a untuk Wuhan dan China yang saat ini dilanda wabah virus Corona. Sudah menjadi fitrahnya, manusia bahkan ateis sekalipun, ketika dalam kesulitan, membutuhkan pertolongan dari Tuhan Yang Maha Kuasa.⁣ ⁣ "Dan dia dibantah oleh kaumnya. Dia berkata: 'Apakah kamu hendak membantah tentang Allah, padahal sesungguhnya Allah telah memberi petunjuk kepadaku'. Dan aku tidak takut kepada [malapetaka dari] sembahan-sembahan yang kamu persekutukan dengan Allah, kecuali di kala Tuhanku menghendaki sesuatu [dari malapetaka] itu. Pengetahuan Tuhanku meliputi segala sesuatu. Maka apakah kamu tidak dapat mengambil pelajaran [daripadanya]?" [QS. Al-An'am: 151].⁣ ⁣ "Dan sesungguhnya Kami jadikan untuk [isi neraka Jahannam] kebanyakan dari jin dan manusia, mereka mempunyai hati, tetapi tidak dipergunakannya untuk memahami [ayat-ayat Allah] dan mereka mempunyai mata [tetapi] tidak dipergunakannya untuk melihat [tanda-tanda kekuasaan Allah], dan mereka mempunyai telinga [tetapi] tidak dipergunakannya untuk mendengar [ayat-ayat Allah]. Mereka itu sebagai binatang ternak, bahkan mereka lebih sesat lagi. Mereka itulah orang-orang yang lalai" [QS. Al-A'raf: 179] . Revisi: di video tertulis 16 hari, yang benar adalah 16 jam sebagaimana yang tertulis di postingan Twitter tersebut. ⁣ #coronavirus #viruscorona #wuhan #china #ccp #xijinping
2231695893589814854; 0; False; 1580258903; Homeopathy defines genus epidemicus as the combined symptoms of a large group of people afflicted with a disease or epidemic, or a remedy that covers all the symptoms which that particular epidemic is capable of producing. According to the feedback from around 30 homeopaths around the globe in the past 14-21 days, the predominant remedies for the current epidemic (which includes 2019 nCoV and influenza) are: :1st_place_medal:Top remedy: Gelsemium (Cough is interestingly not that common... in fact, the main presenting complaint is fatigue, heavy eyelid) :2nd_place_medal: 2nd Choice: Bryonia (for patients with more cough with pain in chest or head, need holding it) :3rd_place_medal: 3rd Choice: Eupatorium perf (When patient has that sort of pain in their bones, but less of that overall heaviness) :sunflower:COMMUNITY PHARMACY OFFERS SINGLE HOMEOPATHIC REMEDIES AS WELL AS OUR LONG-STANDING FORMULA, FLU 6, WHICH COMBINES MULTIPLE REMEDIES -- INCLUDING THOSE LISTED ABOVE -- AND ADDRESSES MYRIAD SYMPTOMS ASSOCIATED WITH FLU-LIKE VIRUSES(A STAFF AND CUSTOMER FAV) :sunflower: :cherry_blossom:STOP BY ANY TIME FOR YOUR HOMEOPATHIC REMEDIES - WE ARE HERE FOR OUR COMMUNITY:cherry_blossom: #homeopathy #communitypharmacy #supplements #coronavirus #buylocal #alternative #shoplocal #herbs #communitypharmacymatters #madisonwisconsin
2231695861317698123; 1; False; 1580258899; ‘s post :revolving_hearts: :frowning_face: im sick <3 haha and that’s why :TOP_arrow: like and follow for a story time :face_with_tears_of_joy: ——————————————————————— ☆| date: 26/1/20 ☆| fc: 12 ☆| pngs: @pngcupcake @pngcharm ☆| follow @fairyqlss for more! ————————————————————— tags (ignore): #niche #nichememes #nichememe #aesthetic #meme #explorepage #moodboard #memes #explore #threads #selfcare #nichecommunity #nichememeaccount #nichememecommunity #nichememer #nichememeideas #nichememesacc #nichememers #lfl #s #cute #love #fff #nichestarterpack #png #fragrance #moodboards #niches #pngs #coronavirus
2231695838970050475; 2; False; 1580258897; Really disappointed but not surprised that this is happening in Canada. Make no mistake. If this type of racism enters into my vicinity in any way, I will lay you the f*** out physically, emotionally and spiritually. You’ll wish you had the #coronavirus instead. :middle_finger_medium-light_skin_tone::middle_finger_medium-light_skin_tone::middle_finger_medium-light_skin_tone: #ohcanada #steptomeidareyou
2231695835329407277; 0; False; 1580258896; Hablando de lo que esta pasando en China vemos que las cifras infectados por el #Coronavirus son alarmantes, según un video que publicó una enfermera que trabaja en un hospital en #China hay más de 90 mil personas infectadas con este virus, este se propaga rápidamente y el gobierno oculta información, se imaginan que esto suceda en todo mundo :globe_showing_Asia-Australia:!!??? Sería muy alarmante, por ello mis palabras que hablan de que existen más OXXOS, más tiendas comerciales, más personas enfocadas en otras cosas, que enfocadas en su salud, por ello te invito a reflexionar y a que esa frase tan sensilla te haga pensar sobre el capitalismo y la clase de sistema en el vivimos actualmente y que todos nosotros apoyamos todo esto y jamás decimos algo :expressionless_face:
2231695769455280915; 0; False; 1580258888; Se espera que los estadounidenses lleguen al aeropuerto de internacional de Ontario, en el estado de California Washington.- Un avión con personal diplomático de Estados Unidos y otros ciudadanos estadounidenses ya ha salido de la ciudad china de Wuhan, epicentro del brote de coronavirus, informó este martes a Efe un portavoz del Departamento de Estado. ‘El vuelo de Wuhan ha salido’, se limitó a decir la citada fuente. Se espera que los estadounidenses lleguen al aeropuerto de internacional de Ontario, en el estado de California y a unos 65 kilómetros de Los Ángeles, aunque por el momento no hay confirmación oficial por parte de las autoridades federales, explicó a Efe David Wert, portavoz del condado de San Bernardino, donde se halla el aeropuerto. ‘Estamos preparados para que, si llegan aquí, podamos darles toda la asistencia que puedan necesitar y para separarlos del resto de la población’, indicó Wert, que aseguró que también están preparados para atender a los niños que puedan venir en el vuelo. Este fin de semana, el Departamento de Estado anunció que estaba organizando un vuelo chárter expresamente destinado a evacuar a su personal diplomático de Wuhan. Además, en esa aeronave, podrán viajar los ciudadanos estadounidenses que quieran costearse el billete a título personal. El Gobierno de EE.UU. ha aconsejado a sus ciudadanos evitar los viajes a China y, expresamente, recomienda no trasladarse a la provincia china de Hubei, cuya capital es Wuhan. De momento, las autoridades han confirmado la existencia de cinco casos de coronavirus. Se trata de personas que habían viajado recientemente a Wuhan y por el momento no se han detectado casos de propagación de persona a persona. Además, United Airlines este martes anunció en un comunicado la suspensión de algunos vuelos desde EE.UU. con destino a Pekín, Shanghái y Hong Kong entre el 1 y el 8 de febrero debido a un ‘significativo descenso en la demanda’ de billetes. El nuevo coronavirus, causante de la neumonía de Wuhan, ya ha dejado 132 muertos entre los cuales al menos 4.515 infectados diagnosticados tan solo en China. #coronavirus #eeuu:United_States: #estadosunidos #diplomaticos
2231695674024789641; 0; False; 1580258877; #coronavirus #pandemic #epidemiology #virus #symptoms
2231695628098821016; 2; False; 1580258872; #crystalmall #burnaby #coronavirus #britishcolumbia
2231695012482395136; 4; False; 1580258871; SO NO ONE WAS GUNNA TELL ME ABOUT THE CORONA VIRUS?!:face_with_symbols_on_mouth:
2231695578740045427; 0; False; 1580258866; #coronavirus preparedness. Hooray for public transit commutes.
2231695127952606962; 0; False; 1580258865; I’m so fucking mad and sad like why- :pensive_face::loudly_crying_face: . · · - - - - #tiktokmemes#twitter#tiktok#mood#edgymemes#kpop#pranks#dankmemes#memes#coronavirus#fff#f4f#explorepage#viral#youtube#exo#fight#lovememes#kpoplatinosparty#youtuber#reactionmemes#mexicanmemes#theghetto#spamforspam#spongebobmemes#reactionvideos#twitterquotes#berleezy#japan#reactionmemes#worldstar
2231695313566203697; 2; False; 1580258834; #coronavirus
2231695246064676884; 0; False; 1580258826; New story up @coppercourier @mpsaz infected with #fakenews hoax about #coronavirus
2231695216822059867; 0; False; 1580258823; SR12 menghadirkan 3 variant Masker kefir : 1. Coffee kefir Mask Masker kefir kopi berasal dari fermentasi susu sapi & kefir, dipadukan dengan olive oil, kopi, & madu ini diperuntukan untuk kulit dengan masalah flek & bernoda bekas jerawat. Kulit tipe Normal pun dapat menggunakannya. 2. Etawa Kefir Mask Masker kefir yg berasal dari susu kambing ini memiliki lemak yg lbh ringan dari pd susu sapi, cocok untuk tipe kulit yg sensitif & berminyak. 3. Milk Kefir Mask Masker kefir dari susu sapi, madu & vco cocok sekali untuk km dengan tipe kulit kering & normal. #maskerkefiretawa #maskerkefirmilk #maskerkefircoffe #sr12skincareherbal #sr12cosmeticskincare #sr12skincarebpom #sr12ciamis #coronavirus
2231694076668147009; 2; False; 1580258687; driving can wait • • • • • • • TAGS #memes #dank #phmemes #memesdaily #funnymemes #funny #funnyshit #shitpost #shitposts #memes #memesdaily:face_with_tears_of_joy: #dankmemes #memes:face_with_tears_of_joy: #memesespañol #shit #poopoo #monkey #gamer #feet #feetpics #nudes #funnymemes #fortnitefunny #coronavirus #coronavirusmemes#humor#memepage#memepages#dailymemes
2231693957264680764; 1; False; 1580258672; Report @planetaverdeoficiall :warning:WARNING GRAPHIC IMAGES:warning: Please share this URGENT post about the coronavirus epidemic with your followers as the origin of the virus has been traced to the zone of the Wuhan market where live wild animals like snakes, rats, bats and monkeys were traded before China instituted a temporary ban yesterday. But a temporary ban is NOT enough, WE MUST use our social media platforms to spread awareness and BAN WILD ANIMAL TRADING WORLDWIDE as this is EXACTLY what caused the SARS virus that killed nearly 800 people in 2003! SARS was 17 years ago and yet these markets are doing the exact same thing, selling live wild animals in unhygienic conditions that create diseases with devastating consequences for the entire human race! This new virus, which has no vaccine, has killed 82 people with 2,887 confirmed cases in 15 countries, numbers which have increased 50% SINCE YESTERDAY and 60 million more people are on lockdown to prevent further spreading. To stay updated in real-time our US followers can now text us at 323-310-1679 and also follow @planetaverdeoficiall on Instagram too. Please pray for the world and share this URGENT post with your followers and tag people, celebrities, influencers and news media that need to see this and let’s work together to PERMANENTLY ban the trading of wild animals that create these deadly viruses! #coronavirus #endanimalcruelty#coronavirusoutbreak #karmagawa
2231693449309342909; 1; False; 1580258612; Di Batam Indonesia turis China justru berbondong-bondong masuk. Padahal sejumlah negara lain mencegah turis China masuk ke negaranya. Turis China ramai-ramai masuk Batam, Kepulauan Riau, tentu sebuah fenomena yang sangat menarik. Mereka naik maskapai Batik Air dan kemudian diangkut lima bus. Informasi yang diperoleh Wartakotalive.com, Turis itu berasal dari Shenzen, China. Sementara itu, sejumlah negara cegah Turis China antara lain Korea Selatan dan Korea Utara. Negara lain seperti Australia dan Arab Saudi melakukan pengawasan super ketat terhadap Turis China. Begitu juga Turki, tercatat telah membatalkan setengah permintaan Visa dari China. . "Tadi pagi mereka tiba menggunakan Batik Air. Ada lima bis yang mengangkut mereka," ujar salah satu sumber kepada TRIBUNBATAM.id. Sumber ini pun menyebut, kedatangan ratusan pelancong asal Shenzen sendiri mendapat perhatian khusus dengan dilakukan pengecekan terlebih dahulu sebelum meninggalkan bandara. . "Cek dengan thermal scanner. Dan petugas tadi standby dengan menggunakan masker dan sarung tangan," sambungnya. Sebelumnya, diketahui saat ini virus corona sendiri telah memasuki Singapura. TURIS CHINA DI SUMBAR DISAMBUT GUBERNUR Kunjungan 174 turis asal Kunming China di Sumatera Barat menjadi perhatian ditengah penyebaran virus corona yang meresahkan banyak orang. Wakil Gubernur Sumatera Barat Nasrul Abit memeriksa kesiapan alat thermo scanner untuk memantau kesehatan para turis yang akan datang ke wilayahnya. Namun sikap ini dinilai lamban. Unggahan Nasrul Abit yang memperlihat foto dirinya memastikan kesiapan alat thermo scanner di Bandara Internasional Minangkabau menuai kritikan. Foto tersebut diunggah melalui akun Twitter pribadi Nasrul Abit, @nasrul_abitt pada Sabtu (25/1/2020) . "Baru saja saya memastikan kesiapan thermo scanner untuk memantau kesehatan para turis China yang akan landing di BIM besok pagi," tulis Nasrul, seperti dikutip Suara.com, Minggu (26/1) Unggahan ini mendapatkan lebih dari 1.800 like dan 500 retweet. Rata-rata warganet yang berkomentar di unggahan itu mengkritik sikap Nasrul Abit dan pemerintah Indonesia. Bagaimana menurut kalian sobat?
2231693206668578429; 1; False; 1580258583; Stay strong my lovely China! Qilai! Buyuan zuo nuli de renmen! Ba women de xuerou, zhucheng women xinde changcheng! Вставай, кто рабства больше не хочет! Великой стеной отваги защитим мы Китай!
2231692910818310318; 0; False; 1580258548; Recomendações de Prevenção. #coronavirus
2231688162296223994; 15; False; 1580257982; Ah que que, que creyeron que yo no haría el challenge :man_shrugging_light_skin_tone: #platano #coronavirus#tomatuplatano
2231685880225340459; 2; False; 1580257710; Keep you and your loved ones protected at all times with our On Guard range! Keep your hands clean with On Guard Foaming Hand Wash, your teeth and gums clean and healthy with On Guard Natural Whitening Toothpaste, your laundry fresh and clean with the On Guard Laundry Detergent, all surfaces clean and safe with the On Guard Cleaner Concentrate, purify and cleanse the air around you with the On Guard Protective Blend, and protect yourself from pollution and environmental threats at all times with the On Guard Touch.
2231684839031220551; 1; False; 1580257585; SUSPEITA CORONAVÍRUS EM CURITIBA O paciente, que esteve na China nos últimos 14 dias, está internado em um hospital particular com suspeita de coronavírus #RICMais https://ricmais.com.br/noticias/saude/coronavirus-suspeita-em-curitiba/ #coronavirus
2231557230713793018; 43; False; 1580242373; #transformationtuesday! Consistency is the :key:. It’s amazing how much you regress to your before pics when you stop trying for a while... but once you get back on track the gains come back quickly :grinning_face_with_smiling_eyes:. Still offering training spots. Email, dm me, or click on the link in my profile to learn more :slightly_smiling_face:.
2229692909351810554; 2; False; 1580020129; Tight bald low fade with a natural blended beard :OK_hand_light_skin_tone: #barbershopconnect #nbahaircuts #thebarberpost #barberology #art @national_barbers_association @national_fade_league @barbersinctv #coronavirus
2229572589198366959; 4; False; 1580005932; Eeryx IS GOATS IN THE RT.teamggs We finally got 1k thanks a lot guys:dove::partying_face: - - - - - - Ignore tags:victory_hand: #france #fortnite #coronavirus #edits #teams #france #fortnite #coronavirus #edits #teams #france #fortnite #coronavirus #edits #teams #france #fortnite #coronavirus #edits #teams #france #fortnite #coronavirus #edits #teams
2231695192233336206; 0; False; 1580258820; #Repost @ppdsgram • • • • • Kami percaya, Puskesmas Bisa!! :flexed_biceps: . . #corona #viruscorona #viruscoronaindonesia #indonesiacoronavirus #coronavirus
2231695186010049547; 0; False; 1580258819; Coronavirus nCoV Top 10 Regions in China (cc-confirmed cases & d-deaths) Hubei: cc 3554 d 125 Guangdong: cc 207 d 0 Zhejiang: cc 173 d 0 Henan: cc 168 d 1 Hunan: cc 143 d 0 Chongqing: cc 132 d 0 Jianxi: cc 109 d 0 Anhui: cc 106 d 0 Shandong: cc 87 d 1 Beijing: cc 91 d 1 Jan 28 - 23:33 GMT #coronavirus #coronavirusupdates #Coronavirus888
2231695139510836756; 1; False; 1580258813; Wait a sec . . . . . . . #meme #memes #funny #dankmemes #memesdaily #funnymemes #coronavirus #dank #humor #coronavirusmeme #netneutrality #coronavirusmemes #dankmeme #edgymemes #offensivememes #anime #love #coronavirusoutbreak #comedy #dailymemes #edgy #fun #memeboss #dadjokes #memer #trump #memelord #memepage #memez #memeaccount
2231695084953345044; 0; False; 1580258807; #savetheplanet #save #kobe #heart #climatechange #nature #uman #destroyer #disaster #control #coronavirus #cina #usa #italy #germany #france #africa #canada #australia #giappone #turkey #iran #world #gretathunberg
2231695062119224290; 1; False; 1580258804; #coronavirus #Vernors #Detroit #LastLaughRecords #mittenmademusik #medicine #medical #itsscience
2231694627806001396; 0; False; 1580258795; Jepang mengirimkan pesawat untuk mengevakuasi 200 warganya yang berada di tempat bermulanya wabah virus Corona. Ada sekitar 650 warga negara Jepang di Wuhan yang mengatakan ingin pergi meninggalkan kota itu. Jepang juga akan menerbangkan 1 atau 2 pesawat susulan untuk menjemput warga negaranya yang tersisa. Pesawat yang dicharter pemerintah Jepang itu juga membawa petugas medis lengkap dengan perlengkapannya. Ini adalah kali pertamanya Jepang mengevakuasi warganya dari luar negeri akibat mewabahnya penyakit menular. ⁣ ⁣ Virus Corona memiliki periode waktu inkubasi selama 14 hari dan bisa menyebabkan pneumonia. Virus ini bisa menyebar melalui batuk dan bersin ataupun melalui kontak langsung dengan penderita. Transmisi dari manusia ke manusia, selain di China juga telah terjadi di Jepang dan Jerman. Lebih dari 100 orang yang telah meninggal akibat virus ini.⁣ ⁣ Sumber: Japan Times, South Morning China Post, ANN News.⁣ ⁣ #jepang #jepun #japan #wuhan #china #coronavirus #viruscorona #jazirahislam
2231694973955061561; 0; False; 1580258794; Visiting a long time brother and senior. Col Delfin Miranda, PA (Ret). Enjoyed the grandiose of Okada and the warmth of Camaraderie of Ust Golden Corps while delivering our quality facemask. #ustgoldencorpsofcadets #redman #okada #facemask #merscov #coronavirus #preventativehealth #whywearmasks #becauselifesworthit
2231694947705866964; 0; False; 1580258790; Продолжаю прямой репортаж о коронавирусе с места событий. Зараза распространяется с охуенной скоростью, всего за сутки количество заболевших увеличилось почти вдвое и достигло 6000 человек! В русскоязычном чатике по Шэньчжэню пишут что без масок не пускают вообще ни в какие заведения, включая супермаркеты и общественный транспорт, при том что маски купить очень сложно - их тупо нигде нет! Китайские власти рекомендуют стирать маски или делать их самостоятельно из марли, так как в ближайшее время обеспечить ими все аптеки страны не получится. В стране полностью закрыты полсотни городов! Знакомые из Уханя сообщают что в городе творится ебаный апокалипсис - улицы полностью вымершие, супермаркеты пустые, пекинская капуста стоит 30 юаней (~5$), короче какой-то ад, надеюсь в Шэньчжэне такого не будет. Ну а мы в данный момент тусим в горах провинции Юннань. Здесь людей совсем мало, они говорят на своём языке и в масках далеко не все - паника на малочисленные народы южного Китая очевидно не сильно распространилась. В нашем регионе заболевших всего два человека, а учитывая что поселения здесь довольно изолированы друг от друга да и туристов вообще не видать, мы чувствуем себя вполне безопасно. При этом автостоп в стране все ещё достаточно хорош, никто не ожидает подхватить вирус от иностранца, местные охотно останавливаются и бесплатно подвозят. Короче путешествовать в такой атмосферке довольно кайфово. На блокпостах за сегодня у нас дважды померили температуру. Причём делают это не ртутными градусниками, а суперсовременными хуевинами похожими на игрушечный пистолет. Прислоняют дуло ко лбу, нажимают на курок и пистолет голосом гуглоробота мгновенно говорит температуру. До чего блять прогресс дошёл! Больше не надо зажимать подмышкой эту холодную стеклянную хуету и не двигаться несколько минут, супер термо-пистолет сразу говорит ответ! Думаем на днях выехать во Вьетнам и переждать там китайский апокалипсис, но в Шэньчжэнь в любом случае придётся вернутся, все таки там остались наши вещи и незавершенные дела. Короче, пока жив буду держать вас в курсе, котаны! #china #travel #yunnan #coronavirus #mountains #breakingnews #village #nature #view
2231694865823985746; 0; False; 1580258781; E já são mais 3 casos suspeitos no Brasil :Brazil: de acordo o @minsaude E como podemos reduzir o risco de infecção pelo coronavírus? :fleur-de-lis:Evitar contato próximo com pessoas com infecções respiratórias agudas :fleur-de-lis:Lavar frequentemente as mãos, especialmente após contato direto com pessoas doentes e antes de se alimentar :fleur-de-lis:Usar lenço descartável para higiene nasal :fleur-de-lis:Cobrir o nariz e boca ao espirrar ou tossir :fleur-de-lis:Evitar tocar nas mucosas dos olhos :fleur-de-lis:Higienizar as mãos após tossir ou espirrar :fleur-de-lis:Não compartilhar objetos de uso pessoal, como talheres, pratos, copos ou garrafas :fleur-de-lis:Manter os ambientes bem ventilados :fleur-de-lis:Evitar contato próximo com animais selvagens e animais doentes em fazendas ou criações Info do boletim infectológico da @sbinfecto #coronavirus #dermatologialondrina #pediatrialondrina
2231694831886066731; 0; False; 1580258777; Novel #coronavirus outbreak may reach its peak in one week or around 10 days, a senior expert said. By end of Monday, 4,515 confirmed cases reported, 106 people died
2231694836866691820; 0; False; 1580258777; E já são mais 3 casos suspeitos no Brasil :Brazil: de acordo o @minsaude E como podemos reduzir o risco de infecção pelo coronavírus? :fleur-de-lis:Evitar contato próximo com pessoas com infecções respiratórias agudas :fleur-de-lis:Lavar frequentemente as mãos, especialmente após contato direto com pessoas doentes e antes de se alimentar :fleur-de-lis:Usar lenço descartável para higiene nasal :fleur-de-lis:Cobrir o nariz e boca ao espirrar ou tossir :fleur-de-lis:Evitar tocar nas mucosas dos olhos :fleur-de-lis:Higienizar as mãos após tossir ou espirrar :fleur-de-lis:Não compartilhar objetos de uso pessoal, como talheres, pratos, copos ou garrafas :fleur-de-lis:Manter os ambientes bem ventilados :fleur-de-lis:Evitar contato próximo com animais selvagens e animais doentes em fazendas ou criações Info do boletim infectológico da @sbinfecto #coronavirus #dermatologialondrina #pediatrialondrina
2231694639400745349; 2; False; 1580258754; Due to these #coronavirus news I decided to reduce my #chinese #stocks exposure, so I sold #jd and #alibaba on Friday. Sorry, totally forgot to post!
2231694587398102854; 0; False; 1580258747; #NOTICIAS El Ministerio de Salud Pública (#MSP) informó que el paciente #chino, sospechoso de tener #coronavirus, se encuentra en estado crítico en una sala de aislamiento de la Unidad de Cuidados Intensivos (UCI) de un hospital en Quito. "Hasta las 11:00 de este martes 28 de enero, la situación del paciente es crítica y estamos a la espera de su evolución. Los médicos a cargo están, de forma continua y permanente, brindándole toda la asistencia del caso", dice parte del comunicado emitido por la cartera de Estado. Además, el organismo recordó que sigue trabajando para prevenir y detectar posibles casos de esta enfermedad que ya ha dejado más de 130 #muertos a nivel mundial. Hay que recordar que el ciudadano asiático llegó al país el pasado 21 de enero y días después presentó síntomas que hacen sospechar que padezca coronavirus. Por eso, el MSP lo aisló y le hizo pruebas para confirmar si tiene o no el virus, pero hasta el momento no se han recibido los resultados. Somos #FRANCISCOSTEREO #TuMusicaTuRitmo:radio: :musical_notes: 102.5 Quito 106.9 Guayaquil www.franciscostereo.com y en nuestra aplicación para celular #FranciscoStereo :mobile_phone:
2231694579538036556; 0; False; 1580258747; Dikutip dari TheGuardian, komisi kesehatan nasional China menyatakan bahwa penularan virus ini dapat terjadi dari manusia pada manusia lain. Pada 24 Januari pihak berwenang China telah mengakui terdapat 830 kasus dan adanya 26 orang yang meninggal akibat virus Corona. Orang yang terinfeksi virus Corona akan mengalami pneumonia. Mereka akan menderita batuk, demam, dan kesulitan bernafas. Pada kasus yang parah bisa terjadi kegagalan organ. Untuk mengatasi virus ini, pemberian antibiotik pada pasien tidak akan bekerja sehingga biasanya dokter akan melakukan rawat inap di rumah sakit. Proses pemulihan juga bergantung pada kekuatan sistem kekebalan tubuh pasien. Namun, banyak orang terinfeksi virus Corona mengalami kondisi kesehatan yang memburuk sehingga berakhir meninggal dunia. Cara pencegahan infeksi virus Corona Cara pencegahan infeksi virus Corona ----------------------------------------- Seperti yang diketahui bahwa hingga saat ini penyebab pasti dari virus Corona belum diketahui dan pengobatannya belum ditemukan dengan jelas. Ada beberapa cara pencegahan yang mudah dilakukan untuk terhindari dari virus Corona, yaitu sebagai berikut: 1. Menggunakan masker tertutup saat berpergian karena udara bisa jadi media penyebaran. 2. Lalu, hindari untuk melakukan kontak langsung dengan hewan. 3. Hindari orang yang sedang sakit, terutama jika orang tersebut menderita demam, batuk atau kesulitan bernafas. 4. Selain itu, sering-seringlah mencuci tangan dengan sabun dan air selama 20 detik atau menggunakan pembersih tangan berbahan dasar alkohol. 5. Usahakan juga untuk tidak menyentuh mata, hidung, dan mulut dengan tangan yang tidak dicuci karena kebersihan diri dapat mencegah tubuh terinfeksi virus tersebut. 6. Jaga kondisi tubuh dan cukupi asupan nutrisi harian agar selalu tetap fit dan terhindar dari wabah virus corona. Hindari juga tempat ramai, jika tidak ada keperluan mendesak. (ref : popmama.com) #cegahdarivirus #jagakesehatan #coronavirus #HalaqohMQMM #LVBTrainingCenter #SYAMMENUJUQUALIFIED #TigaraksaMySuccessWay #HowAboutU #joinresellertigaraksa #BangunImpianMu #YakinBisa #HafizhAqilStore
2231694540790980558; 0; False; 1580258742; :face_with_medical_mask:... #Sante #Vigilance #Coronavirus #Cameroun #NoWay #Peace
2231694520617962650; 1; False; 1580258740; Dead- Danky . . . . . . Tags: #coronavirus #coronavirusmemes #memes #memesdaily #memes:face_with_tears_of_joy: #memesgraciosos #memess #firememes #firememes:fire: #freefirememes #dank #loud #fresh #daily #memes #hehe #lol #f #l #tiktokgirls #papafranku #filthyfrank #papajohns #danky_chanky_
2231694474295980431; 0; False; 1580258734; Pemerintah Jepang baru saja mengkonfirmasi dua kasus baru virus corona. Salah satunya termasuk seorang sopir bus wisata yang belum pernah ke kota Wuhan di Cina tengah. Seperti diketahui, wabah virus mematikan ini dimulai di pasar makanan laut dan unggas. Temuan ini membuat jumlah total infeksi yang dikonfirmasi di Jepang menjadi enam kasus. . Seperti dilansir SCMP, Sopir bus berusia 60-an mengendarai dua kelompok turis Tiongkok dari Wuhan awal bulan ini, kata menteri kesehatan Jepang Katsunobu Kato. Pengemudi tinggal di kota Nara. . Meski demikian hingga kini Kementerian Kesehatan jepang tidak dapat berkomentar lebih jauh tentang kasus baru ini. Menurut data World Organization, per 27 Januari 2020 secara global sebanyan 2798 dikonfirmasi. Di China sendiri terdapat, 2741 kasus yang dikonfirmasi dengan estimasi 5794. . Sebanyak 461 dinyatakan dalam parah dan 80 di antaranya meninggalDi luar China, sebanyak 37 dikonfirmasi di 11 negara. Direktur Jenderal WHO Dr Tedros Adhanom Ghebreyesus kini tengah berada di Beijing untuk bertemu dengan pemerintah dan pakar kesehatan yang mendukung tanggapan tersebut. . Tujuan misi ini adalah untuk memahami perkembangan terkini dan memperkuat kemitraan dengan China, khususnya untuk tanggapan. . Perkiraan saat ini dari masa inkubasi virus berkisar 2-10 hari, dan perkiraan ini akan disempurnakan karena lebih banyak data tersedia. Memahami waktu ketika pasien yang terinfeksi dapat menularkan virus ke orang lain sangat penting untuk upaya pengendalian. . Informasi epidemiologis terperinci dari lebih banyak orang yang terinfeksi diperlukan untuk menentukan periode infeksi 2019-nCoV, khususnya apakah penularan dapat terjadi dari individu tanpa gejala atau selama periode inkubasi. . Artikel : Viva.co.id . . :detective:Follow @dunia_fakta.id Untuk informasi Unik, Menarik dan Menghibur Lainnya! :blue_circle:Jangan Lupa Share Ya:blue_heart: . . :copyright: All Rights and Credits Reserved To The Respective Owner(s). Please Contact Us For Credit or Removal. :heavy_minus_sign: :heavy_minus_sign: :heavy_minus_sign: :heavy_minus_sign: #infodunia #infoupdate #faktadunia #fakta #wowfakta #faktaagama #creepy #faktaislam #wowfakta #faktaunik #infounik #infoanda #china:China: #CoronavirusOutbreak #viruscorona #coronavirus
2231694458080765665; 2; False; 1580258732; Jornal da Cultura discutindo importância da Ampliação da indicação das vacinas da Febre Amarela e Gripe, e claro ... Coronavírus! #coronavirus #vacinas #2019ncov #febreamarela
2231694431042453835; 0; False; 1580258729; Prevenção: Boa higiene das mãos, dos alimentos e das vias respiratórias além evitar contato próximo com quem mostrar sinais de condições respiratórias como tossir e espirrar. #coronavirus #ministeriodasaude #oms #enfermagem:syringe::pill: #nurse:syringe: #enfermeiras #prevençao #estudantesdeenfermagem #tecnicodeenfermagem #profissionaisdasaúde #medical #enfermagem:red_heart: Referência: https://www.who.int/es/news-room/q-a-detail/q-a-coronaviruses
2231691836656584237; 0; False; 1580258719; On Friday, France confirmed its first two cases of the Wuhan coronavirus, with one patient being hospitalized in Paris and the other in the southwestern city of Bordeaux. Health Minister Agnes Buzyn told a news conference that these were the first two confirmed cases in Europe, and that more cases were likely to occur in France.⁠ Sourced via @globalnews⁠ #GlobalNews #Coronavirus #France ⁠ #6ixviews #issating #movethecultureforward:double_exclamation_mark:⁠
2231694177120559678; 0; False; 1580258699; even more of an excuse not to leave the house. . • • • • Follow at @_randomshit.com_ #dankmemes #memes #memesdaily #wa #vines #vine #awa #memes #funnyvideos #funnymemes #memez #funny#followforfollowback #follow4followback#shoutoutforshoutout #s4shoutout#explore #explorepage #edgymemes #edgy #edgymemesforedgyteens #edgymemes #coronavirus
2231693784458810147; 12; False; 1580258695; • Menteri Terawan : "Penyakit Coronavirus bisa sembuh sendiri" • Semoga Rakyat china melihat Video Menkes ini, Agar mereka tetap Tenang, Enjoy, Aman.. :beaming_face_with_smiling_eyes: ____________________________ @piisangmanis #wuhanchina #wuhan #coronavirus #menkes
2231694141528410806; 0; False; 1580258694; #memes #dankmemes #coronavirus #memesdaily
2231693988536980454; 0; False; 1580258676; Pagi bro & sist, Yuuks berdiskusi dan update mengenai NCorona Virus. Note speaker : Dr. Siti Nadia Tarmizi, M. Epid. Direktur P3 Vektor & Zoonosis Kemkes RI. * Serta pembicara lain nya. 2 skp + lunch + snack Investasi : Rp. 200 ribu #coronavirus #kangaroo90 #healthevent #healthcare #seminarkesehatan #wuhan *to be confirmed.
2231659738806784125; 0; False; 1580258668; Mapping the Wuhan Coronavirus (2019-nCoV) :world_map: . . Desarrollado por: el Centro de Ciencias e Ingeniería de Sistemas (CSSE) un grupo de investigación ubicado dentro del Departamento de Ingeniería Civil y de Sistemas (CaSE) en la Universidad Johns Hopkins (JHU):blue_book: . . En respuesta a la emergencia de salud pública en curso, se desarrolló un tablero en línea para visualizar y rastrear los casos reportados en una escala de tiempo diaria:magnifying_glass_tilted_right:; el conjunto completo de datos se puede descargar como una hoja de google. . . :pen:Los datos del caso visualizados se recopilan de diversas fuentes, incluidos la OMS, los CDC de EE. UU., El CDC de China de ECDC (CCDC), el NHC y el DXY. DXY es un sitio web chino que agrega informes de situación de NHC y CCDC locales en tiempo casi real, proporcionando estimaciones de casos regionales más actuales de las que son capaces las organizaciones de informes a nivel nacional, y por lo tanto se utiliza para todos los casos de China continental reportados en nuestro tablero ( confirmado, sospechoso, recuperado, muertes). . . Los casos de EE. UU. (Confirmados, sospechosos, recuperados, muertes) se toman de los CDC de EE. UU., Y todos los datos de casos de otros países (sospechosos y confirmados) se toman de los departamentos de salud regionales correspondientes:memo: . . . El tablero está destinado a proporcionar al público una comprensión de la situación del brote a medida que se desarrolla, con fuentes de datos transparentes.:round_pushpin: . . #mapainteractivo #china #wuhan #coronavirus #JHU #science #videoVirus #virusWuhan #medicine #medicina #medstudent #news #coronavirusnow #today
2231693809983562633; 1; False; 1580258655; sound like @thassabet
2231693758443839690; 2; False; 1580258649; كرونا ويروس ها(بخش دوم) برای اولین بار در شهر ووهان استان هوبئی چین، پس از اینکه مردم بدون علت مشخصی دچار سینه پهلوشدند و واکسن‌ها و درمان‌های موجود مؤثر نبودند، نوع جدیدی از کروناویروس شناسایی شد که به آن عنوان ۲،019-nCoVداده شد. این ویروس شواهدی از انتقال انسان-به-انسان را نشان داده‌است و با توجه گزارش‌هایی از چندین کشور به غیر از چین، به نظر می‌رسد میزان انتقال ‏ (میزان عفونت)آن در اواسط ژانویه سال ۲۰۲۰ افزایش یافته‌است.دوره نهفتگی ویروس (مدت زمان طی شده از در قرار گرفتن تا بروز علامت‌ها) بین ۲ تا ۱۴ روز است و در این مدت مسری می‌ماند. علامت‌های بیماری شامل تب، سرفه و مشکلات تنفسی است و بیماری می‌تواند کشنده باشد. ووهان در ۲۳ ژانویه قرنطینه شد و بر اساس آن تمام حمل‌ونقل‌های عمومی به داخل و خارج از ووهان به حالت تعلیق درآمد. از آن زمان، حداقل در ۱۵ شهر دیگر در استان هوبی نیز، حمل و نقل به همین ترتیب متوقف شده‌است. بسیاری از رویدادهای سال نو از جمله شهر ممنوعه در پکن، نمایشگاه‌های معابد سنتی و سایر مجالس جشن، به دلیل ترس از انتقال، بسته شدند. هنگ کنگ همچنین سطح پاسخ به بیماری‌های عفونی خود را به بالاترین حد رساند، وضعیت اضطراری اعلام کرد، مدارس خود را تا اواسط ماه فوریه تعطیل کرد و جشن‌های سال نوی خود را نیز لغو کرد. ادامه در كامنت اول #spfco #science #coronavirus #ncov2019 #wuhan #pcr #genome #dnasequencing #rnasequencing #سپنتا_پايا_فرين #ويروس_كرونا #ووهان #كرونا #نرخ_ارز #نرخ_دلار #نرخ_طلا #شيوع_ويروس_كرونا #شيوع_ويروس_سارس #وزارت_بهداشت #پيشگيرى_از_ويروس_كرونا #ساينس #چين #ويروس #وايرال #كروناويروس #كرونا_ويروس #ويروس_خطرناك #پژوهشگر #محقق #پژوهشگر_علوم_پزشکی
2231693698054525001; 0; False; 1580258641; #coronavirus #chinese #jokes
2231693091038131368; 0; False; 1580258636; His Holiness Sakya Trichen Rinpoche :folded_hands_medium-light_skin_tone: making a holy wish with fervent faith for containing outbreak of the Coronavirus :microbe: in China by chanting Goddess Parnashawari prayer and mantra. #StayHealthy #CoronaVirus :microbe: #HisHolinessSakyaTrichen #Rinpoche #Mantra #Prayers #TibetanBuddhism #FreeTibet #Tibetan #InstagramVideosOfTibet #InstagramVOfTibet #Tibet #Tibetan #Prayers #Buddhist #Love #Peace #EveryDay #Compassion
2231693598448062438; 3; False; 1580258630; For ya’ll who haven’t played this game - it's basically about virus outbreak that sweeps the whole world. Just let that sink in... Gamers have also been startled to discover that there is a biological research lab near the city where the outbreak originated has a familiar logo. Shanghai Ruilan Bao Hu San Biotech Limited seems to be linked to the Umbrella Corporation from Resident Evil. It has also been pointed out that Corona is an anagram of ‘Racoon’, fans of Resident Evil will know that the original outbreak in the game started in Raccoon city. -- -- #populationcontrol #StayVigilant #newworldorder #wakeupsheeple #secretsocieties #mindcontrol #consciousawareness #freedomthinker #WakeUpAmerica #coronavirus #news #newsflash #breakingnews
2231693601410386496; 1; False; 1580258630; Belum terlambat lagi kan??? Meletop baru dan lama tetapi gaya masih sama. Lol:zany_face::face_with_tears_of_joy: . . Meletop setiap hari selasa, 9.00 malam, Astro RIA dan RIA HD . . . #MiraFilzah #Meletop #Nabilahmad #astroria #astro #Ariani #coronavirus #jujurlahnikahiaku #tolongsempurnakanceritamami #goodmorning #morningsunshine #lunaday
2231693564492128633; 0; False; 1580258626; Sorong, 29 Januari 2020. Kantor Imigrasi Kelas II TPI Sorong mengikuti dialog interaktif RRI Kota Sorong dengan topik peningkatan pengawasan WNA cegah virus corona. Kegiatan berlangsung dinamis dan atraktif via sambungan telepon dengan beberapa instansi terkait. Kasi Tikomkim Kanim Sorong Erlangga Dwi Saputra juga menyarankan kepada masyarakat khususnya warga kota sorong sekitar yang sudah berencana wisata ke daerah endemi virus corona ditunda dulu, demi kebaikan bersama. #kemenkumaham RI #Imigrasi #RRI #dialoginteraktif #coronavirus @kemenkumhamri @kemenkumham_pabar @rrisorong @jerry_risnandar @erlangga.saputra @rstradiatama @yansen2987 @edwino.msl @awal.aj @willygustiyan @8chal.ds @ariefkurnia_ @gw.adjie @monkey.d.raldy @ekawati_zakaria_balle @fermina.mtnbn @findrimeg @arifianata @mahmud.efendi @adnan_oke
2231693496661942515; 0; False; 1580258617; #corona #coronavirus #china #memes #lol #funny #twitter #iran #bruh #funnymemes #edgymemes
2231693473644257946; 0; False; 1580258615; Kenapa diSR12 harus ada paket pemula terlebih dahulu? ?:thinking_face: Nih jawabannya say,,:backhand_index_pointing_down: Karena untuk memutus siklus ketergantungan terhadap skincare xxxx sebelumnya say,, Supaya kulit mu siap menerima perawatan selanjutnya lewat Produk SR12 :slightly_smiling_face: Nah begitu say:winking_face:,,, Emang paket pemula itu isinya apa aja sih? Terdiri dari::backhand_index_pointing_down: 1. Sabun 2. Masker kefir 3. VICO Paket pemula ini harus disesuaikan dulu ya say dengan jenis kulit mu :slightly_smiling_face: biar hasilnya wawww:face_blowing_a_kiss::winking_face: #wajahkusam #wajahsehat #wajahberminyak #vicosejutamanfaat #sr12skincareherbal #sr12cosmeticskincare #sr12skincarebpom #sr12ciamis #coronavirus
2231693439243046925; 1; False; 1580258611; Síguenos para mas contenido :blue_heart: - - - - #memesdaily #elgoth #meme #memesgraciosos #memesenespañol #memesespañol #memes:face_with_tears_of_joy: #memes #goth #siguemeytesigo #gothjaidefinichon #chileanmemes #jaidefinichongoth #china #coronavirus #gatitos #kakarot #dylantero #instagram #instamemes #dylanteromeme
2231693294923012534; 0; False; 1580258593; Já são três casos suspeitos no Brasil. O lado ruim da globalização. #geografia #geography #geoéamor #vestibular #educacao #sustentabilidade #enem2019 #fuvest #unesp #unicamp #brasil #enem #education #studygram #study #vestibularmedicina #concurseiro #meioambiente #concurso #usp #coronavirus #china
2231693158945399026; 0; False; 1580258577; #CoronaVirus this guy has a cool wacom pen and talks about containment, infection and deaths.
2231693061090891281; 1; False; 1580258576; Çinli yetkililer corona virüsine yakalanan vatandaşları tespit ediyor #çin #wuhan #corona #coronarender #coronavirus #şafaksezer #sinema #mizah #takip #seyf #kafalar #reynmen #wtcn #youtube #çukur #ganyotçu #ekremabi #galatasaray #fenerbahçe #besiktas #caps #saykodelipaylaşımlar #pubg #fundamentals #yarasa
2231692792305150715; 281; False; 1580258574; Jepang mengirimkan pesawat untuk mengevakuasi 200 warganya yang berada di tempat bermulanya wabah virus Corona. Ada sekitar 650 warga negara Jepang di Wuhan yang mengatakan ingin pergi meninggalkan kota itu. Jepang juga akan menerbangkan 1 atau 2 pesawat susulan untuk menjemput warga negaranya yang tersisa. Pesawat yang dicharter pemerintah Jepang itu juga membawa petugas medis lengkap dengan perlengkapannya. Ini adalah kali pertamanya Jepang mengevakuasi warganya dari luar negeri akibat mewabahnya penyakit menular. ⁣ ⁣ Virus Corona memiliki periode waktu inkubasi selama 14 hari dan bisa menyebabkan pneumonia. Virus ini bisa menyebar melalui batuk dan bersin ataupun melalui kontak langsung dengan penderita. Transmisi dari manusia ke manusia, selain di China juga telah terjadi di Jepang dan Jerman. Lebih dari 100 orang yang telah meninggal akibat virus ini.⁣ ⁣ Sumber: Japan Times, South Morning China Post, ANN News.⁣ ⁣ #jepang #jepun #japan #wuhan #china #coronavirus #viruscorona
2231693112245563852; 0; False; 1580258572; JAJAJAjaja...ja :eyes: :black_small_square: :black_small_square: :black_small_square: :black_small_square: #SinNombreOficialicimo #uruguay #china #humor #coronavirus #zorra #dengue #2020 #pandemia
2231693007026769460; 0; False; 1580258559; Waspadai corona virus yang sedang melanda beberapa negara di berbagai belahan dunia. Apa itu Corona virus ? Apa saja gejala yang ditimbulkan? Dan bagaimana cara mencegahnya? Cari tahu infonya di postingan instagram Jims Honey yuk! Dan jangan lupa untuk selalu waspada dan jaga kesehatan kamu ya! . . . #corona #coronavirus #Jimshoney #fd_pinkyshop #viruscorona #staysafe
2231692993338064700; 0; False; 1580258557; Mengenal sosok dokter Ali Mohamed Zaki, ilmuwan muslim penemu virus Corona. . Ali berhasil mempublikasikan virus temuannya di salah satu jurnal terkemuka, yaitu The New England Journal of Medicine (NEJM) pada Oktober 2012, bersama dengan beberapa ilmuwan (virologist) dari Belanda . . #SINDOgrafis #CoronaVirus #VirusCorona #VirusWuhan #Beritaviral #SARS #InfoKesehatan #TipsKesehatan #AliMohamedZaki #ikatandokterindonesia #regrann @koransindo
2231692875360174569; 8; False; 1580258556; China se dispone a construir en pocos días un hospital apara atender a pacientes del #Coronavirus, pero en Panamá la construcción del nuevo Hospital del Niño lleva más de siete años sin poder ejecutarse. #TReporta
2231692920187805703; 0; False; 1580258549; Waspadai corona virus yang sedang melanda beberapa negara di berbagai belahan dunia. Apa itu Corona virus ? Apa saja gejala yang ditimbulkan? Dan bagaimana cara mencegahnya? Cari tahu infonya di postingan instagram Jims Honey yuk! Dan jangan lupa untuk selalu waspada dan jaga kesehatan kamu ya! . . . #corona #coronavirus #Jimshoney #fd_pinkyshop #viruscorona #staysafe
2231692887892866084; 0; False; 1580258545; :') #fotografías #prima #primo #bombita #coronavirus
2231692820339584782; 0; False; 1580258537; Haha #coronavirus #wuhan #starwars
2231692734070828421; 0; False; 1580258527; Happy elephant sound* FOLLOW @dottedmuffin . . . . . . . . #humor #memesdaily #memes #meme #fun #comedy #funnymemes #coronavirus #dailymeme #dailymemes #2020 #china #follow #funnymemesdaily
2231692725840038523; 14; False; 1580258526; :police_car_light::police_car_light::police_car_light:NEW POST ON THR CORONAVIRUS OUTBREAK!!! :police_car_light::police_car_light::police_car_light: The new strain coronavirus (termed 2019-nCoV) has been gaining quite a bit of attention in the news worldwide with its climbing death rate (over 100 deaths) and incidence (over 4000 reported to be infected, likely to be an underestimation). There are now five cases reported in the United States. You’ve likely read about it or heard about it but just in case you haven’t here are some quick facts about what you should know, when to be suspicious for it, and how to prevent it! This info was gathered from @cdcgov (CDC.gov). •• :keycap_1: How does the virus spread? - Person to person via droplets. :speaking_head::dashing_away::sweat_droplets: •• :keycap_2: How can I protect myself? - Wash your hands often with soap and water for at least 20 seconds. :sweat_droplets::sweat_droplets::sweat_droplets: - If soap is not available then use an alcohol based hand sanitizer. - Avoid close contact with people who are sick. - Stay home when you’re sick. :sneezing_face: - Cover your cough or sneeze. - Avoid touching your eyes, nose, and mouth with unwashed hands. :eyes::nose_medium_skin_tone::mouth: •• :keycap_3: What symptoms to look out for: - Fever and symptoms of respiratory illness, such as cough or shortness of breath, within 14 days after travel from China, you should call ahead to a healthcare professional and mention your recent travel or close contact. - If you have had close contact with someone showing these symptoms who has recently traveled from this area, you should call ahead to a healthcare professional and mention your close contact and their recent travel. •• •• •• Thank you @medelita_gram for this brand new white coat!!! :winking_face::smiling_face_with_sunglasses::OK_hand_medium_skin_tone: (White coat: Bernard Men's Stretch Lab Coat, size 36). •• •• •• #nyc #doctor #brooklyn #cardiology #coronavirus #coronavirusoutbreak @cdcglobal @nejm
2231692728567449263; 22; False; 1580258526; Brasil tem três casos suspeitos de coronavírus, diz ministro da Saúde. Contaminação começou na China e registra novos casos em vários países. Para mais detalhes, acesse o Imirante.com. #imirante #informaçãonoseutempo #notícias #saúde #coronavirus #alerta
2231692681691457803; 0; False; 1580258520; Medidas preventivas y control de infecciones: 1. Uso de mascarillas respiratorias. No es necesario protector respiratorio N95 hasta el momento. 2. Higiene de manos con antisépticos, agua y jabón, durante 20 segundos cumpliendo los 5 momentos (antes de tocar al paciente, después de realizar tareas asépticas, después de manipular las secreciones del paciente, después de tocar al paciente, después de tocar el entorno del paciente). 3. Toser o estornudar en el pliegue del codo, evitar tocar la cara, naríz o boca con las manos sin lavar. 4. Evitar el contacto cercano con personas enfermas. 5. Limpiar y desinfectar las superficies manipuladas con frecuencia. #medidaspreventivas #infecciónviral #coronavirus #medicinainterna #infectología #verlezzamd
2231692382144189909; 0; False; 1580258485; Coronavírus . :white_heavy_check_mark: Constituem uma grande família de vírus, conhecidos desde meados de 1960 e causam infecções respiratórias em animais e humanos. São caracterizados morfologicamente por espículas na superfície, que se assemelham a uma coroa. :white_heavy_check_mark: Geralmente causam infecções respiratórias leves a moderadas, mas alguns podem causar doenças graves, com grande impacto em saúde pública, como a Síndrome Respiratória Aguda Grave (SARS) identificada em 2002 e a Síndrome Respiratória do Oriente Médio (MERS) identificada em 2012. :white_heavy_check_mark: Em 2019 foi identificada uma nova variante do vírus (2019-nCoV), na cidade chinesa de Wuhan. A provável transmissão ocorreu de um reservatório natural do vírus para o ser humano e o provável foco inicial da doença parece ser um mercado de frutos do mar. Algumas suspeitas sugerem transmissão através de morcegos. :white_heavy_check_mark:O vírus é transmissível de pessoa para pessoa por partículas respiratórias e por contato direto ou indireto com secreções infectadas, antes mesmo da manifestação dos sintomas. :white_heavy_check_mark:Os dados sobre contágio e letalidade ainda estão não permitem conclusões e a evolução da epidemia está sendo acompanhada para melhor definição. Relatório da situação global publicado hoje pela OMS traz que os pacientes com infecção 2019-nCoV estão apresentando ampla gama de sintomas. A maioria parece ter doença leve, e cerca de 20% parecem progredir para doença grave, incluindo pneumonia, insuficiência respiratória e, em alguns casos, óbito. :white_heavy_check_mark: Na ausência de medicamentos eficazes ou de uma vacina, o controle dessa doença depende da pronta identificação, avaliação de risco apropriada, gerenciamento e isolamento de possíveis casos, e a investigação e acompanhamento de contatos próximos para minimizar o potencial de transmissão subsequente. :white_heavy_check_mark:Até o momento não existem casos confirmados no Brasil e três casos suspeitos estão sendo investigados. #coronavirus #infectologia #goiania #goias #medicina #saude #health
2231692338808602400; 0; False; 1580258479; Menciona al chino alcahuete. @@ #chinos #coronavirus #infectados
2231692321509210597; 0; False; 1580258477; ข้อแนะนำและวิธีป้องกันตัวเองเพื่อลดโอกาสเสี่ยงเป็นโรคปอดอักเสบจากการติดเชื้อ ไวรัสโคโรนาสายพันธุ์ใหม่ 2019 (2019-nCoV) 1.สวมหน้ากาก เมื่ออยู่ในสถานที่แออัด 2.กินร้อน ช้อนกลาง กินอาหารที่ปรุงสุก 3.หมั่นล้างมือด้วยน้ำสะอาด หรือ แอลกอฮอล์เจลล้างมือ 4.นอนหลับพักผ่อนให้เพียงพอ 5.ไม่อยู่ใกล้ชิดผู้มีอาการทางเดินหายใจ 6.หลีกเลี่ยงสัมผัสสัตว์ที่คาดว่าเป็นพาหะ สำหรับท่านที่เดินทางไปยังพื้นที่เสี่ยงในช่วงเร็ว ๆ นี้ หรือ มีปฏิสัมพันธ์ใกล้ชิดกับผู้เดินทางกลับจากประเทศจีน โดยเฉพาะเมืองอู่ฮั่น ภายในระยะเวลา 14 วัน หากมีอาการไข้ ไอ เจ็บคอ น้ำมูลไหล หายใจเหนื่อย ให้รีบไปติดต่อพบแพทย์ทันทีนะคะ ที่มา : องค์การอนามัยโลก และ กรมควบคุมโรค #ไวรัสโคโรนาสายพันธุ์ใหม่2019 #ไวรัสโคโรน่า #VirusCorona #Coronavirus #ไวรัสโคโรนา #ไวรัสโคโรนาสายพันธุ์ใหม่ #nCoV2019
2231692302064348734; 1; False; 1580258475; :police_car_light::SOS_button::China::Brazil::SOS_button::police_car_light: 请各位刚从国内出来的华人华侨，自行在家隔离两个星期（14）天。如有感觉不适，尽快就医，去急诊:hospital:。疫情无情，人:Japanese_not_free_of_charge_button:情。防护疫情人人有责。为了对您和您身边的人负责。保护自己，就是保护家人 :folded_hands_light_skin_tone: A toda comunidade chinesa no Brasil :police_car_light::SOS_button::Brazil::China::SOS_button::police_car_light: Por favor, chineses que vieram do exterior que acabaram de sair da China, chegaram no Brasil, fiquem isolados em casa por duas semanas (14) dias. Se você se sentir mal, procure atendimento médico o mais rápido possível e vá para o departamento de emergência :hospital:. O surto é implacável e as pessoas :Japanese_not_free_of_charge_button:. É responsabilidade de todos proteger contra um surto. Você é responsável por você e aqueles ao seu redor. Proteger-se e proteger sua família. :folded_hands_light_skin_tone: :police_car_light::SOS_button::police_car_light: #coronavirus #china #brazil #brasil #wuhan #pequim #guangdong #virus #viruschina2020 #globo #g1 #g1globo #Sars #jornaldobrasil #中国 #中国华人 #华人华侨 #chineses #chinesesnobrasil
2231692218280659546; 0; False; 1580258465; Deodorant spray ini emang best banget :sparkling_heart: bau ketek dan burketpun minggat shay kelebihan lainnya bisa bikin kulit ketiak yang hitam perlahan menghilang:smiling_face_with_heart-eyes::smiling_face_with_heart-eyes: Ahh aku sih suka banget :two_hearts: kalo kamu:winking_face::winking_face: #deodorantherbal #deospray #bauketi #mencerahkanketiakhitam #sr12skincareherbal #sr12ciamis #sr12cosmeticskincare #sr12skincarebpom #coronavirus
2231691726320712094; 0; False; 1580258450; bayangin kalian yang dikasih makan kecebong sama mami kalian :upside-down_face: @salsa_f_23 @tokofashionsalsa @fashiontas212 @_nation.exe009 #chillmusic #chinatown #chinesenewyear #jiji #jorok#kecebonganyut #kecebongjogja #kecewa #kecebonglucu #maka #makanan #makanapa #manis #pahi #kenangan #jorokbanget #coronavirus #virus #virusvideo #vidiokatakata #videowhatsapp #videoliterasi
2231692067904489580; 0; False; 1580258447; It's the end if days #coronavirus
2231692050810908298; 2; False; 1580258445; Alright, alright, we know...being arrested by the FBI isn't necessarily any proof of guilt, especially in today's world. But, considering the Coronavirus scare that's currently going around, it's highly coincidental that a chemistry department head specializing in nanotechnology and chemical and bioweapon research gets arrested...and we don't believe in coincidences. We'll dive deeper and continue to run this story to groud, right now we can't do anything but be journalists. -------------------------------------------- Follow us for instant updates and real time intelligence reports. S2 Underground is a freelance covert intelligence service that provides daily intelligence updates to the American people on various events. We view mainstream media as a hostile force that actively hides the truth. This is where the truth comes out. Welcome to S2 Underground. #redflagalerts #intelligence #conservative #instagood #2ndamendment #2a #comeandtakethem #news #alert #gunrights #ar15 #assaultweapons #shallnotbeinfringed #impeachtrumpnow #republican #fakenews #democrat #meme #donaldtrump #freedom #trump2020 #liberal #guncontrol #virginia #policethepolice #policebrutality #terrorism #coronavirus #biology #chemistry
2231692040759307115; 0; False; 1580258444; China is cancelled - - - - -#dankmemes #spongebobmemes #spongebob #dankest #memesthatcurecancer #memesthatcuredepression #memesdaily #bestmemesever #nutt #bestmemesof2019 #joker #jokermovie #bigmouth #xboxisgay #thiccmemes #ww3memes #fortnite #memesarelife #redditmemes #normiememes #bestmemes #offensivememes #offensivememes:sweat_droplets::eyes::hundred_points::face_with_tears_of_joy::face_with_tears_of_joy::gem_stone::fire::face_with_steam_from_nose::sweat_droplets::OK_hand::hundred_points::face_with_tears_of_joy::folded_hands::face_with_tears_of_joy::face_with_tears_of_joy::gem_stone::gem_stone::fire::face_with_steam_from_nose::sweat_droplets::eyes::eyes:#coronavirus
2231692044225251910; 0; False; 1580258444; :') #fotografías #amor #comida #coronavirus #uwu
2231692019563481096; 0; False; 1580258441; Seperti yang dipesan oleh Menteri Kesehatan, Yang terpenting saat ini adalah menjaga Imunitas tubuh agar tidak mudah terserang virus apapun. . Untuk menjaga Imunitas tubuh bisa dengan konsumsi rutin British Propolis 2 sampai 3 X sehari. . Saatnya sedia British Propolis dirumah untuk anda dan keluarga. . WA 081585179695 www.britishpropolismm.com #BritishPropolis #imunitas #suplemenkesehatan #suplemenkeluarga #coronavirus #tipskesehatan #menterikesehatan #drterawan #sekolahcikal #highscope #acgschooljakarta #pesandokter #
2231691926707646295; 0; False; 1580258430; Ima leave you with this big brain moment (gn ppl) #cancerousmemes #offensivememes #gay #relateable #coronavirus #corona #relatablememes #stolenmemes #china #stolenmemesforstolenkids #offensivememes:sweat_droplets::eyes::hundred_points::face_with_tears_of_joy::face_with_tears_of_joy::gem_stone::fire::face_with_steam_from_nose::sweat_droplets::OK_hand::hundred_points::face_with_tears_of_joy::folded_hands::face_with_tears_of_joy::face_with_tears_of_joy::gem_stone::gem_stone::fire::face_with_steam_from_nose::sweat_droplets::eyes::eyes: #dankmemes #meme #pronouncingthingsincorrectly #jetfuelcantmeltsteelbeams #lmao #tiktoksexy #tiktokmemes #twittermemes#twitterquotes #redditmemes #gaming
2231691578590475588; 0; False; 1580258425; Aerial images show how deserted the central #Chinese city of #Wuhan has become under lockdown, as authorities scramble to stop a deadly #coronavirus #epidemic from spreading further.
2231691784387115327; 0; False; 1580258425; Ơn chúa.Viêt Nam đã chữa thành công Virus Corona. Đó là 1 điều tuyệt vời tuy chỉ là 1 đất nước nhỏ #donaldtrump #vietnam #coronavirus
2231691867836249928; 0; False; 1580258423; . Virus Corona dapat berikatan dengan glikoprotein permukaan sel inang secara spesifik untuk memulai terjadinya infeksi. Virus corona diklasifikasikan menjadi tiga golongan utama, golongan 1 dan 2 menginfeksi mamalia, mulai dari kelelawar hingga manusia, sedangkan golongan 3 hanya ditemukan pada spesies avian (burung). Infeksi virus ini dapat menimbulkan gejala penyakit yang bervariasi, mulai dari hampir tidak timbul gejala apapun hingga gejala yang fatal dan cepat. Virus corona atau corona virus pertama kali diidentifikasi pada 1960, namun tidak diketahui asal virusnya. Nama corona virus berasal dari bentuknya yang mirip mahkota. Pada beberapa kasus, virus corona bisa menginfeksi hewan dan manusia. Virus corona mengakibatkan 585 kematian akibat Middle East respiratory syndrome (MERS), yang muncul pertama kali pada 2012 di Arab Saudi. Sebelumnya pada 2003, corona virus menyebabkan 774 kematian akibat Severe Acute Respiratory Syndrome (SARS). Pada akhir Januari 2020, WHO mengindentifikasi 2019-nCoV di China. Pada akhir Januari 2020, ada sekitar 300 kasus yang teridentifikasi di China. Tiap negara telah menyiapkan upaya pencegahan dan pengamanan, namun virus corona tetap mampu menyebar ke seluruh dunia. #BEMFIKES #BEMFIKESUIA #coronavirus #corona
2231691826372641129; 0; False; 1580258418; #newsfromtheartworld this week includes #taliesin closing, #coronavirus closes more museums, artists move into @artspaceusa #pullmanartspacelofts, #holocaustremembranceday survivors part of 75th anniversary portrait exhibition #cgnart #linkinbio
2231691803126711193; 1; False; 1580258416; SWIPE LEFT! It's all good. Don't fill your mind with negative news. #china #chinavirus #coronavirus Stay positive and spread love! #shenzhen #wuhan
2231691783926389678; 1; False; 1580258413; :face_with_thermometer::face_with_medical_mask: we need QUARANTINE
2231691758627328137; 0; False; 1580258410; Ministro da Saúde, @henriquemandetta, vai reunir secretários estaduais e tratar de protocolos para o caso de o coronavírus chegar ao Brasil. Estar de prontidão é essencial! Nesta terça-feira, o @minsaude orientou que brasileiros só viajem à China em caso de extrema necessidade. Os três casos suspeitos por aqui estão em Belo Horizonte (MG), Curitiba (PR) e São Leopoldo (RS). #JuscelinoFilho #Coronavirus #Saude
2231691567860835943; 0; False; 1580258406; #coronavirus
2231691707967484775; 0; False; 1580258404; សូមស្វែងយល់អំពីជំងឺផ្លូវដង្ហើមប្រភទថ្មីដែលបង្កដោយវីរុសកូរ៉ូណាដែលមានប្រភពពីក្រុង Wuhan ខេត្ត Hubei ប្រទេសចិន។ សូមយកចិត្តទុកដាក់លើរោគសញ្ញាដែលលោកអ្នកកំពុងមាន ឬក្រោយពេលប្រាស្រ័យទាក់ទងជាមួយមនុស្សដែលទើបត្រឡប់មកពីប្រទេសចិន ឬប្រទេសដែលកំពុងមានការឆ្លងរាតត្បាតដោយវីរុសនេះឱ្យបានដិតដល់។ ជាមួយគ្នានេះក៏សូមយកចិត្តទុកដាក់ផងដែរចំពោះរបៀបនៃការឆ្លងនៃវីរុសនេះ និងវិធីបង្ការកុំឱ្យឆ្លងដើម្បីសុខសុវត្ថិភាពផ្ទាល់ខ្លួន។ នៅធនាគារកាណាឌីយ៉ា យើងកំពុងចាត់ទុកបញ្ហានេះជាបញ្ហាចម្បងដើម្បីការពារសុវត្ថិភាពរបស់បុគ្គលិក និងអតិថិជនរបស់យើងគ្រប់រូប ដើម្បីធានាឱ្យបាននូវអនាម័យ និងការរស់នៅស្អាត។ #CanadiaBank #Coronavirus #HereToStay
2231691616455039732; 0; False; 1580258393; Boutta be spooky story time #cancerousmemes #offensivememes #gay #relateable #coronavirus #corona #relatablememes #stolenmemes #china #stolenmemesforstolenkids #offensivememes:sweat_droplets::eyes::hundred_points::face_with_tears_of_joy::face_with_tears_of_joy::gem_stone::fire::face_with_steam_from_nose::sweat_droplets::OK_hand::hundred_points::face_with_tears_of_joy::folded_hands::face_with_tears_of_joy::face_with_tears_of_joy::gem_stone::gem_stone::fire::face_with_steam_from_nose::sweat_droplets::eyes::eyes: #dankmemes #meme #pronouncingthingsincorrectly #jetfuelcantmeltsteelbeams #lmao #tiktoksexy #tiktokmemes #twittermemes#twitterquotes #redditmemes #gaming
2231691514131993126; 1; False; 1580258384; If you know you know Follow @ferrocats for daily memes
2231691511834358239; 1; False; 1580258381; Sempat beredar informasi, melalui pesan whatsap virus Corona menyebar hingga ke Palembang. . . Di dalam pesan tersebut mencatut nama Kepala Dinas Kesehatan Kota Palembang Letizia, bahwa virus tersebut sudah menyebar hingga ke kawasan Bukit Palembang. . . Selengkapnya klik di ig story SRIPOKU.COM #sripo #sriwijayapost #corona #coronavirus #viruscorona #palembang #palembangup #palembangkece #palembangbedesau #palembanghits #palembangterkini #palembanginsta #palembangupdate #palembanginfo #palembangeksis #palembangkekinian #palembangkulukilir #infopalembang #sumsel #sumselterkini #sumselgemilang #beritasumsel #sumateraselatan #sumselupdate #sumselnews #exploresumsel #sumsel24jam
2231691502135706088; 0; False; 1580258380; Waspadai corona virus yang sedang melanda beberapa negara di berbagai belahan dunia. Apa itu Corona virus ? Apa saja gejala yang ditimbulkan? Dan bagaimana cara mencegahnya? Cari tahu infonya di postingan instagram Jims Honey yuk! Dan jangan lupa untuk selalu waspada dan jaga kesehatan kamu ya! . . . #corona #coronavirus #Jimshoney #fd_pinkyshop #viruscorona #staysafe
2231691460368382647; 8; False; 1580258375; Could this be the next plague??:grimacing_face::grimacing_face: Comment down below what you think :inbox_tray: #corona #coronavirus #coronaviruses #coronavirusmemes #coronavirusnews #coronavirus2020 #coronavirus2020 #news
2231691413945817964; 0; False; 1580258369; What would their names be? #cancerousmemes #offensivememes #gay #relateable #coronavirus #corona #relatablememes #stolenmemes #china #stolenmemesforstolenkids #offensivememes:sweat_droplets::eyes::hundred_points::face_with_tears_of_joy::face_with_tears_of_joy::gem_stone::fire::face_with_steam_from_nose::sweat_droplets::OK_hand::hundred_points::face_with_tears_of_joy::folded_hands::face_with_tears_of_joy::face_with_tears_of_joy::gem_stone::gem_stone::fire::face_with_steam_from_nose::sweat_droplets::eyes::eyes: #dankmemes #meme #pronouncingthingsincorrectly #jetfuelcantmeltsteelbeams #lmao #tiktoksexy #tiktokmemes #twittermemes#twitterquotes #redditmemes #gaming
2231691402864844992; 1; False; 1580258368; La #OMS ya declaró al coronavirus una enefermedad de emergencia global de alto riesgo, pero, ¿tu que sabes sobre ésta enfermedad? Se originó el la ciudad China de Wuhan, en dónde luego de un brote de Neumonia que afectó a decenas de personas descubrieron que se trataba de un nuevo tipo o cepa de Coronavirus El #Coronavirus es un virus común entre animales y humanos que afectan las vías respiratorias, por ser un virus no existe tratamiento específico para curarlos, sólo se tratan los síntomas; los cuales son fatiga, tos, fiebre, dificultad para respirar, fiebre y dolor de cabeza La cifra de muertos es de 106 personas, todos en China, pero también hay casos en #Japón, #USA, #Tailandia, #Canadá, #Francia, #Alemania, #Vietnam, #Singapur y #Australia #salud #virus #china #wuhan
2231691352416247443; 0; False; 1580258362; Utilidade Pública! Seja cuidadoso(a) ao repassar notícias sobre o coronavírus, busque informações em sites oficiais. @minsaude #coronavirus #bemestar #saudepublica #saudemental #semfakenews #ministeriodasaude
2231691348170657695; 0; False; 1580258361; Gloves are currently trending all over Amazon so here is the best deal! 100 pair of nitrile gloves for just $9.98! That is 67% OFF! Pick yours up today! https://www.amazon.com/gp/product/B00GS8W3T4/ref=as_li_tl?ie=UTF8&tag=thefrugalflam-20&camp=1789&creative=9325&linkCode=as2&creativeASIN=B00GS8W3T4&linkId=10c3ee74180eb3473c55a45595528ff2 #amazon #amazondeal #coronavirus
2231691312042942567; 0; False; 1580258357; Tomáme una foto así tipo Corona virus, medio despistada. :Japanese_secret_button::Japanese_passing_grade_button::carp_streamer::red_envelope: #coronavirus
2231691305615335278; 0; False; 1580258356; 29.01.19 #virus #corona #coronavirus #warning #dead #death #world #biology #health
2231691271751957058; 0; False; 1580258352; :loudly_crying_face: #memesdaily #new #coronavirus
2231691244823082563; 0; False; 1580258349; It's tru tho #cancerousmemes #offensivememes #gay #relateable #coronavirus #corona #relatablememes #stolenmemes #china #stolenmemesforstolenkids #offensivememes:sweat_droplets::eyes::hundred_points::face_with_tears_of_joy::face_with_tears_of_joy::gem_stone::fire::face_with_steam_from_nose::sweat_droplets::OK_hand::hundred_points::face_with_tears_of_joy::folded_hands::face_with_tears_of_joy::face_with_tears_of_joy::gem_stone::gem_stone::fire::face_with_steam_from_nose::sweat_droplets::eyes::eyes: #dankmemes #meme #pronouncingthingsincorrectly #jetfuelcantmeltsteelbeams #lmao #tiktoksexy #tiktokmemes #twittermemes#twitterquotes #redditmemes #gaming
2231691216646738313; 0; False; 1580258346; Hey @corona, seriously what's up with this virus!? #coronavirus #corona #virus #meme #funnymemes #funny #endoftheworld #2020
2231691189139060126; 0; False; 1580258342; De acuerdo a la Comisión Nacional de Sanidad de #China, el #Coronavirus se ha llevado la vida de 106 personas :pensive_face: y mantiene infectadas a 4.515 :weary_face: . Por lo que te recomendamos: . :keycap_1:.- Evita el contacto cercano con personas afectadas por #infeccionesrespiratorias :keycap_2:.-Lávate las manos de forma frecuente, especialmente antes y después del contacto directo con #personasenfermas . :keycap_3:.- Mantén una distancia de un metro entre las personas :keycap_4:.- Cubre tu boca y nariz con el antebrazo o usa pañuelos desechables al toser o estornudar y después lávate las manos . Por ahora, no existe una cura para esta enfermedad. No obstante, los #médicos :man_health_worker: trabajan para desarrollar una #vacuna . Con nuestra #aplicación ¡puedes marcar la diferencia! Descarga #Novem, a través de https://play.google.com/store/apps/details?id=com.asertech.novemapp y carga todos tus #antecedentesclínicos . . . #China #Wuhan #Pandemia #Enfermedadesmortales #contingencia #Salud #Saludable #NoticiaEnDesarrollo
2231691145688057562; 0; False; 1580258337; Becareful out there IG fam :folded_hands_medium-light_skin_tone: #corona #coronavirus #sick #fuckcoronavirus
2231688494057437827; 0; False; 1580258330; Following recent deadly outbreaks of #measles in Samoa and #coronavirus in China, leading health and children’s organisations are now warning that nine million children could die of #pneumonia in the next decade. #Malnutrition, air pollution and lack of access to #vaccines and #antibiotics are among the contributing factors.⁠ ⁠ Click the link :link:in our bio :books:to find out more!⁠ ⁠ #ForEveryChild #unicefnz #unicef #childrensrights #childrights #childhood #kids #tamariki⁠ ⁠ ⁠
2231691067697407613; 0; False; 1580258328; I know so many unfortunate things have occured within just the first month of 2020 and the #coronavirus is definitely a scary one. But I believe that if we take some simple precautions, we can limit exposure and help to prevent transmission: 1. Use tissues to "catch it, bin it, and kill it." 2. Wash your hands frequently and very thoroughly with soap and warm water, especially after touching potentially infected surfaces in public! 3. Wear gloves, glasses, and masks. These items can help us not to touch our faces with potentially infected hands and help to block others' coughs and sneezes. And remember that the virus can spread through ears and eyes too! 4. Drink plenty of water or warm tea! Fluids help to flush away germs and mucosa, and staying warm with things like hot tea make the body less favorable for the virus. . ♡ Most importantly, please spread LOVE and not hate or racism towards people in China. ♡ Please don't overgeneralize or blame people from China for the virus. ♡ Many people in China are or know someone in a quarantined city, and they are more anxious about this situation than any of us. So, please send your LOVE and good wishes to them! . For friends living in or planning to visit Korea, swipe to see the Korean Government's recommendations (Kor and Eng.) The Korean government is working hard to prevent widespread transmission to Korea~♡ . #코로나바이러스 #kcdc #1339 #infographic #love #solidarity #doodling #illust #그림 #lovenothate #virus #서울 #travel #여행 #일러스트 #삽화 #두들링 #digitalart #인포그래픽 #graphicdesign #그래픽디자인 # procreate
2231691048909049527; 0; False; 1580258326; Phew I’m safe! #meme #humour #darkmeme #memesdaily #smug #virus #corona #immune #safe #dank #dankmeme #dailylife #funny #solitary #reclusive #isolated #coronavirus
2231691019732927222; 0; False; 1580258322; De acuerdo a la Comisión Nacional de Sanidad de #China, el #Coronavirus se ha llevado la vida de 106 personas :pensive_face: y mantiene infectadas a 4.515 :weary_face: . Por lo que te recomendamos: . :keycap_1:.- Evita el contacto cercano con personas afectadas por #infeccionesrespiratorias :keycap_2:.-Lávate las manos de forma frecuente, especialmente antes y después del contacto directo con #personasenfermas . :keycap_3:.- Mantén una distancia de un metro entre las personas :keycap_4:.- Cubre tu boca y nariz con el antebrazo o pañuelos desechables al toser o estornudar y lávate las manos después . Por ahora, no existe una cura para esta enfermedad. No obstante, los #médicos :man_health_worker: trabajan para desarrollar una #vacuna . Con nuestra #aplicación ¡puedes marcar la diferencia! Descarga #Novem, a través de https://play.google.com/store/apps/details?id=com.asertech.novemapp y carga todos tus #antecedentesclínicos . . . #China #Wuhan #Pandemia #Enfermedadesmortales #contingencia #Salud #Saludable #NoticiaEnDesarrollo #enfermedadesrespiratorias
2231690980642559354; 0; False; 1580258318; Información importante sobre el #coronavirus . :microbe: . . Personas con enfermedades crónicas que afecten las vías respiratorias, o las que causan disminución en las defensas, bebés prematuros y ancianos. . . Los demás si nos contagiamos, tendremos un gran resfrío. . . A lavarse las manos, cubrirse al toser y guardar cama si estamos enfermos. . Ante cualquier signo de alarma: fiebre constante, dificultad para respirar, vomitos constantes.... acudir al centro de salud más cercano, sobretodo si ha viajado cercanamente a lugares donde el virus está circulando. . . Esperemos con paciencia y sin alarma las indicaciones del @minsa_peru . . . #pacienciaybuenhumor #mamalas24horas #coronavirus #niños #infecciones #gripe #alertaepidemiológica
2231690945317208874; 0; False; 1580258313; Masih mulus gais, dijual karena kena fitnah aja ... .. .. .. #viruscorona #coronavirus #obatviruscorona #wuhan #wabah #wabahpenyakit #penyebaranvirus #penyakitmematikan #imunitas #doa #mustajab #resepwarisanbundaku #china #ccp #xijinping
2231690907894298988; 0; False; 1580258309; Assalamualaikum.. Bismillahirrahmanirrahim Open PO.. Polkka Pocket Printed. Harga 100 x 24.500 50 x 25.000 20x 25.500 10 x 26.000 5 x 27.000. Yuks serbu...... Bisa d jual 100ribon 3 biji ya.. Mari mari chat WA ke mbak Mimin https://bit.ly/2BwlBJE. Katalog bisa ke Channel Telegram https://t.me/katalogdiandesanta #polkka #kaospolkkka #polkkaanak #kaospolkkaanak #polkkaprint #pockettessseries #polkkapocket #polkkasaku #viruskorona #coronavirus #ripkobe #crazyrichsurabayan #indonesiabagus #sidoel #akhirkisahcinta #mangkujiwo #indonesiabebassampah #indobesiabebasplastik #cpns #CPNS #tescpns
2231690895764509152; 0; False; 1580258307; #FullSpectrumSurvival on #Youtube doing the #research to keep you safe while the #MSM limit access to facts. #CoronaVirus will be #devistating to #survival. #Play it #safe. This is bigger than the #media let on and you must be prepared for this to get worse!! Don't wait till it's too late to take #precautions. #BetterToBeSafeThanSorry https://youtu.be/oFlOkkmXS54
2231688876081266906; 0; False; 1580258303; 신종코로나 방역망이 뚫렸습니다. 이제 각자도생 뿐으로 보입니다 #코로나#신종코로나#chinacoronavirus#coronavirus#우한바이러스
2231690437462436770; 0; False; 1580258302; #coronavirus #coronavirusoutbreak
2231690732387964689; 0; False; 1580258301; @eldiario #Coronavirus | En China :China: dos ciudadanos se pelearon para poder comprar una mascarilla, debido a que ya no hay suficientes :prohibited: y las que se consiguen las venden muy caras.
2231689114202032619; 0; False; 1580258298; Things that make u go #coronavirus
2231690576840012374; 0; False; 1580258296; #Coronavirus | ¿De qué se trata esta nueva amenaza para la salud de las personas y cuáles son sus características? Descubrilo en este #video
2231690800211571712; 0; False; 1580258296; :') #fotografías #family #bombita #coronavirus
2231690755422885724; 0; False; 1580258291; #updates on #CoronaVirus - which has 2 new strains in #LosAngeles and #OrangeCounty #California :face_with_medical_mask::face_with_medical_mask::face_with_medical_mask: - - - - - - #Patriot #AmericaFirst #Truth #News #TheGreatAwakening #MAGA #USA #KAG #america #freedom #justice #politics #qanon #Today #WWG1WGA #RedPill #QArmy #truther #congress #walkaway #redwave #blexit #military #veterans #Now
2231690727094671653; 0; False; 1580258287; Assalamualaikum.. Bismillahirrahmanirrahim Open PO.. Polkka Pocket Printed. Harga 100 x 24.500 50 x 25.000 20x 25.500 10 x 26.000 5 x 27.000. Yuks serbu...... Bisa d jual 100ribon 3 biji ya.. Mari mari chat WA ke mbak Mimin https://bit.ly/2BwlBJE. Katalog bisa ke Channel Telegram https://t.me/katalogdiandesanta #polkka #kaospolkkka #polkkaanak #kaospolkkaanak #polkkaprint #pockettessseries #polkkapocket #polkkasaku #viruskorona #coronavirus #ripkobe #crazyrichsurabayan #indonesiabagus #sidoel #akhirkisahcinta #mangkujiwo #indonesiabebassampah #indobesiabebasplastik #cpns #CPNS #tescpns
2231690715937915811; 0; False; 1580258286; Two cases of the new deadly strain of coronavirus have been identified in Ontario, with a third reported Tuesday in British Columbia. But how much of a threat does the new virus pose to Canadians? Link in bio. #twocases #bc #newvirus #coronavirus
2231690394572553643; 0; False; 1580258282; Bu virüs şeysi ortalığı iyice karıştırdı heğa :face_with_tears_of_joy::face_with_tears_of_joy: . . . #komik #komedi #ilginç #ilginçkazalar #illustrationartists #corona #virus #coronavirus #korona #komikvideo #korkunçvideo #binaliyildirim #binaliyıldırim #ekremimamoglu #babalativi #funny #funnyvideos #fantastik #idiot #idiots
2231690677552203594; 0; False; 1580258281; Debemos extremar las medidas. KILOL te ayuda a evitar los riesgos más comunes con los alimentos. #coronavirus #virus #alimentos
2231689566633728398; 1; False; 1580258280; Yeah same - - - - #meme #memes #gay #lgbt #bruh #dankmemes #edgymemes #hashtag #tiktok #sickdick #fortnite #fortnitecommunity #fortnitegaming #fortniteninja #bruhcat #dog #anime #loli #blackpeoplebelike #coronavirus #lmaowefinnadie
2231690580690400962; 0; False; 1580258275; Google maps nos brinda una herramienta en la cual nos muestra los lugares ya confirmados y falsas alarmas del Coronavirus en Tiempo Real Te compartimos el link para que estes informado :right_arrow: . https://goo.gl/maps/3aiwdFA6fRSTXG6m6 . . . #VidaMédica #TecnologíaMédicaParaTodos #SirviendoConPasión #Coronavirus #Prevención
2231690590846833000; 0; False; 1580258271; Assalamualaikum.. Bismillahirrahmanirrahim Open PO.. Polkka Pocket Printed. Harga 100 x 24.500 50 x 25.000 20x 25.500 10 x 26.000 5 x 27.000. Yuks serbu...... Bisa d jual 100ribon 3 biji ya.. Mari mari chat WA ke mbak Mimin https://bit.ly/2BwlBJE. Katalog bisa ke Channel Telegram https://t.me/katalogdiandesanta #polkka #kaospolkkka #polkkaanak #kaospolkkaanak #polkkaprint #pockettessseries #polkkapocket #polkkasaku #viruskorona #coronavirus #ripkobe #crazyrichsurabayan #indonesiabagus #sidoel #akhirkisahcinta #mangkujiwo #indonesiabebassampah #indobesiabebasplastik #cpns #CPNS #tescpns
2231690585184700640; 0; False; 1580258270; Common sight of masks everywhere while traveling amid virus breakout. #coronavirus #chiangmaithailand
2231690540810586096; 0; False; 1580258265; Made on my Twitter. Follow if you can :thumbs_up: . . . . . . . . [:thinking_face: DONT MIND THE TAGS :thinking_face:] #memes #meme #dankmemes #dankmeme #comedy #comedian #comedic #january #january2020 #januarymemes #cursedimages #cursedimage #cursedmeme #cursedmeme #2020 #2020meme #corona #coronavirus #virus #plague
2231690514663263947; 0; False; 1580258262; Nice turnaround for #bonds #gold and #btc from #coronavirus. Bitcoin = Gold. #bitcoin <> #equities
2231690490116436422; 0; False; 1580258259; Staying away from #coronavirus
2231690479305872790; 6; False; 1580258258; Teamwork to prevent #coronavirus from spreading! #tron is on the way! Join us!
2231690465102438035; 0; False; 1580258256; Worry about coronavirus? :thinking_face: :thumbs_up: Wearing face mask at public places is a easy way to protect your family :backhand_index_pointing_right: 3D Mask Unicharm for both adults and children. —————————————— Just click and enjoy your favorite time Shark delivers to you ON TIME, DOOR to DOOR and FREE —————————————— Mobile web: Sharkmarket.vn Download app for iOS and Android #sharkmarket #샤크마켓 #facemask #coronavirus #goodprice #goodproduct #gooddelivery
2231690439843722687; 0; False; 1580258253; Debemos extremar las medidas. KILOL te ayuda a evitar los riesgos más comunes con los alimentos. #coronavirus #virus #alimentos
2231690399495498585; 0; False; 1580258248; #bichon #picofthechota #picoftheday #idiota #kingleyons #coronavirus #holis
2231687857084606028; 0; False; 1580258248; Todo lo que necesita saber sobre el ¨ #Coronavirus ¨. Y el primer caso sospechoso que se analiza en Ecuador.
2231690359539581934; 0; False; 1580258243; Thoughts? Hotel staff have sent robots to deliver meals to plane passengers who were isolated for stricter screening of #coronavirus. More than 200 tourists were housed in the isolation point in #Hangzhou, east #China, after their flight landed in the city. Some of the passengers on board came from #Wuhan, the city where the virus that has killed more than 100 people originated from. To prevent cross-infection between the passengers, the hotel staff decided to deliver the meals through robots. Video taken by the guests on Sunday shows the robot stopping in front of the room doors while playing the announcement to the guests. It can be heard saying: "Hi everyone. I am now serving meals to you and if you have any meal requirements, please send us a message through WeChat. "A member of staff will contact you shortly. Enjoy your meal, thank you." A man, who wears a face mask and a long coat, opens the door, takes the food off the shelf of the robot and walks back into his room. A spokesman at Hangzhou School of Communist Party of China told Pear that they have programmed 16 robots, one on each floor across the building. He said: "We have set the route for the robots, including where to go, where to stop and to play the announcement at the door. "The robots can entertain and sing songs to the guests." Transport Minister, Grant Shapps, has said the government is working on plans to repatriate UK nationals in the city of Wuhan, where the outbreak is believed to have started. He spoke on BBC Breakfast this morning: "One of the things we’re asking people to do is to contact the consulate there to make them aware. People have started to do that. :hand_with_fingers_splayed_medium-dark_skin_tone:More in comments:backhand_index_pointing_down_medium-dark_skin_tone:#Biowarfare
2231690206824960791; 0; False; 1580258240; Thoughts? Hotel staff have sent robots to deliver meals to plane passengers who were isolated for stricter screening of #coronavirus. More than 200 tourists were housed in the isolation point in #Hangzhou, east #China, after their flight landed in the city. Some of the passengers on board came from #Wuhan, the city where the virus that has killed more than 100 people originated from. To prevent cross-infection between the passengers, the hotel staff decided to deliver the meals through robots. Video taken by the guests on Sunday shows the robot stopping in front of the room doors while playing the announcement to the guests. It can be heard saying: "Hi everyone. I am now serving meals to you and if you have any meal requirements, please send us a message through WeChat. "A member of staff will contact you shortly. Enjoy your meal, thank you." A man, who wears a face mask and a long coat, opens the door, takes the food off the shelf of the robot and walks back into his room. A spokesman at Hangzhou School of Communist Party of China told Pear that they have programmed 16 robots, one on each floor across the building. He said: "We have set the route for the robots, including where to go, where to stop and to play the announcement at the door. "The robots can entertain and sing songs to the guests." Transport Minister, Grant Shapps, has said the government is working on plans to repatriate UK nationals in the city of Wuhan, where the outbreak is believed to have started. He spoke on BBC Breakfast this morning: "One of the things we’re asking people to do is to contact the consulate there to make them aware. People have started to do that. :hand_with_fingers_splayed_medium-dark_skin_tone:More in comments:backhand_index_pointing_down_medium-dark_skin_tone:#Biowarfare
2231690289864377994; 0; False; 1580258235; Tonight we traveled to China without fear! Why, without so much as leaving the kitchen! Homestyle Tofu (Sichuan) and Grean Beans w/Sesame Dressing made for a big smile and a full tummy from Q. Thanks to @rasamalaysia and @chinasichuanfood for the yummy recipes! ----- Recipes: Homestyle Tofu : https://rasamalaysia.com/spicy-sichuan-homestyle-tofu/ Sesame Chinese Long Beans: https://www.chinasichuanfood.com/sesame-chinese-long-beans/ #rasamalaysia #chinasichuanfood #eatathome #coronavirus #cantstopme
2231690227604053843; 0; False; 1580258228; Cuando el presidente chino comienza a toser en plena cumbre mundial :face_with_tears_of_joy::China::face_with_medical_mask: . . . . . #meme #china #coronavirus #g20 #g8 #g10 #presidente #humor #jaja #virus #ill #chinesenewyear #chinese #tos #fear
2231690209905148056; 3; False; 1580258226; Se registra primer caso de #coronavirus en Puerto Rico, según nos informan una joven de 23 años está infectada con el virus; sin viajar a China. Visita nuestro sitio web www.sertelnoticias.com #sertelnoticias #republicadominicana #china #wuhan vía @lmonoticias #coronavirus
2231690195014788330; 0; False; 1580258224; #Coronavirus #pandemic in #Wuhan #China it's worst than you think
2231690187791318271; 0; False; 1580258223; Panamá repatriará a 75 estudiantes becados en la República Popular de China por el avance del coronavirus. Se tratan de becarios que ya culminaron sus estudios y están en la espera de su graduación. Un grupo será repatriado el 4 y el otro el 7 de febrero, respectivamente. . #LEPNacional #Panamá #coronavirus
2231690150044753891; 0; False; 1580258219; There has been much in the news about the coronavirus from Wuhan, China. One thing to keep in mind is that you have a greater chance of contracting the flu. Learn more about #coronavirus and protecting yourself from all viruses from Healthy Children.org. LEARN more: http://bit.ly/TPHcorona #WashYourHands #Virus #FightFlu #Flu #TPedHealth
2231690093561988653; 0; False; 1580258212; Fairly odd parents was better than SpongeBob don't @ me #cancerousmemes #offensivememes #gay #relateable #coronavirus #corona #relatablememes #stolenmemes #china #stolenmemesforstolenkids #offensivememes:sweat_droplets::eyes::hundred_points::face_with_tears_of_joy::face_with_tears_of_joy::gem_stone::fire::face_with_steam_from_nose::sweat_droplets::OK_hand::hundred_points::face_with_tears_of_joy::folded_hands::face_with_tears_of_joy::face_with_tears_of_joy::gem_stone::gem_stone::fire::face_with_steam_from_nose::sweat_droplets::eyes::eyes: #dankmemes #meme #pronouncingthingsincorrectly #jetfuelcantmeltsteelbeams #lmao #tiktoksexy #tiktokmemes #twittermemes#twitterquotes #redditmemes #gaming
2231690075803379347; 0; False; 1580258210; No te wa a deci ke zoi io . . . . . . . . . . . . . . . . . #dankmemes #memes #dylantero #chilegram #dylanteromemes #instachile #shitpostespañol #shitpost #chistoso #chilegram #chileanmemes #shitposting #memesdaily #re3 #coronavirus #terceraguerramundial #guerramundial #umor #usa#instachile #chilegram #renunciapiñera #simpsons #chiledesperto #chile #memeschilenos #chilememes #memeschile #shitpostchile #Santiago #valparaiso #Concepcion #sanvalentin
2231690061315958993; 0; False; 1580258208; Ya está aquí, ya llegó!!!! . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . #simpsons #thesimpsons #corona #virus #coronavirus #china #like4likes #likeforlikes #likeme #followme #followxfollow #followback #cartoons #seymour #skinner #bart
2231690055596895215; 0; False; 1580258207; #coronavirus taşıyanların tedavi edilmesi için yapımına 23 ocakta başlanan hastanenin çoğu bölümü 6 günde tamamlandı.
2231689220703731253; 1; False; 1580258198; Inside Wuhan ` #xijinping #wuhan #coronavirus #cina #virus #freeuyghur #geloranews #breakingnews#bebaskanluthfi#opposite6890#fuadbakh#rockygerung#stmmelawan#mahasiswa#mahasiswabergerak#infoterkini#emakemakjamannow#milenial#akalsehat#republikakalsehat#republikjancukers#muslimcyberarmy#tvone#ilctvone#kompastv#beritaterkini#kumparan#reformasidikorupsi#hadifayyadh
2231689971692420654; 1; False; 1580258197; Hong Kong ppl rushing for food :astonished_face:- Wuhan Virus
2231689621962716321; 0; False; 1580258195; :red_circle:Que tal está silla? . . . SIGUE a @jospre_lol Para más momos . . . . . #Jospre #memes #divertido #momazos #Momos #momazosxd #chiste #humor #re100horneado #memeslol #momoz #memesdivertidos #memes4k #videoscuriodos #humorpesado #humornegro #tiktokmemes cano #humormexicano #memesmexicanos #videosgraciosos #videosderisa #memesdominicanos #videosmemes #tiktok #memesespañol #memeslatinos #dominicanos #mexico:Mexico: #tiktokmemes #coronavirus
2231689784802775321; 0; False; 1580258192; Oh neeeeeereein . . . . . . .... . . . . #funnyvideos #haha #memes #illness #china #blackhumor #haha #witzig #alman #memes #keller #likeforlikes #likeforfollow #wuhan #virus #corona #coronavirus #deutschrap #tiktokmemes #tiktokgirls #tiktok #alman #almanmemes #capitalbra #nimo #mero428 #kmn
2231689896774638181; 1; False; 1580258188; 새해 '0' 많이 받으세요~! 정답 발표~ 정답은 '복' 많은 분들이 적극적으로 참여 해주셔서 진심으로 감사드립니다 ^^ 옥스포드는 여러분의 사랑으로 성장합니다. 조만간 또 다른 이벤트로 여러분들 찾아 뵐게요~ 또 참여 부탁드립니다 ^^ 모든 참여자 분들 새해 복 많이 받으세요~ _ <당첨자> xianxi77 mrs_sesilia miraeng_hjmom 축하드립니다~! *디엠 메세지로 주소, 연락처를 보내주시면 발송됩니다 ^^ _ 여러분! 신종 코로나 바이러스가 극성입니다.. 마스크, 손씻기, 개인청결 생활화 하시고 꼭 건강하시길 바랍니다. _ #옥스포드 #옥스포드씨티 #미니피규어 #블럭 #신년 #쥐 #디자인 #육아 #육아스타그램 #이벤트 #신종 #코로나 #바이러스 #우환 #폐렴 #마스크 #Oxford #oxfordct #family #toy #event #character #cute #figure #design #winter #coronavirus #mask
2231689886027527397; 0; False; 1580258187; Se registra primer caso de #coronavirus en Puerto Rico, según nos informan una joven de 23 años está infectada con el virus; sin viajar a China. #lmonoticias #republicadominicana #china #wuhan #coronavirus
2231689829245511830; 1; False; 1580258180; Reposted from @fakhrulunic Aminkan, amal doa ni dan mana2 doa lain..nasihat pakar jgn lupa #coronavirus - #regrann
2231687770624373259; 0; False; 1580257935; First post you fuggs follow us fuggers :smiling_face_with_horns::smiling_face_with_horns::smiling_face_with_horns: • • • • • • • TAGS #memes #dank #phmemes #memesdaily #funnymemes #funny #funnyshit #shitpost #shitposts #memes #memesdaily:face_with_tears_of_joy: #dankmemes #memes:face_with_tears_of_joy: #memesespañol #shit #poopoo #monkey #gamer #feet #feetpics #nudes #funnymemes #fortnitefunny #coronavirus #coronavirusmemes#humor#memepage#memepages#dailymemes
2231685752004345239; 0; False; 1580257694; Пусть только так и будет :folded_hands:. #coronavirus #coronavirusinmexico #mexico:Mexico: #коронавирусвмексике #коронавирус #юмор #приколы
2231683926384194248; 1; False; 1580257477; None
2231681214749874482; 1; False; 1580257159; :woozy_face:Low quality post :chart_increasing: Follow me for more quality posts:birthday_cake: @ferrocats
2231680259162741876; 0; False; 1580257039; Office renovation at Mitraland Kota Damansara for CAPTECHASIA What we do : Ideas and consultation Design and Build Custom furniture Decoration We have 2 more SLOT in FEBRUARY for a free CONSULTATION. Don't hesitate to DM or you can just email at the email provided Can reach us directly at 01119994551 or 0132464955 3D perspective from @lanai.design #interior #interiordesigner #officedecor #officedesign #officespace #scandinavianstyle #scandinaviandesign #project #design #decor #coronavirus #savetheplanet
2231677113004473032; 1; False; 1580256675; None
2231664593284001956; 0; False; 1580255172; The bad guys are losing. Stay strong fam and don't feed into the fear. Stay off the tell lie vision. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . #wakeup #losangeles #raisefrequency #vibration #health #california #pedowood #disclosure #westcoast #awakened #responsibility #higherconsciousness #exposed #truth #elevate #elevatingconsiousness #celebrity #weather #sunset #pandemic #matrix #pizzagate #sexy #life #sunny #openyoureyes #roaring20s #coronavirus #socal #kobe
2231689695790790883; 0; False; 1580258177; When she's under 18 :rolling_on_the_floor_laughing::rolling_on_the_floor_laughing::rolling_on_the_floor_laughing: - - - - -Tag a Friend! - - - #wedrinkvuodka #funny #insta #instagram #followback #follow4follow #followme #us #fun #like #done #likeforlike #friends #memes #funny #damm #imdone #spongebob #patrick #worldwar3 #coronavirus #fires #memes
2231689755165543834; 2; False; 1580258171; Been around York and some people avoiding the Asian foods..:thinking_face: . . . #coronavirus #virus #york #nottoolate
2231689659025393753; 0; False; 1580258160; Ramai sangat yang tanya saya.. Betul ke #AtmosphereSky boleh tapis #coronavirus dan #influenzaA ke?? Yes sure, inshaaAllah :winking_face: Sy berani cakap macam ni sebab semua allergen, bakteria, virus yg ada dalam list tu (rujuk gambar 2), dah certified by Allergy Uk tau :grinning_face: Boleh baca kat sini: https://www.allergyuk.org/get-help/products/502-amway-atmosphere-sky-air-purifier Mana laa boleh nak claim macam2 kalau xde 3rd party yg certified kan??? :smiling_face_with_sunglasses: Atmosphere Sky ada HEPA filter yg filter dia sehalus 0.0024micron tau! :face_screaming_in_fear::face_screaming_in_fear::face_screaming_in_fear: Yerrr.. 7000x lebih halus dari rambut awak dear! :smiling_face_with_heart-eyes: Baru laa berbaloi ada air purifier kan :winking_face: Kalau beli yg harga beribu, tapi tak de certified boleh tapis kuman bakteria dan virus, siapa yang rugi? Adudududu.. Nak pilih barang berkualiti, jangan hanya tengok yg hebat marketing atau banyak bill board kat high way (baca: marketing power) semata.. :grinning_face_with_sweat::face_with_tears_of_joy: Kawan2 ada jumpa iklan tv or billboard Ferrari? :smiling_face_with_sunglasses: Yess, high quality product always exclusive for high quality people :winking_face: Pilih yg ada kajian, yg ada pihak ketiga sahkan apa yang dia claim. Baru la telus kan. Kalau hanya percaya cakap agent, kura-kura pun boleh terbang :face_with_tears_of_joy: Jom jadi pengguna bijak.. Jangan tertipu dengan product marketing ya kawan2. Utk kesihatan, pilih yang betul2 berkualiti! :index_pointing_up_light_skin_tone: (rujuk video di bawah :winking_face:) Jgn pernah kompromi dgn kesihatan sendiri, apatah lagi kesihatan anak-anak. HEPA filter kalau dah hitam, boleh ganti baru.. Kalau paru-paru kita??? :anxious_face_with_sweat: #kurangkanbebanparuparuanda #atmospheresky
2231689647464127265; 0; False; 1580258159; A Canadian teacher who lives in the Chinese city that is the epicentre of a coronavirus outbreak says he has no plans to leave. Link in bio. #canadianteacher #coronavirus #outbreak #stay
2231689589777721937; 0; False; 1580258152; Non sembra, ma sono le 8 di mattina. E ho un ombrello in tasca dentro la giacca. Ph: @coriandolinne #analogphotography #milan #after #high #chinese #coronavirus #italy #vintage #film #portodimare #morning #puremorning #flash #overexposed #analog #throwback #autumn #2019 #orange #china
2231689034032696163; 2; False; 1580258120; Reposted from @cordova.media Seorang pejabat Kemenlu China, bernama Lijian Zhao memposting di akun twitternya, video pembangunan rumah sakit yang dibangun untuk pasien yang terjangkit virus Corona. Rumah sakit yang dibangun selama 16 jam ini, berbentuk box dilengkapi dengan teralis besi di jendelanya dan dan kunci yang diletakkan di pintu bagian luar.⁣ ⁣ Di postingan tersebut, ia juga menuliskan, "Let's pray for Wuhan & China", mari berdo'a untuk Wuhan dan China. Sudah jamak diketahui bahwasanya pemerintah China dari Partai Komunis China menganut paham atheisme. Namun dalam kondisi darurat seperti ini, salah satu anggotanya mengajak berdo'a untuk Wuhan dan China yang saat ini dilanda wabah virus Corona. Sudah menjadi fitrahnya, manusia bahkan ateis sekalipun, ketika dalam kesulitan, membutuhkan pertolongan dari Tuhan Yang Maha Kuasa.⁣ ⁣ "Dan dia dibantah oleh kaumnya. Dia berkata: 'Apakah kamu hendak membantah tentang Allah, padahal sesungguhnya Allah telah memberi petunjuk kepadaku'. Dan aku tidak takut kepada [malapetaka dari] sembahan-sembahan yang kamu persekutukan dengan Allah, kecuali di kala Tuhanku menghendaki sesuatu [dari malapetaka] itu. Pengetahuan Tuhanku meliputi segala sesuatu. Maka apakah kamu tidak dapat mengambil pelajaran [daripadanya]?" [QS. Al-An'am: 151].⁣ ⁣ "Dan sesungguhnya Kami jadikan untuk [isi neraka Jahannam] kebanyakan dari jin dan manusia, mereka mempunyai hati, tetapi tidak dipergunakannya untuk memahami [ayat-ayat Allah] dan mereka mempunyai mata [tetapi] tidak dipergunakannya untuk melihat [tanda-tanda kekuasaan Allah], dan mereka mempunyai telinga [tetapi] tidak dipergunakannya untuk mendengar [ayat-ayat Allah]. Mereka itu sebagai binatang ternak, bahkan mereka lebih sesat lagi. Mereka itulah orang-orang yang lalai" [QS. Al-A'raf: 179] . Revisi: di video tertulis 16 hari, yang benar adalah 16 jam sebagaimana yang tertulis di postingan Twitter tersebut. ⁣ #coronavirus #viruscorona #wuhan #china #ccp #xijinping
2231689309933382789; 0; False; 1580258118; Stay alert! #Coronavirus
2231689281102356473; 0; False; 1580258115; This made my day #residentevil #coronavirus #racooncity
2231689272586171502; 1; False; 1580258114; #punnypostffs #dadjokes #jokes #funny #instagram #corona #coronavirus #shot #keephealthy
2231689223378027947; 2; False; 1580258108; :red_heart: (just kidding) . . . . . . . . . #meme #satire #irony #screenrecord #picklerick #coronavirus #corona #virus
2231689091585019989; 2; False; 1580258107; Hsbs eisbwgwuswvgw . . . . . . . #funnyvideos #haha #memes #illness #china #blackhumor #haha #witzig #alman #memes #keller #likeforlikes #likeforfollow #wuhan #virus #corona #coronavirus #deutschrap #tiktokmemes #tiktokgirls #tiktok #alman #almanmemes #capitalbra #nimo #mero428 #kmn
2231688767492515154; 0; False; 1580258107; #wuhanvirus #coronavirus
2231689127673987832; 0; False; 1580258097; #coronavirus
2231689083666991435; 0; False; 1580258091; #CORONAVIRUS #Prevención Hasta la fecha no se dispone de #vacuna alguna ni de tratamiento específico para combatir la #infección por coronavirus. Mantener una #higiene básica es la forma más eficaz de evitar contraer este virus en los lugares en los que existe un mayor riesgo de transmisión, fundamentalmente las zonas del planeta en las que se han registrado casos. Es conveniente lavarse las manos con frecuencia y evitar el contacto con personas ya infectadas, protegiendo especialmente ojos, nariz y boca. A quienes puedan estar en contacto con posibles afectados se les aconseja el uso de #mascarillas y usar pañuelos para cubrirse la nariz y la boca cuando se tose o se estornuda
2231687340002972758; 0; False; 1580258084; Low key I’m scared for my life #corona #coronavirus #scared #china #sad #meme #memes #follow4followback #nude #followforfollowback #tiktokmemes #tiktok #funnytiktoks #laugh #bushdid911whichcausedthecivilwarwhichmadekanyewestsaygeorgebushhatesblackpeople #cheifs #chiefskingdom #49ers #superbowl #trump #trump2020 #berniesanders #hilarious #joebiden #stinky #likeforlikes #fashion #clothes #addidas #nike
2231688985862757185; 5; False; 1580258080; Hello wise people, saya kembali. Ternyata ada yang LEBIH PARAH dari corona virus... Gara-gara virus corona, Malam ini jam 8, di channel Vian Flash. Nyalakan notifikasi bro. Thank you. #coronavirus #vianflash
2231688975478031829; 0; False; 1580258078; #coronavirus talking to human race like #shrek #twitter #funny
2231688862508725586; 0; False; 1580258073; Nike - - - - - @zecta_momos - - - Ya sabes,sigueme para mas contenido original y dale like para saber si les gusta :3 - - - - - - - - Ignorar :v: #recién_horneado #re100horneado #instalike #sigueme #dale_like #dale_me_gusta #followforspam #followforfollow #followme #horneado #hashtag #likeforlike #like4like #comparte #momo #momos_gratis #momos #memes #instalike #tags_for_likes #tagsforlikes #hailgrasa #coronavirus #friends #followers #picsart #hashtag #momos4k #memesespañol #legionholk #instagram #china
2231688845102758918; 0; False; 1580258063; #Coronavirus III
2231688699468152070; 0; False; 1580258046; Bottoms up China :face_with_raised_eyebrow: - - #edgy #bruh #obama #cringe #doge #iran #mlg #okboomer #fortnite #ninja #roblox #minecraft #tyler1 #spongebob #nohomo #coronavirus #arab #alah #billieeilish #doge #ripkobebryant #meme #familyguy #kobebryant #shrek #joker #china #wwiii #babyyoda #ripkobe #ww3
2231688674891059965; 0; False; 1580258043; Due to the rise in demand for masks and disinfectant products,we will be amending the quantity of masks and disinfectant products each customers can purchase to ensure that there's sufficient for each household. Kindly check with our cashier for the purchase of masks and disinfectant products. While stocks last. We hope to seek your understanding and patience during this period. Thank you! #VenusBeautySG #Masks #WuhanVirus #CoronaVirus
2231688664647686790; 0; False; 1580258043; #LoQueCallamosLosProgramadores #coronavirus
2231688626639407545; 3; False; 1580258037; Super Junior has donated 10,000 masks to China to help prevent the Coronavirus • • • • • • • • • • • • • #suju #sm #china #superjunior #coronavirus
2231688609618363632; 0; False; 1580258035; CORONAVIRUS: ¿Qué es? Los #coronavirus son un grupo extenso de virus de ARN con envoltura viral comunes, pertenecen a la subfamilia taxonómica Orthocoronavirinae de la familia Coronaviridae. Dependiendo de cada tipo, los coronavirus pueden causar diversas #afecciones, desde el resfriado común hasta enfermedades más graves, como #bronquitis, #bronquiolitis, #neumonía, el síndrome respiratorio de Oriente Medio, síndrome respiratorio agudo grave, entre otros. Se llaman así por sus puntas en forma de corona en la superficie del virus. Algunos coronavirus solo afectan a los animales, pero otros también pueden afectar a los humanos. La mayoría de las personas se infectan con estos virus en algún momento de su vida, comúnmente en la infancia sin presentar mayores riesgos para la salud. Existe poca información sobre la transmisión, gravedad e impacto clínico y no existen tratamientos aprobados hasta la fecha, sin embargo se pueden tratar varios de los síntomas, las opciones terapéuticas dependen del estado clínico de cada paciente. Causas Los coronavirus se transmiten de forma limitada entre humanos, pero hasta la fecha se desconoce el origen de estos virus. En todo caso, se sabe que ciertos animales, como los murciélagos, actúan como reservorios. Como en otros virus que causan neumonía, cuando se transmiten en humanos, el contagio se produce generalmente por vía respiratoria, a través de las gotitas respiratorias que las personas producen cuando tosen, estornudan o al hablar. Todo parece indicar que nuevo coronavirus, 2019nCoV, también conocido como coronavirus de Wuhan, tiene una procedencia animal. De hecho, los primeros casos se han relacionado con un mercado de animales vivos de la ciudad de Wuhan, en China Síntomas Secreción y goteo nasal. Tos. Fatiga. Dolor de garganta y de cabeza. Fiebre. Escalofríos y malestar general. Dificultad para respirar (disnea)
2231688590106474174; 0; False; 1580258033; Juntos podemos prevenir. :flexed_biceps: Con estas medidas logramos una Medellín saludable y libre de #CoronaVirus @alcaldiademed
2231688556610585045; 0; False; 1580258032; A luchar contra ese Virus tan Maligno. #coronavirus #corona #virus
2231684527546663441; 0; False; 1580258031; Semoga peristiwa ini juga memberikan pelajaran pada pemerintah China yang mengisolasi dan mengkarantina jutaan Muslim Uyghur di kamp-kamp konsentrasi dan kini terpaksa harus mengisolasi dan mengkarantina pula warganya sendiri di 12 kota karena mewabahnya virus Corona. Semoga wabah ini segera mereda dan tidak menyebar semakin luas. Semoga saudara Muslim kita dan penduduk sipil di negeri China dijauhkan dari wabah ini. Sumber: RFA-China, Science Alert, NY Times, Verter News, South China Morning Post, BBC Indonesia. #wuhan #coronavirus #viruscorona #china #tiongkok
2231688475416757136; 0; False; 1580258019; #Coronavirus II
2231682563194742238; 3; False; 1580258018; Issues of infectious disease were defining aspects of my service in the #PeaceCorps. I decided that when I returned to the US, I would devote every opportunity I might be afforded to the development of effective and accessible #vaccines. It’s been an honor and a privilege to learn from, and work alongside such a brilliant and diverse group of people at the Vaccine #Research Center (as well as our collaborators!). #vaccineswork #scientistswholift #coronavirus #science
2231688434716308989; 0; False; 1580258014; Aveces puedo tomar las mejores fotos, que no siquiera yo me lo creo :') #fotografías #lagrimitas #familia #coronavirus #dominar#al #mundo
2231688389032661773; 2; False; 1580258009; :warning:WARNING GRAPHIC IMAGES:warning: about the corona virus epidemic as the origin of the virus has been traced to the zone of the Wuhan market where live wild animals like snakes, rats, bats and monkeys were traded before China instituted a temporary ban yesterday. But a temporary ban is NOT enough, WE MUST use our social media platforms to spread awareness and BAN WILD ANIMAL TRADING WORLDWIDE as this is EXACTLY what caused the SARS virus that killed nearly 800 people in 2003! SARS was 17 years ago and yet these markets are doing the exact same thing, selling live wild animals in unhygienic conditions that create diseases with devastating consequences for the entire human race! This new virus, which has no vaccine, has killed 82 people with 2,887 confirmed cases in 15 countries, numbers which have increased 50% SINCE YESTERDAY and 60 million more people are on lockdown to prevent further spreading. Ban the trading of wild animals that create these deadly viruses! #coronavirus #endanimalcruelty #coronavirusoutbreak #karmagawa #explorepage #explore #news #memes #haircutfail #memevideo #dankmemevideos #memesdaily #edgymemes #relatable #meme #humor #offensivememes #funny
2231688363713652436; 0; False; 1580258006; The Department Of Health and Human Services is tracking the latest news and developments on novel #coronavirus If you suspect you have #novelcoronavirus, please phone the dedicated hotline on 1800 675 398. If you have concerns for your health please contact your local GP and ensure that you call ahead. Up-to-date information is available via the DHHS website: https://www.dhhs.vic.gov.au/novelcoronavirus In the event of an emergency please call 000 immediately.
2231688343639766923; 0; False; 1580258003; #coronavirus #coronavirusmemes #corona #china #chinamemes #ebolamemes #virus #wuhan #wuhanvirus #wuhancoronavirus #sneeze #cough #plaguedoctor #plague #ww3 #ww3memes
2231687982887690566; 0; False; 1580258002; Dalam bencana.. merinding denger orang2 bs saling menguatkan satu sama lain. Wuhan Jiayou! :beating_heart: Sending prayer to you all.. Semoga bencana ini cepat berlalu. This too shall pass!!! . #wuhanjiayou #wuhanaddoil #wuhan #fightcoronavirus . Reposted from @bbcnews Residents in Wuhan, China are shouting encouragement and singing songs from their apartment windows to boost morale amidst the coronavirus quarantine. :speaker_medium_volume: Wuhan is the centre of the deadly outbreak, and all 11 million residents have been advised to stay at home. Click the link in the bio to find out more. :backhand_index_pointing_up: #china #coronavirus #wuhan #bbcnews - #regrann
2231688329699401104; 0; False; 1580258002; Sejak beberapa hari kebelakang, semua warta berita sedang membicarakan virus corona. Virus yang merebak di Kota Wuhan, Provinsi Hubei, China tengah menjadi sorotan dunia termasuk Indonesia sendiri. Sebab, sudah ada beberapa orang menjadi korban akibat virus berbahaya ini. Kita perlu waspada dan pastikan menghindari hal yang memungkinkan kita terkena virus ini. Dan jaga imunitas dengan mengonsumsi suplemen sebagai antibodi seperti K-Liquid Chlorophyll, K-Sauda VCO, Propolis, K-Vit C plus / K-C susu skim. Stay healthy semua!! . . . #klink #klinkindonesia #klinksolusihidupmu:heavy_check_mark: #klinkdigitalnetworkmarketing #klink17tahun #coronavirus #corona
2231683702811066317; 5; False; 1580258002; Scientists have found also protein codes in the virus similar to the one in snakes. . #coronavirus #batsoup #wuhan #wuhanoutbreak #coronaoutbreak #wuhanvirus
2231688273805577414; 0; False; 1580257995; El balance de la epidemia de neumonía viral en China registraba este martes un total de 106 muertos y más de 4.500 infectados en el país asiático, mientras se confirmó el primer caso de contagio en Alemania y la Organización Mundial de la Salud (OMS) elevó de "moderado" a "alto" el nivel de amenaza del letal coronavirus. El gobierno chino reportó la noche del lunes casi 1.300 nuevos contagios. En la provincia de Hubei (centro), donde comenzó la epidemia, las autoridades sanitarias afirmaron que el virus había causado 25 muertos más e infectado a otras 1.771 personas, lo que eleva el número de pacientes afectados a más de 4.000 en toda China. Oficialmente se reportaron 24 muertes en la provincia de Hubei, donde el virus fue detectado por primera vez en diciembre, y un fallecimiento en Pekín, la capital. Las autoridades anunciaron además el envío de unos 6.000 médicos al epicentro del brote para intentar contenerlo. Fuente: DW en Español . . . #china #china:China: #coronavirus #coronaviruschina #coronavirusoutbreak #francia #mexico #vietnam #coreadelsur #japon #estadosunidos #eeuu #brasil #epidemia #news #noticias #organizacionmundialdelasalud #oms #relacionesinternacionales #salud #ministerio #wuhan #enfermedad #epidemia #francia:France: #mexico:Mexico: #brasil:Brazil: #coreadelsur:South_Korea: #japon:Japan: #vietnam:Vietnam: #camboya:Cambodia:
2231688192586431918; 0; False; 1580257985; #Repost @leangreenie ・・・ If not for your health, if not for our planet, if not for the animals then FOR WHAT? . Farmers are literally burning the lungs of our planet to clear land for cattle in the Amazon rainforest. 1 billion wildlife were killed in the Australian fires because of climate change worsening the drought, we then culled 5,000 camels because they were "drinking our water". Now we see the Coronavirus, caused by consuming and handling dead animals. . The most powerful single thing you can do to help our environment, our health and the animals is shift to a vegan diet. . . . . . . . #animalagriculture #coronavirus #amazonfires #fire #bushfires #animals #animal #australia #australian #australianfirefighters #australianfires #endsuffering #endexploitation #speciesism #animalliberation #animalactivist #animallovers #vegetarian #vegan #veganism #leangreenie#govegan #veganlove #crueltyfree #vegansofig #veganlife #vegan #animallover
2231688178485252729; 7; False; 1580257983; Que miedito y que misterioso :face_screaming_in_fear: Sígueme para mas! @teoriasduh :tired_face: Ustedes que dicen? Sigueme @teoriasduh . . . . . . . . . . #frasesdeamor:red_heart: #horasad #textosdeamor #falsasamistades #coronavirus #conspiraciones #conspiracion #videossad #memessad #escritoresdeinstagram #viralvids #sabiasque #datointeresante #curiosidades:light_bulb: #datocuriosos #teoriasconspirativas #teoria #calentamientoglobal #viralizalo #terroriser
2231688156507243424; 0; False; 1580257981; #coronavirus I
2231688152112127959; 0; False; 1580257980; Rebuilt. >>> 2014.5 Shangri La in Yunnan, China had a massive fire in January 2014 which burnt about 60,000 sqm of houses mostly made of wood in the old town. Tragedies like such was devastating but it was amazing also to see how fast people recovered from it and rebuilt what they have lost. In this Chinese New Year in China, it’s as much pain around if not less than any other disasters. #coronavirus is the only thing that people care and talk about, as it should be. As annoying as it could be with the challenges of lack of fresh food, supplies like masks, I’d say it’s harder to deal with the panic and the change of the routines. I have no doubt that we will put this behind us eventually and move on with our lives. Just as everything else, good or bad, people forget and move on to the next thing. Things will be rebuilt, will people too? #prayforwuhan #damagecontrol #disasters #difficulttimes #documentaryphotography #thoughts
2231687487541262980; 159; False; 1580257980; Kirby Viajero pt. 2 :person_gesturing_OK: - YEPAAA... La bola rosada sigue viajando por el mundo y cada vez se pone más exigente... Yapo kirby ta weno ya. Está demás decir pero no se ofenda que solo es un mim :oncoming_fist::smiling_face_with_sunglasses: ¿Qué creen?, Kirby viajará de nuevo o seguirá siendo un pesao joder macho... - #shitposting #shitpost #dankmemes #chileandankmemes #kirby #XD #coronavirus #dou #leanen404jaj #yepa #youtubers
2231688078400102727; 0; False; 1580257972; ¿Cómo se contagia el #coronavirus? Aunque inicialmente se pensaba que el #contagio se daba sólo de animales a humanos, ahora sabemos que se puede contagiar de persona a persona, a través de: :handshake: Contacto de una persona infectada con una o más personas sanas (tocar, estrechar la mano). :wind_face: Por el aire, al toser o estornudar. :prohibited::raised_hand_medium-light_skin_tone::droplet:Tocarse la nariz, la boca o los ojos sin lavarse las manos, después de haber estado en contacto con superficies infectadas. :pile_of_poo: Contacto con heces fecales contaminadas (poco común). - Recientemente se ha sabido que también se contagia durante la fase de incubación, mientras la persona todavía no ha desarrollado los síntomas. . . ¿Cuáles son los #síntomas? Este #virus produce infecciones de las #viasrespitarorias, presentando síntomas de un resfriado común, por lo que se les puede confundir en un inicio, aquí te indicamos cuáles son:backhand_index_pointing_down:: :sneezing_face: Secreción nasal :face_with_head-bandage: Dolor de cabeza :face_with_medical_mask: Tos :face_screaming_in_fear: Dolor de garganta :face_with_thermometer:Fiebre :fearful_face: Malestar general - En su etapa más grave puede convertiste en #bronquitis o #neunomía causando síntomas como: :face_with_thermometer: Fiebre muy alta, si tiene neumonía. :sleepy_face: Tos con flema. :face_with_steam_from_nose: Falta de aire o dificultad para respirar (disnea). :weary_face: Dolor u opresión en el pecho al respirar y/o toser. - Los síntomas más graves (y la mayor mortalidad) se registran tanto en personas mayores como en aquellos individuos con inmunodepresión o con ·enfermedades crónicas como #diabetes, algunos tipos de #cáncer o enfermedad pulmonar crónica. - #epidemia #Wuhan #atencionmedica #cuarentena #alerta #epidemiologia #salud #saludpublica
2231688049142455277; 0; False; 1580257968; Tahmin edilenden daha hızlı çoğalıyor ve gelişiyor. #corona #coronavirus
2231687928638545903; 0; False; 1580257954; Shanxia, una enfermera en el Hospital Renmin de #Wuhan , se afeitó todo el cabello mientras trabajaba en la primera línea de la lucha contra el #Coronavirus . Explicó que esto la ayudaría a ahorrar tiempo al ponerse la ropa protectora y evitar infecciones cruzadas. La foto fue publicada en la cuenta de Twitter @Echinanews, un diario chino. #RNN #RNN27 #NoticiasRNN #RedNacionalNoticias
2231687834879941627; 0; False; 1580257943; i vostri ordini da wish stanno arrivando... :microbe: #coronavirus #virus #wuhan #china #viruscinese #cina #eurodance #90s #gaymemes #memes #dankmemes #blackhumor
2231687830149926557; 1; False; 1580257942; Stay safe :face_with_medical_mask: - 1) Wuhan Coronavirus is transmissible even if a host does not present symptoms 2) so avoid crowded places 3) Germany just reported its first case of corona virus in someone who had never visited Wuhan so this means it’s communicable, evolving and transmitting 4) There’s a possible connection and leak from a bioweapons research hub in Wuhan due to the virus’ abilities to survive on surfaces for days and spread during an asymptomatic period 5) If you feel sick, be considerate and wear a mask 6) Not to panic you, but ground sources in China are claiming the outbreak js much much worse than what is being reported/released to the international community | This picture is from my trip to East Asia a couple years ago. Looks and feels scifi but now it feels real.
2231687717859527297; 0; False; 1580257929; Uh oh - - - #meme #dankmeme #fortnitememes #memesdaily #dailymemes #funnymemes #hilariousmemes #hilarious #funny #meme #dankmeme #transformers #transformersmemes #kobebryant #coronavirusmemes #coronavirus #corona #straya #bayverse #transformersbayverse #transformersrotf #gdaymate #geewun #g1 #tfmemes #autobots #decepticons #starwars #starwarsmemes #starwarsnerd #starwarsfan
2231687716558674733; 0; False; 1580257928; Rasulullah shallallahu ‘alaihi wa sallam bersabda: مَا أَنْزَلَ اللهُ دَاءً إِلَّا أَنْزَلَ لَهُ شِفَاءً “Tidaklah Allah menurunkan penyakit kecuali Dia juga menurunkan penawarnya.” (HR Bukhari). . . Stay strong! #wuhanjiayou #wuhan #wuhanvirusoutbreak #coronavirus
2231687703338844664; 0; False; 1580257927; Coronavirüs salgını hakkında sosyal medyada yayılan tüm iddiaları bir araya getirdik. Çin'de yayılmaya başlayan coronavirüs bir çok insanın hayatını kaybetmesine neden oldu. Coronavirüs Çin dışına çıkmış ve Fransa, Kanada gibi onbir ülke de görülmüş durumda. Coronavirüsü hakkındaki çok ciddi iddiaları YouTube videomuzda izleyebilirsiniz iyi seyirler. #coronavirus #corona #sars #zika #salgın #mers #domuzgribi #kırımkongo
2231687688078020141; 0; False; 1580257925; 𝒄𝒓𝒂𝒗𝒆𝒔 𝒅𝒆𝒂𝒕𝒉 𝒍𝒊𝒌𝒆 𝒂 𝒔𝒏𝒂𝒄𝒌... ~ i know that this illness has been circulating for a while now but i want everyone to be safe!! ^^ ~ 𝒇𝒄: 51 𝒕𝒊𝒎𝒆: 7:32 pm 𝒅𝒂𝒕𝒆: jan 28 2020 ~ 𝒕𝒂𝒈𝒔 #meme #memes #niche #nichememe #nichememes #nichememeacc #nichememer #nichememeideas #nichememedaily #nichememecommunity #nichememers #nichememesdaily #nicher #aesthetic #red #orange #yellow #green #blue #purple #pink #multicolour #multicolor #pastel #grunge #coronavirus #awareness #coronavirusawareness #staysafe
2231687657109596575; 1; False; 1580257921; Pessoal, algumas pessoas estão preocupadas com o Coronavírus, principalmente quem está com viagem marcada. :face_with_medical_mask: Pois bem: não há motivos para pânico se sua viagem estiver marcada para a Itália. Pode viajar sem nenhuma preocupação. :raising_hands_medium-light_skin_tone: . . Como está a situação do Coronavírus na Itália? :confused_face: . . De acordo com o Ministério do Interior, na Itália a situação está sob controle e, segundo a Ministra do Interior Luciana Lamorgese, não há motivo para pânico. Três casos suspeitos foram registrados no país até agora: um em Pistoia, para qual os resultados dos exames deram negativos, e dois em Nápoles, sendo que um homem está com a suspeita do vírus enquanto sua esposa está internada somente por precaução, embora ambos estejam passando por exames. :neutral_face: . . As orientação para que a propagação do vírus seja evitada é lavar bem as mãos as cada duas horas, evitar aglomerações e, caso for espirrar ou tossir, que seja em um lenço descartável. :slightly_smiling_face: . . Os sintomas do Coronavírus são tosse seca, febre alta, dor de garganta e dificuldade para respirar - se você estiver com estes sintomas após uma viagem, vá até o hospital. :face_with_thermometer: . . A Itália está seguindo TODAS as orientações da OMS e, evidente, está atenta a qualquer suspeita; embora a OMS tenha declarado que o vírus é de ‘alto risco global’, as cidades chinesas mais afetadas estão sendo monitoradas, assim como as saídas do país. Muitas companhias de cruzeiro, por exemplo, já cancelaram seus próximos cruzeiros para a China. :face_without_mouth: . . O mapa do @inquirerdotnet mostra CASOS CONFIRMADOS, não suspeitos, ok?!? . . Fontes: imagem @inquirerdotnet / informações @ministerointerno e @who (OMS) #viajandoparaitalia #coronavirus #OMS #italia
2231687641848804569; 0; False; 1580257920; Jaga dan lindungi kesehatan diri kita :winking_face::winking_face: . . . #corona #coronavirus #apotek24 #apotikjogja #k24indonesia #apotekk24gejayan
2231687577039941353; 0; False; 1580257912; I'm sorry... - - - #meme #dankmeme #fortnitememes #memesdaily #dailymemes #funnymemes #hilariousmemes #hilarious #funny #meme #dankmeme #transformers #transformersmemes #kobebryant #coronavirusmemes #coronavirus #corona #straya #bayverse #transformersbayverse #transformersrotf #gdaymate #geewun #g1 #tfmemes #autobots #decepticons #starwars #starwarsmemes #starwarsnerd #starwarsfan
2231687578255654044; 15; False; 1580257912; Sorry for kinda only posting the corona virus related stuff :face_with_medical_mask:. • • • • • • #memes #dankmemes #offensivememes #offensivememes:sweat_droplets::eyes::hundred_points::face_with_tears_of_joy::face_with_tears_of_joy::gem_stone::fire::face_with_steam_from_nose::sweat_droplets::OK_hand::hundred_points::face_with_tears_of_joy::folded_hands::face_with_tears_of_joy::face_with_tears_of_joy::gem_stone::gem_stone::fire::face_with_steam_from_nose::sweat_droplets::eyes::eyes: #coronavirus #coronavirusmemes #coronavirusoutbreak #jasiahiam #nascaraloe #jasiah #travisbarker #twitter #twittermemes #freegage #subtogagegames53 #iloveyoumore #dippingmyballsinorangejuice #ripx #sexmeme
2231687563809504505; 0; False; 1580257910; La situación del ciudadano chino, de 49 años, quien es sospechoso de coronavirus es «crítica», hasta las 11:00 de este martes 28 de enero, informó el Ministerio de Salud Pública (MSP) en un comunicado difundido por la Secretaría de Comunicación. #coronavirus
2231687519308977084; 0; False; 1580257905; #maiortempestade #brumadinho #coronavirus #intoxicaçãodietilenoglicol Que tempos difíceis minha Minas Gerais está passando. Nada acontece por acaso, não há coincidências... Há sim dias de trevas sobre esta Terra que, há poucos anos, foi o lugar escolhido para uma visitação intensa de Deus e que trouxe um grande AVIVAMENTO (principalmente na adoração) para a nação Brasileira. Mineiros, voltem a cantar, dobrem seus joelhos e clamem pela intervenção do Senhor, para que a Luz resplandeça sobre as trevas e que a Glória de Deus possa triunfar sobre toda a opressão. Deus muda o destino pois Ele é o dono da história. Os céus se movem por meio das orações dos seus santos. . "E se o meu povo, que se chama pelo meu nome, se humilhar e orar, buscar a minha face e se afastar dos seus maus caminhos, dos céus o ouvirei, perdoarei o seu pecado e curarei a sua terra." 2 Crônicas 7:14 NVI . . * 1 ANO DA TRAGÉDIA DE BRUMADINHO (Minas Gerais contabilizou 228 mortes em decorrência do rompimento da barragem de rejeitos da mineradora Vale em Brumadinho / MG); . * A MAIOR TEMPESTADE da história da cidade de Belo Horizonte que registrou o maior volume de chuva em 24 horas. Houve a precipitação de 171,8 milímetros de água, que causaram mais de 50 mortes, até o momento; . * CORONA VÍRUS (O primeiro caso suspeito de incidência do coronavírus no Brasil é investigado em Minas Gerais); . * A quarta morte foi registrada por ingestão de substância tóxica encontrada em cervejas produzidas em Belo Horizonte. . . #bh #mg #intercessão #intercessores #intercessaoprofetica #transformação #godisgoodallthetime
2231687392431270813; 0; False; 1580257890; Day 2 of our Chinese food appropriation- I mean appreciation! Beef fried rice! Guaranteed no #coronavirus or #batsoup here!
2231687237072940607; 0; False; 1580257889; #coronavirus
2231687303678782947; 4; False; 1580257879; Os vírus de transmissão vinda por animais, como é o coronavírus, metafisicamente se relaciona com a maneira que as pessoas lidam com os seus impulsos. As forças instintivas e os ímpetos naturais, são reprimidos e bloqueados frente aos acontecimentos. Segundo Freud, o convívio em grupo exige a repressão dos impulsos naturais dos indivíduos. Essa contenção e/ou negação dos instintos diante das adversidades, metafisicamente torna as pessoas vulneráveis aos contágios de vírus provenientes dos animais. Ao serem tomadas por essas forças instintivas, que não podem ser extravasadas, surge uma espécie de fúria interior, que provoca metafisicamente a baixa a imunidade, expondo o corpo ao contágio. Obviamente, esse sentimento é frequente entre as pessoas que ficam indignadas com certos acontecimentos, revoltadas e sem poderem fazer nada para conter ou evitar tais absurdos. Elas têm vontade de se comportarem de maneira bem exageradas, mas não podem e ficam caladas, reprimindo as suas emoções. Dessa forma são desenvolvidos os padrões metafísicos que podem atrair tais contaminações. No entanto, é preciso estar expostas a animais infectados e nem sempre isso acontece; mesmo existindo muitas pessoas ao redor do mundo com esses padrões, os contágios surgem de maneira pontual e localizados. Quando surgem essas epidemias, elas se alastram, metafisicamente contaminando as pessoas que cultivam o padrão emocional causador das doenças, podendo se tornar um surto mundial. Assim sendo, segundo a metafísica, o tal vírus é a repressão dos instintos, a confusão interior, levando ao desânimo. . :backhand_index_pointing_right:O atual cenário da crise entre o os EUA e o Irã, tem tomado maiores proporções, causando temor na população mundial. Eventos assim mexem com o impulso das pessoas deixando-as frente ao temor ou revoltadas com estas ações, sem condições de manifestarem quaisquer reações. Esses sentimentos podem desencadear os padrões metafísicos que favorecem do contágio dessa epidemia, que se alastra pelo mundo. . No próximo post iremos falar sobre prevenção metafisica para nós protegermos deste vírus. . Fonte: Valcapelli, site #metafisica #coronavirus #metafisicadasaude #saudequantica #cura #físicaquantica
2231687234642047247; 0; False; 1580257871; This is how conspiracy theories start... Chinese biotech logo same as the Umbrella Corp logo from Resident Evil, and now logo removed from their website. Corona is an anagram to Racoon (eg Racoon City). How about October 2019 the Centre for Health Security ran an exercise about a world response to coronavirus outbreak and by 20 months in the projected death toll was 150 million poeple. Or how about 2 of the Chinese scientists that in 2015 successful mixed Corona Virus from horseshoe bat's with Sars to make it capable of infecting humans work in a biosafety level 4 (the highest setting world wide) laboratory just 30kms from the source city of the outbreak..#outbreak #coronavirus #china #umbrellacorporation #racooncity #wuhan #pandemic #horseshoebat #centreforhealthsecurity #billgates #rlsw #biotech #shanghai #conspiracy
2231687206691313461; 2; False; 1580257868; Sad peace sign :disappointed_face::victory_hand_light_skin_tone: Stay safe everyone #coronavirus Another accidental matching outfit. lol...
2231687158448901621; 0; False; 1580257862; Badminton pro #likeforlike #badminton #olympics #wilson #sports #asia #coronavirus #china #wuhan
2231687159782689096; 0; False; 1580257862; Hmmm...quite a coincidence... #coronavirus
2231687110086388752; 0; False; 1580257856; Indonesia dan negara-negara lain masih menunggu pertimbangan maupun saran pemerintah RRT (Republik Rakyat Tiongkok) dalam rangka melakukan tindakan evakuasi terhadap warga negara yang berada di Wuhan. Pemerintah indonesia hinggi kini terus tanggap terhadap keberadaan 93 WNI di Wuhan, Cina dengan emmasok logistik dan mendirikan posko di Changsa, provinsi Hunan #wni #wuhan #coronavirus #corona #china #RRT
2231687108619947053; 1; False; 1580257856; Rekaman video yang menunjukkan seorang turis asal China mengamuk gara-gara harus menjalani serangkaian tes untuk mencegah masuknya virus Corona dari Wuhan di Bandara Senai, Malaysia.Melansir dari World of Buzz, Senin 27 Januari 2020, turis tersebut tampak ditempatkan di sebuah ruang. . Kemungkinan besar untuk menjalani screening dari otoritas bandara. Terlihat di video itu, dia menggedor dinding kaca yang ‘mengurungnya’. . Bukan cuma itu, dia bahkan mencoba untuk memanjat dinding kaca tersebut guna menarik perhatian otoritas Bandara Senai, Distrik Kulai, Johor, Malaysia. Tak pelak, polah turis tersebut membuat geger bandara. . Sekadar informasi, Malaysia kini berada di tengah kekhawatiran besar masuknya wabah virus Corona dari Wuhan, China. Alhasil, sejumlah alat screening ditempatkan untuk menyasar turis-turis yang datang dari negara tersebut. . Artikel : Makassarterkini.id #wuhan #coronavirus #wuhanvirus Lihat Info menarik dan terbaru lainnya di @nih.info . . . . #faktaindo #beritaindonesia #berita #fakta #beritanasional #infoindonesia #infoterkini #beritaterbaru #infoterbaru #beritaterkini #beritajakarta #infojakarta #faktaterkini #videoberita #beritahariini
2231687108409780091; 0; False; 1580257856; Untung bukan urusan saya " " " " #sujiwotedjoquotes #sujiwotedjo #caknunvideo #leterasi30detik #puisi #puisicinta #puisigalau #narasi #narasitv #prabowo #jokowi #mobilelegendsindonesia #pubgindonesia #munir #wijitukul #filosofi #jokowi2periode #corona #coronavirus #hmi #gmki
2231687002670023391; 0; False; 1580257843; #Repost @who • • • • • • Here are some facts about the new #coronavirus (2019-nCoV) #MythBusting
2231686975685215733; 2; False; 1580257840; #SonDakika Koronavirüsü kapanlardan 1,239 kişinin durumu kritik #corona #coronarvirus #koronavirus #virüs #deprem #çin #Wuhan #türkiye #almanya #istanbul #izmir #adana #gaziantep #salgın #hastalık #coronavirues #CoronaVirus #takipçikazan #gt #antalya #trabzon #afad #haber #SonDakika #aztagram #followme #likeme #video #mizah #çin . Dünya'da Olan En Güncel Olay ve Gelişmelerden herkesten önce haberdar olmak istemezmisiniz? @reflexhaber Bizi Takip Edebilirsiniz.
2231686861508491194; 0; False; 1580257831; . . . . . . . . . . . . . . . . Sigueme . . . . . . . . . #meme #memes #chileanmemes #chileandankmemes #chile #dank #jaidefinichon #ricardomilos #dylanteromeme #coronavirus #help
2231686892997502648; 0; False; 1580257830; Um novo tipo de coronavírus, até então desconhecido, surge na China, infectando milhares de pessoas (5.578 até agora), causando um número significativo de mortes (131). . Essas epidemias sempre geram muito pânico ao redor do mundo, especialmente porque a movimentação de pessoas, e consequentemente, dos vírus, é muito rápida. Hoje de manhã eram 16 países com casos confirmados da doença, agora à noite, são 18. . No Brasil, atualmente, estamos lidando com 3 casos suspeitos, todos relacionados a viagens à China. . Mas o que isso tem a ver com Segurança de Alimentos? Bem, primeiramente, TUDO! . O hábito dos chineses de comercializar animais vivos em feiras, comercializar carnes e pescados em temperatura ambiente, somados à constante aglomeração de pessoas nessas feiras é um prato cheio pra um micro-organismo “se transformar” e se adaptar ao corpo humano. . Mas ATENÇÃO! Encontramos essas feiras, com carnes e outros produtos de origem animal sem procedência ou mal acondicionados, facilmente aqui no Brasil! . Sabe aquele queijo colonial cheio de furinhos irregulares? Aquele salame úmido, que ainda não tá bem maturado? E aquele mel no vidro de café? Sabe quando é bem baratinho, abaixo do valor de mercado??? Produtos clandestinos. Eles podem esconder vírus, bactérias e todo tipo de perigo à saúde humana. . #saudenamesa #alimentoseguro #foodsafety #coronavirus #fiscalizacaosanitaria #inspeçãosanitária #boaspraticasdefabricacao #boaspraticasdemanipulação #china #vigilanciasanitaria #restaurante #restaurantesportoalegre #bareserestaurantes #alimentosebebidas #meritoconsultoria
2231686882554932629; 0; False; 1580257829; Day 1 of our Chinese food appropriation- I mean appreciation! Garlic chili chicken, jasmine rice, and brocolli. Guaranteed no #coronavirus or #batsoup here!
2231686842464804749; 0; False; 1580257824; Prevention is better than cure! Stay safe and healthy guys... :face_with_medical_mask: #nCov #CoronaVirus
2231686755819716937; 0; False; 1580257817; Kami dah kembali beroperasi. . Untuk tempahan dan pertanyaan boleh dm/call/wasap 0183934415 . #bygangsisters #marukukecorrr #nuh2020 #sepahtureunion2020 #murukuborong #murukuborongmurah #nakubahhidup2020 #coronavirus
2231686732708090228; 1; False; 1580257811; :police_car_light::SOS_button::police_car_light: #coronavirus #china #brazil #brasil #wuhan #pequim #guangdong #virus #viruschina2020 #globo #g1 #g1globo #Sars #jornaldobrasil
2231686716671049362; 0; False; 1580257809; #coronavirus #shanghai #metro #shanghairailwaystation #beijing #sanlitun #maskn95 #jirco #beijingsouthrailwaystation #panic #nopeople #nodrama #enlacuerdafloja #pandemia #epidemia
2231686684677071383; 0; False; 1580257805; “Villages are sealing themselves off in China, blocking roads and building walls to protect against outsiders.”⁣ ⁣ Video from Sky News.⁣ ⁣ #news #breakingnews⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣ #worldnews⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣ #coronavirus #wuhanvirus #wuhancoronavirusoutbreak #WuhanCoronavirus⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣ #coronavirusoutbreak #corona #ncov2019 #ncov⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣ #武漢肺炎 #武汉疫情⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣ #China #Wuhan⁣⁣⁣⁣⁣ #StandWithWuhan⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣ #LunarNewYear #NewYear #SpringFestival⁣⁣ ⁣⁣⁣
2231686598792445653; 5; False; 1580257795; En las redes sociales aparecieron fotos del mercado de mariscos Huanan, en la ciudad china de Wuhan, antes de que se clausurado por las autoridades el 1 de enero, bajo la sospecha de ser la fuente de origen del nuevo coronavirus. . El mercado es famoso entre los locales por la venta de una amplia variedad especies de animales, que van desde insectos hasta cachorros del lobo y especies cuya venta es ilegal. . Según las autoridades, las ventas ilegales suceden en medio de pésimas condiciones de salubridad: pisos y paredes llenos de tierra y salpicadas de sangre. . En Huanan se podía encontrar carne de alrededor de 112 diferentes especies animales como civetas (un mamífero carnívoro que habita la India y el sur de China), zorros, salamandras, pavos reales, ratas, cachorros de lobo, cocodrilos y puercoespines, entre otros, según rescribió RT. . Las imágenes muestran gran variedad de comercios ilegales de animales, incluidos puercoespines y koalas encerrados en pequeñas jaulas. . El último balance de víctimas por el coronavirus fue confirmado por autoridades chinas: hay 81 personas fallecidas y más de 2.800 infectados. . Fuente: iprofesional.com . #Repost @miaminews24 ・・・ #información #news #noticias #miami #EstadosUnidos #EE.UU #2020 #wuhan #china #coronavirus #huanan #mercado #virus #OMS
2231686541346885201; 0; False; 1580257788; #coronavirus
2231686490813957954; 0; False; 1580257782; Corbola Follow @eastern.odie . . . #dankmemes #coronavirus #ebola #dankmemesdaily #meme #memes #memes:face_with_tears_of_joy: #hahaha #:face_with_tears_of_joy: #:rolling_on_the_floor_laughing: #stolenmemes #oc #funnymemes #reddit #pewdiepie #anime #disney #smallmemepage #dailymemes #follow #followers #likeforlikes #lmao #rofl #tiktok #lol #xd #halariousmemes #shitpost #autisticmemes
2231686452396469615; 2; False; 1580257778; #dankmemes #memeaccount #dankmemesdaily #memedaily #vans #darkhumormemes #darkhumor #niggalations #china #coronavirus #slutsk #hoe #selfiewhore
2231686309378581495; 0; False; 1580257761; In typical me fashion I have ended up in a conspiracy theory about #CoronaVirus this almost definitely maybe probably right. #contagion style manufactured bio-warfare China on China friendly fire test, and far better than Bill Gates trying to get one up on #anti-vaxxers.
2231686165589012791; 0; False; 1580257760; @kobebryant Kral :collision::collision::collision::collision::basketball: . . . #kobe #bryant #kobebryant #abd #basketball #basketbol #nba #kral #king #iyigeceler #istanbul #ataşehir #iyiuykular #kendi #gibi #zor #hadi #gt #dm #beğeni #good #öldü #coronavirus #onel #lebron #jorden
2231686259248960297; 0; False; 1580257755; Let’s not cause panic and encourage hysteria. Follow credible sources such as the @who for information and new developments re the corona virus #coronavirus #stayinformed #aDoptEvent
2231686225794117907; 0; False; 1580257751; Several months ago, when still living in China , I penned this ink #corona before awareness that it could exist and jump existence between species, traveling through the fabric of time, space and sputum or bodily fluids. #art #ink #artscience #contemporaryart #dots #artistsoninstagram #penandink #mitlistarts #coronavirus #igart #igartist #awareness #sciartinitiative
2231686216717501273; 0; False; 1580257750; #humor #coronavirus
2231686153728518938; 0; False; 1580257742; Erstmaliger Ausbruch des Virus am 31.12.2019 in #Wuhan. 27 Menschen erkrankt, 7 schweben in Lebensgefahr. Am 11.01 offiziell 41 Infizierte. Unter Ihnen das erste Todesopfer. Der 19.01 verzeichnete erste #Infektionen außerhalb Chinas. Die Zahl der Infizierten steigt auf 62. Am 21. Januar stieg die Anzahl Infizierter auf 308. Am 23. Januar sagte Peking die großen #Neujahrsfeiern ab & bis zum 25.01 gab es rund 1300 gemeldete Infektionen & 41 Todesfälle wodurch die Regierung Chinas Gruppenreisen im In- und Ausland verbot. Bis zum 26.01 betrug die Zahl der Infektionen 2000 weltweit, wohin gegen die Anzahl infizierter alleine in China gestern sprunghaft um 1700 auf 4500 anstieg. Angesichts der rasanten #Ausbreitung des neuartigen #Lungenvirus bot die USA China „jede erdenkliche Hilfe an. Bis heute sind mehr als 100 Menschen durch das #Coronavirus gestorben & 3 weitere Menschen haben sich in Deutschland infiziert. In der wegen des Coronavirus abgeriegelten Stadt #Wuhan wurde eine #Klinik für bis zu 1000 Patienten in 10 Tagen gebaut. China ähnele nun einem „apokalyptischen Katastrophenfilm“, da der Ursprungsort des Erregers „Wuhan“ zurzeit eine #Geisterstadt ist. In China werden wegen des Coronavirus ‘ drastische Maßnahmen ergriffen. In der Provinz Hubei wurden 45 Millionen Menschen in mehr als einem Dutzend Städten weitgehend von der Außenwelt abgeschottet. Flüge sowie Fern- und Nahverkehr wurden gestoppt. Auch andere Regionen haben den Überlandverkehr von Bussen und einige Zugverbindungen gestrichen. Die Regierung verlängerte zudem die Ferien über das laufende Neujahrsfest hinaus. Quellen https://bit.ly/2GyqN20 https://bit.ly/2GxpBvS https://bit.ly/38NYzg0 https://bit.ly/2RyzPlW https://to.pbs.org/37BqFLc https://bit.ly/36CZazs https://bit.ly/36AeQ6P https://bit.ly/2RVhJd6
2231686123461915049; 3; False; 1580257738; ALERTA VERMELHO! #Repost @dr.biosseguranca with @make_repost ・・・ 3 simultâneos Casos suspeitos de #coronavirus aqui no Brasil. Vamos ficar atentos :eyes: #biossegurança . G1 :backhand_index_pointing_down: O Ministério da Saúde anunciou na tarde desta terça-feira (28) dois novos casos suspeitos do coronavírus 2019-nCoV, um em São Leopoldo (RS) e outro em Curitiba (PR). Mais cedo, o governo havia noticiado a investigação de um caso em Belo Horizonte (MG). Inicialmente, o ministério disse que o possível caso no Rio Grande do Sul havia sido registrado em Porto Alegre, mas uma atualização mostra que ocorreu em São Leopoldo, região metropolitana. A notificação à pasta federal que foi feita pela Secretaria de Saúde da capital gaúcha. Fonte: G1
2231686069506491471; 0; False; 1580257732; Melansir dari Washington Post, Selasa (28/1/2020), staf medis di sana bahkan harus mengenakan popok karena tak memiliki waktu untuk pergi ke toilet. Ya, banyaknya pasien membuat mereka bahkan tak bisa meluangkan waktu setidaknya 5-10 menit untuk pergi ke toilet. . Tak hanya itu, mengenakan popok juga memudahkan mereka agar tak berulang kali melepaskan baju hazmat yang mereka kenakan saat menangani pasien terjangkit virus corona. . Belum lagi, butuh waktu yang tak sebentar untuk mengenakannya kembali. Ini juga bisa membantu mereka agar tak boros dalam penggunaan perlindungan seperti baju hazmat, masker dan kacamata pelindung. . "Kami tahu bahwa pakaian pelindung yang kami kenakan mungkin akan menjadi yang terakhir yang kami punya dan kami tak bisa bersikap boros," kata seorang dokter yang bertugas di Rumah Sakit Wuhan Union. . Artikel : liputan6.com #wuhan #coronavirus #wuhanvirus Lihat Info menarik dan terbaru lainnya di @nih.info . . . . #faktaindo #beritaindonesia #berita #fakta #beritanasional #infoindonesia #infoterkini #beritaterbaru #infoterbaru #beritaterkini #beritajakarta #infojakarta #faktaterkini #videoberita #beritahariini
2231685136315689791; 1; False; 1580257727; Mejor compro en otro lado :grinning_face_with_sweat: :hugging_face: memes diarios. :clapper_board: vídeos divertidos :smiling_face_with_sunglasses: compártelos :man_and_woman_holding_hands: etiqueta a tus amigos! :heart_suit: y dale “me gusta” #videosvirales #videosderisa #risas:face_with_tears_of_joy: #solamenteyo:grinning_face_with_sweat::victory_hand: #mexico #colombia #chile #ecuador #argentina #buenosaires #venezuela #españa #uruguay #uruguayo #uruguay:Uruguay: #bolivia #uruguaya #argentinas #videosdehumor #video #hombres #mujeres #viral #chino #coronavirus #memes #plantillas #perros #videosderisa
2231686009752723465; 1; False; 1580257725; Así no me sorprendas 2020... :face_with_rolling_eyes::exploding_head::face_screaming_in_fear::face_with_medical_mask::face_with_medical_mask::face_with_medical_mask::face_with_medical_mask::face_with_medical_mask::face_with_medical_mask::face_with_medical_mask:@ⓅⒺⓃⒹⒺⒿⒶⒹⒶⓈ➃Ⓤ#humor #chistes #bromas #memes #momos #funnymemes #lol #coronavirus #2020sorprendeme #alv #allyouneedisgoodjokes #pendejadas4u
2231685910357200137; 0; False; 1580257713; #Internacionales - La compañía #Disney cerró todas las instalaciones de Disneyland Shanghai a partir de este 28 de enero, "como medida de precaución en línea con los esfuerzos de prevención que tienen lugar en toda #China", para evitar contagios por el #coronavirus.
2231685858734283521; 0; False; 1580257707; Pemerintah Jepang baru saja mengkonfirmasi dua kasus baru virus corona. Salah satunya termasuk seorang sopir bus wisata yang belum pernah ke kota Wuhan di Cina tengah. Seperti diketahui, wabah virus mematikan ini dimulai di pasar makanan laut dan unggas. Temuan ini membuat jumlah total infeksi yang dikonfirmasi di Jepang menjadi enam kasus. . Seperti dilansir SCMP, Sopir bus berusia 60-an mengendarai dua kelompok turis Tiongkok dari Wuhan awal bulan ini, kata menteri kesehatan Jepang Katsunobu Kato. Pengemudi tinggal di kota Nara. . Meski demikian hingga kini Kementerian Kesehatan jepang tidak dapat berkomentar lebih jauh tentang kasus baru ini. Menurut data World Organization, per 27 Januari 2020 secara global sebanyan 2798 dikonfirmasi. Di China sendiri terdapat, 2741 kasus yang dikonfirmasi dengan estimasi 5794. . Sebanyak 461 dinyatakan dalam parah dan 80 di antaranya meninggalDi luar China, sebanyak 37 dikonfirmasi di 11 negara. Direktur Jenderal WHO Dr Tedros Adhanom Ghebreyesus kini tengah berada di Beijing untuk bertemu dengan pemerintah dan pakar kesehatan yang mendukung tanggapan tersebut. . Tujuan misi ini adalah untuk memahami perkembangan terkini dan memperkuat kemitraan dengan China, khususnya untuk tanggapan. . Perkiraan saat ini dari masa inkubasi virus berkisar 2-10 hari, dan perkiraan ini akan disempurnakan karena lebih banyak data tersedia. Memahami waktu ketika pasien yang terinfeksi dapat menularkan virus ke orang lain sangat penting untuk upaya pengendalian. . Informasi epidemiologis terperinci dari lebih banyak orang yang terinfeksi diperlukan untuk menentukan periode infeksi 2019-nCoV, khususnya apakah penularan dapat terjadi dari individu tanpa gejala atau selama periode inkubasi. . Artikel : Viva.co.id #wuhan #coronavirus #wuhanvirus Lihat Info menarik dan terbaru lainnya di @nih.info . . . . #faktaindo #beritaindonesia #berita #fakta #beritanasional #infoindonesia #infoterkini #beritaterbaru #infoterbaru #beritaterkini #beritajakarta #infojakarta #faktaterkini #videoberita #beritahariini
2231685817527766923; 0; False; 1580257702; I’m not sure how accurate this is...but regardless of the case, the fact that the actual number of confirmed/death cases are higher than the predicted is damn scary. I don’t care who or where you get your policies from, but aside from doing your best to avoid contact, if you don’t have one already, go get yourself life and critical illness insurance that you’ve been putting off for so long like YESTERDAY. Go talk to a friend or colleague who offers them. This is not about who offers the cheapest or who you like/trust the most. The important thing is that you get yourself covered NOW. #coronavirus #lifeinsurance #criticalillnessinsurance #financialplanning
2231685800448276593; 0; False; 1580257700; O Japão registrou mais três casos de coronavírus, aumentando o número de infectados para sete, informou o Ministério da Saúde do país na terça-feira (28). Um homem de 40 a 49 anos que mora na cidade chinesa de Wuhan, onde se concentra o surto, foi diagnosticado com o vírus em Aichi, o segundo caso registrado na província. Ele veio ao Japão no dia 20 de janeiro e apresentou febre três dias depois. Uma mulher da mesma faixa etária, residente em Wuhan, foi internada em Hokkaido, no norte do Japão, com sintomas de pneumonia. As autoridades de saúde confirmaram na terça-feira que ela é portadora do coronavírus. O primeiro caso de transmissão dentro do Japão ocorreu com um motorista de ônibus japonês que transportou dois grupos de turistas chineses de Wuhan, entre Tóquio e Osaka. Ele está internado em Nara, onde mora, segundo o Ministério da Saúde. Este também foi o primeiro caso de japonês infectado pelo vírus. Todos os outros seis pacientes são chineses que moram em Wuhan ou que residem no Japão e estiveram na cidade afetada pelo surto. Do total de sete infectados no Japão, dois tiveram o vírus descoberto em Tóquio, dois em Aichi, um em Kanagawa, um em Hokkaido e um em Nara. Na China, o surto já matou 106 pessoas e infectou mais de 4.500. Acesse o nosso site na seção de notícias > Japão para ler a matéria completa :backhand_index_pointing_right: www.alternativa.co.jp #alternativaonline #japao #coronavirus #aichi #toquio #kanagawa #nara #hokkaido #coronavirusnojapao
2231685789409159267; 0; False; 1580257699; Finally! :clapping_hands::clapping_hands::clapping_hands:. The two sides agreed that WHO will send international experts to visit China as soon as possible to work with Chinese counterparts on increasing understanding of the outbreak to guide global response efforts. #coronavirus #coronavirusoutbreak #wuhanvirus #news
2231683578222529516; 0; False; 1580257688; Que tristeza vale #venezia #coronavirus
2231685693302416639; 0; False; 1580257687; Investigadores de Hong Kong :Hong_Kong_SAR_China: advierten que el coronavirus está a punto de convertirse en una epidemia global. Estiman que unas 44.000 personas estarían infectadas con ese microorganismo, muchas más de las que sugieren las cifras oficiales hasta el momento, publicó RT. :United_States: La Casa Blanca le comunicó a las aerolíneas estadounidenses que vean la probabilidad de suspender sus vuelos entre EEUU y China Alerta News 24 Según informes chinos :China:, han muerto 106 personas y más de 5 mil infectados :microbe:. #coronavirus #china #virus #wuhan #farmacia #salud
2231685603410197114; 0; False; 1580257686; Baru-baru ini viral sebuah video yang terjadi pada tanggal 27/01/2020 kemarin. Video itu terjadi di negara China terlihat di dalam video seorang pria yang diduga terkena virus corona dengan segaja membuka masker lalu bersin di depan perawat rumah sakit. #wuhan #coronavirus #wuhanvirus Lihat Info menarik dan terbaru lainnya di @nih.info . . . . #faktaindo #beritaindonesia #berita #fakta #beritanasional #infoindonesia #infoterkini #beritaterbaru #infoterbaru #beritaterkini #beritajakarta #infojakarta #faktaterkini #videoberita #beritahariini
2231685657105068606; 0; False; 1580257683; Reposted from @docmedia.co (@get_regrann) - #Docmedia . Coronavírus . Os coronavírus são uma família de vírus caracterizada por espículas na superfície que lembram uma coroa. Causam de quadros leves, semelhantes ao resfriado comum, a quadros respiratórios muito graves. As últimas epidemias provocadas por coronavírus foram a síndrome respiratória aguda grave (SARS) e a síndrome respiratória do Oriente Médio (MERS). . Em dezembro de 2019 foi identificada uma nova variante (2019-nCoV) na cidade chinesa de Wuhan, cuja provável transmissão ocorreu de um reservatório natural do vírus para o ser humano. O foco inicial da doença parece ser um mercado de frutos do mar. Suspeitas não comprovadas sugerem que o 2019-nCoV possa ser originário de morcegos. Além disso, o vírus é transmissível entre humanos e por contato com secreções aéreas contaminadas. Os dados sobre o contágio e a letalidade ainda não permitem conclusões e a evolução de epidemia deve ser acompanhada melhores conclusões. . Contudo, os últimos relatos já dão conta de 50.000 infectados e 106 mortes. Os infectados podem ser assintomáticos ou apresentar quadros respiratórios leves, até pneumonia viral severa e insuficiência respiratória. Até o momento não há vacina ou tratamento específico para os doentes, que devem ficar em isolamento respiratório e receber tratamento sintomático e de suporte. O diagnóstico da infecção é feito por biologia molecular em amostras de sangue para identificar o material genético viral. . A redução do risco de infecção deve ser prioridade e inclui evitar o contato com pessoas com sintomas respiratórios, lavar frequentemente as mãos em água corrente, utilizar lenços descartáveis na higiene nasal, cobrir a boca ao espirrar ou tossir, não compartilhar objetos de uso pessoal, evitar aglomerações humanas e não consumir ou ter contato com possíveis reservatórios do vírus. Até o momento não há casos de 2019-nCoV confirmados no Brasil. Técnicos afirmam existir sim o risco de uma epidemia global, mas só o acompanhamento da evolução poderá confirmar. . Para acompanhar os casos em tempo real: https://bit.ly/2tLBFqN . #docmedia #coronavirus #infectologia #saúde #medicina #epidemia - #regrann
2231685633137817872; 0; False; 1580257680; As of today, there are no coronavirus cases in the Philippines. You know why? Because we always wash our hands before we eat, we don’t wipe but we wash our butts each time we poop (not that it is connected with the virus), we brush our teeth 3-4x a day (again, not that it is connected with the virus) and on top of these, Phils. stops issuing tourist visas temporarily to Chinese nationals to be safe. Keep it up Filipinos! Stay safe and healthy. Ang tindi ng immune system natin the best!:thumbs_up_medium-light_skin_tone: #philippines #coronavirus #coronavirusoutbreak
2231685606421603337; 0; False; 1580257677; It follows . If you saw me on explore then follow fool. Follow @crash_the_bikes1848 for more. Or don't. It's not like I am your stepdad forcing you to do things you don't wanna do. Unless ? . #meme #memes #bestmemes #instamemes #ww3 #funnymemes #dankmemes #offensivememes #edgymemes #batsoup #nichememes #memepage #funniestmemes #dank #memesdaily #cursedmemes #memesrlife #memestar #memesquad #plague #igmemes #memeaccount #china #relatablememes #coronavirus #nichememe #memetime #μιμιδιο #μιμιδιο_ελληνικο_ορθοδοξο #wwiii
2231685492612850350; 0; False; 1580257663; Voo do #boeing747 da #kalittaair evacuando cidadãos americanos de de #Wuhan , fr24 #wuhan #coronavirus #fr24 #flightradar24 #boeing #aviation #virus #wuhanvirus #aviaçao
2231685460040385264; 0; False; 1580257659; Coronavirus confirmed cases and deaths jump 1000+ and 20+, respectively, every day this week so far in China. Confirmed cases in Thailand jumped from 8 yesterday to 12 today in Thailand, and 4 to 7 in Japan. There is information from China saying the spread should not be too much wider anymore. Let’s hope it will come true. :folded_hands::folded_hands::folded_hands:#coronavirus #smartage @smartager
2231685398835876126; 0; False; 1580257652; :warning: Évitez de toucher les bars métalliques dans les transports en commun . #corona #coronavirus
2231685393501980742; 0; False; 1580257651; Jadi 'doctor' sekejap.. bersama2 kita mencegah Novel Coronavirus (2019-nCoV). Jaga kebersihan diri, pakai 'face mask' dan jgn lupa kerap cuci tangan. #naorielberaksi #coronavirus #sarawak #youtuber #20602
2231685218900927676; 0; False; 1580257631; Coronavírus. Informações sobre o que é, como é e cuidados! Compartilhe essas informações! @anvisaoficial #coronavirus
2231682448210950753; 2; False; 1580257617; marmota pingüe fascista #dylanteromeme #marmotaedionda #coño #ben10 #mortalkombat #frozono #coronavirus #plagueinc #oms #theend #thegame #dankmemes #bachata #pubg #cursedimages #shitpost #shitpostvideos #like4like #psuculia #nomaspsu #follow4followback #renunciacubillos #acab #fortnite #gretathunberg #elgoth #uwu #fff #summer #weed
2231684801451225609; 0; False; 1580257616; #china #chinatown #chinaglaze #chinalife #chinatravel #chinadoll #chinaairlines #chinagirl #chinagram #chinafood #chinatour #chinatownyvr #ChinamansHat #Chinalookingglass #chinaglazeofficial #chinainsider #chinaphotography #chinatrips #chinafashion #chinathroughthelookingglass #chinatownsingapore #chinaboy #chinaart #chinandega #chinalove #chinapainting #chinar #chinaeastern #chinapavilion #coronavirus
2231685050020318011; 0; False; 1580257611; Reposted from @inailonk Pagi2 minum Jamu dulu utk mencegah berbagai penyakit seperti flu pilek demam radang tenggorokan, autoimun, melancarkan haid, nyeri sendi, pegal linu, pusing dll . By. @inailonk Bahan : 1 ruas Jahe merah,iris 1 ruas Kunyit,iris 1 batang Sereh, iris 1 bh. Jeruk nipis, peras 200cc Air mendidih 2 sdm Madu . Cara : campur semua bahan dgn air mendidih, setelah airnya hangat tambahkan madu sesuai selera. . . . . . . . . . . . . . . . . . . . . . . . . . . #resepjsr #7dayschallengejsr#ibuonlinejsr #hidupsehatjsr #airnanojsr #minumansehat#testimonijsr #jurussehatrasulullah #kanker#coronavirus #jsr #Allahlagi#menu_jsr #obatherbal #airnanojsr #influenza #viruskorona #flu#flujsr #uploadkompakan#minumanjsr #kankerjsr #viruscorona#detoxwater #sehatdenganherbal#sarapan #obatherbal#jsr#resepzaidulakbar #promiljsr #zaidulakbar
2231685013849854832; 0; False; 1580257606; O Ministério da Saúde hoje confirmou um caso suspeito de Coronavírus em Minas Gerais. :play_button::play_button:Trata-se de uma paciente de 22 anos que apresentou sintomas compatíveis com a doença e esteve em Wuhan na China, chegando ao Brasil no dia 24 de Janeiro. :play_button::play_button:Agora a tarde o Ministério da Saúde foi notificado de mais dois casos suspeitos no Brasil de pessoas que estiveram na China. Os casos seguem em investigação! Fonte: saude.gov.br #minisaude #informação #conhecimentoétudo #coronavirus #transmissão #saude #doenças #enfermagemavançada #enfermagemempoderada #enfermeirosemformação #enfermagempedagogica #enfermagem #enfermeiro #enfermeira #nursenow #nurse #foco
2231684947194921307; 5; False; 1580257598; Durmam com esse barulho, se espirrar ja sabe ... ; ; @_playstation_noticias @officialredmars100 . . #coronavirus #china #memes #rpm #preppertalk #bronchitis #bacterialvaginosis #aids #dallas #repost #urbansurvival #beready #preppernation #virus #doomsdaypreppers #candidiasis #pandemic #preparedness #virologia #paragrafando #studygram #med #biomedicas #brucellosis #chikungunya #chickenpox #flu #hepb #hepatitise #thewitcher
2231684942815582389; 0; False; 1580257598; ALERTA :police_car_light: #Repost @dr.biosseguranca with @make_repost ・・・ 3 simultâneos Casos suspeitos de #coronavirus aqui no Brasil. Vamos ficar atentos :eyes: #biossegurança . G1 :backhand_index_pointing_down: O Ministério da Saúde anunciou na tarde desta terça-feira (28) dois novos casos suspeitos do coronavírus 2019-nCoV, um em São Leopoldo (RS) e outro em Curitiba (PR). Mais cedo, o governo havia noticiado a investigação de um caso em Belo Horizonte (MG). Inicialmente, o ministério disse que o possível caso no Rio Grande do Sul havia sido registrado em Porto Alegre, mas uma atualização mostra que ocorreu em São Leopoldo, região metropolitana. A notificação à pasta federal que foi feita pela Secretaria de Saúde da capital gaúcha. Fonte: G1
2231684865521267479; 0; False; 1580257589; Por si el #coronavirus #DentalHope #masvalePrevenimss #Aldoselfies
2231684851512924237; 0; False; 1580257587; Map of current situation as of January 28,2020. Map created by reddit user dearproject0⠀⠀ Follow us :backhand_index_pointing_right_light_skin_tone: @wuhanvirusnews ⠀⠀ ⠀⠀ ⠀⠀ #wuhanvirusnews #coronavirus #coronaviruses #coronavirusoutbreak #coronavirus2020 #wuhan #wuhanchina #china #coronaviruschina #wuhanvirus #outbreak #toronto #canada
2231684831967153255; 1; False; 1580257585; Akhlak kita baik, itu adalah hasil usaha kita memperbaiki hati. Hubungan kita baik dengan orang lain, itu adalah hasil memperbaiki hubungan dengan Alloh. Kejar akhirat, dunia akan mengikuti. . Follow @haifahiza_ Follow @haifahiza_ . Jangan lupa Klik link di Bio!! . . ____________________________________________________ #tauhiid #islam #rahmatanlilalamin #daaruttauhiid #aagym #dakwah #dakwahdigital
2231684830282938224; 1; False; 1580257584; This is the most recent update on Coronavirus from the Centers for Disease Control: Repost @cdcgov with @make_repost ・・・ While #CDC considers 2019-nCoV a serious situation and is taking preparedness measures, the immediate risk in the U.S. is considered low, based on what we know. Everyone should always take simple daily precautions to help prevent the spread of respiratory illnesses. Learn more at www.cdc.gov/nCoV. #publichealth #illness #respiratory #sickness • • • #consumersafetywatch
2231684828904941935; 0; False; 1580257584; Recuerda que en Ecuador no hay casos confirmados de #Coronavirus. Conoce varios tips que tenemos preparados para que tu estadía sea segura y placentera en el país de los cuatro mundos. ¡El Gobierno Nacional trabaja por tu salud y la de los ciudadanos y la de todos los visitantes! #PrevenciónEsSalud
2231684807095972649; 0; False; 1580257582; Ampunilah dosa kami Ya Allah..lindungilah kami dari malapetaka dan bencana.. #mybidara #doayangbaikbaik #wuhan #coronavirus #coronavirusoutbreak #china #pandemic
2231684755867185863; 0; False; 1580257575; Hello guys! I ada lagi 5 stock the ordinary niacinamide. RM32 ! Dm for order :person_gesturing_OK: #niacinamide #dropship #theordinary #skincare #malaysia #uitm #theordinarymurah #sayajual #coronavirus #alphaarbutin #theordinarymalaysia #murahmurah #bajukurung #2020 #readystock
2231684709663127164; 0; False; 1580257570; Royal army guard wearing a face mask as he stand guard at the entrance of the Istana Negara in Jalan Tunku Abdul Halim, Kuala Lumpur as precaution for Wuhan coronavirus. The disease has killed 131 people in China and sickened thousands more. - :camera_with_flash: Hasnoor Hussain / The Malaysian Insight • • • • • #wuhan #coronavirus #virus #plague #themalaysianinsight
2231684694345601424; 0; False; 1580257568; Good morning guys, I’m in stressful now while reading morning news of #coronavirus #corona because it’s very close, please take care yourself (put on mask in everywhere you go and wash your hands via alcohol 70-95% after touching everything in public) . . . . #ipad #ipad2019 #apple #pantone #mood #hand #selfie #mirrorselfie #happy #light #pantone #quotes #quoteoftheday #lightroom #vscocam #gay #gayboy #gaydaddy #gaysnap #instagay #wednesdaymotivation #wednesdayvibes #wednesdaywisdom #wednesday
2231684682558526255; 0; False; 1580257567; #Americans now being #evacuated from #China! #coronavirus
2231684648728486412; 0; False; 1580257563; Good morning guys, I’m in stressful now while reading morning news of #coronavirus #corona because it’s very close, please take care yourself (put on mask in everywhere you go and wash your hands via alcohol 70-95% after touching everything in public) . . . . #ipad #ipad2019 #apple #pantone #mood #hand #selfie #mirrorselfie #happy #light #pantone #quotes #quoteoftheday #lightroom #vscocam #gay #gayboy #gaydaddy #gaysnap #instagay #wednesdaymotivation #wednesdayvibes #wednesdaywisdom #wednesday
2231684645825432862; 1; False; 1580257562; O coronavírus originário da cidade chinesa de Wuhan já tem 4.583 casos confirmados no mundo, com 106 mortes, relata a rede CNN. A maioria dos casos confirmados está na China, 4.515, enquanto todas as mortes decorrentes da patologia foram registradas no território chinês. O segundo país com mais casos de infecção é a Tailândia, com 14. Na sequência, aparece Hong Kong com oito casos. No mundo, são 18 países com casos confirmados de infecção pelo coronavírus. Fora da Ásia, são cinco casos nos EUA; um no Canadá; três na França; e um na Alemanha. No Brasil, o Ministério da Saúde confirmou um caso suspeito em Minas Gerais. Uma mulher de 22 anos que esteve recentemente na cidade de Wuhan, na China, está hospitalizada em Belo Horizonte com sintomas que levantam suspeitas sobre possível contaminação pelo coronavírus. Wuhan é considerada o epicentro do surto do vírus no país asiático. Em um comunicado, a Secretaria de Saúde de Minas Gerais informou que, na sexta-feira, 24, a jovem foi atendida na Unidade de Pronto Atendimento (UPA) da região centro-sul de Belo Horizonte “com alguns sintomas respiratórios e febre baixa”. Matéria completa: Valor Econômico - Globo Siga a nossa página @Politizando_SF #china #coronavirus #saude #comunismo #belohorizonte #virus #lula #bolsonaro #bozo #moronacadeia #bolsolixo #asia #lulalivre #pcdob #haddad #psol #partidodostrabalhadores #esquerdavalente #salveoplaneta #politizando #politizandosf
2231684621036676376; 0; False; 1580257559; 여기서 사테 2급이 4마리 입니다. 코로나 걸리면 살처분인거 티비나와 아시죠 저 소독제도 못구하고 요새 상당히 예민합니다. 아줌마들 우리집 오면 저 돕니다. 오지마세요. 그리고 who머리가 중국인이라며 뭐? 심한 바이러스 아니야? 미쳤냐 중국인? #사이테스2급#사이테스#코로나#cltes#coronavirus#WHO
2231683870474742779; 0; False; 1580257545; Another video with people trying to escape from Quarantine Zone:exclamation_mark: :police_car_light:MAXIMUM SHARE:police_car_light: . #coronavirus #coronavirusoutbreak #virus #wuhan #wuhanvirus #coronaviruschina #wuhanchina #corona #coronovirus
2231684490474879566; 5; False; 1580257544; Reposted from @inailonk Pagi2 minum Jamu dulu utk mencegah berbagai penyakit seperti flu pilek demam radang tenggorokan, autoimun, melancarkan haid, nyeri sendi, pegal linu, pusing dll . By. @inailonk Bahan : 1 ruas Jahe merah,iris 1 ruas Kunyit,iris 1 batang Sereh, iris 1 bh. Jeruk nipis, peras 200cc Air mendidih 2 sdm Madu . Cara : campur semua bahan dgn air mendidih, setelah airnya hangat tambahkan madu sesuai selera. . . . . . . . . . . . . . . . . . . . . . . . . . . #resepjsr #7dayschallengejsr#ibuonlinejsr #hidupsehatjsr #airnanojsr #minumansehat#testimonijsr #jurussehatrasulullah #kanker#coronavirus #jsr #Allahlagi#menu_jsr #obatherbal #airnanojsr #influenza #viruskorona #flu#flujsr #uploadkompakan#minumanjsr #kankerjsr #viruscorona#detoxwater #sehatdenganherbal#sarapan #obatherbal#jsr#resepzaidulakbar #promiljsr #zaidulakbar
2231684487229774412; 0; False; 1580257543; I'm ready to the #coronavirus :face_with_medical_mask::cowboy_hat_face:
2231684468404536434; 0; False; 1580257541; Aamiin ya Rabbal Alamin :palms_up_together_light_skin_tone:⁣ •⁣ •⁣ ________________________________ Support My Partner Follow :backhand_index_pointing_right: @bapeercuy :grimacing_face: Follow :backhand_index_pointing_right: @bapeercuy :grimacing_face: . Follow :backhand_index_pointing_right: @bapergen :sad_but_relieved_face: Follow :backhand_index_pointing_right: @bapergen :sad_but_relieved_face: . Follow :backhand_index_pointing_right: @semangatdoa :palms_up_together: Follow :backhand_index_pointing_right: @semangatdoa :palms_up_together:________________________________ . . Nah, bagi anda yg sedang mencari gamis atau hijab dengan brand ternama bisa follow akun partner kami :backhand_index_pointing_right:@semangatmuslimahstore . . . #ustadabdulsomad #ustadabdulsomadlcma#dakwahku #ustadhandybony #ustadkhalidbasalamah #ustadzhananattaki #shalat #adihidayatlcma #ustadzsyafiqrizabasalamah #ustadzsyafiq #shalat #dakwahcinta #menikahmuda #hijrah #hijrahku #hijrahcinta #ustadfelixsiauw #dakwah #dakwahislam #renunganislam #ceramah #kajianislam#ceramahustadabdulsomad #aagym #tausiyahcinta #beraniberhijrah #tausiyahku #dakwahdalampuisi #viral #khitbah #coronavirus
2231683865500815784; 3; False; 1580257535; looks like a scene from a Hollywood movie ... #humanity #will #encouragement #wuhan #china #coronavirus
2231684017954945344; 0; False; 1580257534; Coronavirus. Explicación. #coronavirus #wuhan
2231682507282475871; 0; False; 1580257531; Holy smokes!! #optionstrading traders! The market shakes off #coronavirus like it was never a problem in the first place. . . #DDA #marketrebels Closed 2 gaps and looking like AAPL earnings is going to send us #moon #turnaroundtuesday #classictrading
2231684379972658205; 0; False; 1580257531; Sobe para três o número de pessoas com suspeita de Coronavírus no Brasil. O Ministério da Saúde confirmou no fim desta tarde desta terça, 28, que o Brasil tem três casos suspeitos de coronavírus. Além de uma estudante de 22 anos, que está internada em Belo Horizonte, mais duas pessoas têm suspeitas de portar o vírus. Uma delas está em Porto Alegre (RS) e outra em Curitiba (PR). Matéria Completa no link na Bio. #virus #ministro #coronavirus
2231683816769189941; 0; False; 1580257464; #卖面膜 #chinese #coronavirus #Sellmask DM please
2231683794692152951; 17; False; 1580257461; amiga pfv #uesurtando #oemputecido #osurtadasso #memedaminhavida #omusodoinsta #florzinhachata #paginalixo #oficial10barra10 #oatrapalhado #pensadorsincero #oficial1967 #nazareamarga #superiludido #migasualouca #memestwitter #umaesquinademarte #smsindelicado #apaixonadinha #piranhadeamor #aciumentassa #dramaticasso #umiludidao #maisa #larissamanoela #raissachaddad #memesbrasileiros #memesbrasil #memesbr #oestressadasso #coronavirus
2231682280093893772; 1; False; 1580257280; The coronavirus that originated from Wuhan, China is very contagious but mortality rate is just slightly higher than seasonal flu. Just wash your hands often and get lots of rest to strengthen your immune system. :) Stay healthy everyone.
2231681265189662747; 4; False; 1580257159; Fuck that ... I’m ready at all times ... #coronavirus #HellNo #TattooTheOne
2231669267299141956; 7; False; 1580255741; Coronavirus:anxious_face_with_sweat::face_with_tears_of_joy:. Tag your friends! - - - - #tiktokmuser #trending #trends #challenger #tiktokbox #tiktok_sea #slowmo #slowmovideo #musically #editsounds #audiosforedits #girls #tiktok #musically #oh #tiktokgirls #girlsvideo #bffs:red_heart: #videostarpresets #livetiktok #justfriends #friends #tiktokfunny #boyngirl #boyandgirls #musicallyapp #tiktok #tiktokfun #couple #comedy #fun #coronavirus
2231627348001085032; 0; False; 1580250732; Arrivederci :victory_hand: . . . . #ufc #mma #ufcmemes #mmamemes #bjj #brazilianjiujitsu #muaythai #boxing #kickboxing #karate #wrestling #judo #2020 #coronavirus #death #ohshit #fuck #holup #arrivederci #drake #danawhite
2231551097910427951; 7; False; 1580241685; Grandma: "Stop wearing weird stuff!"⁠ Me: "No." *Takes selfie* :camera::winking_face_with_tongue:⁠ .⁠ .⁠ .⁠ .⁠ .⁠ #LilCheekyBits #SpiritHood #BeYourself #LetMeTakeASelfie #Selfie #HelloKitty #CustomWork #CustomSpiritHood #Crafting #Create #Artist #Designer #Artisan #Sewing #Festival #FestivalWear #FestivalFashion #RaveGirls #Rave #RaveOutfit #FeelingFolksy #Craftsposure #Handmade #EDM #EdmLife #Costume #Sparkle #PinkHair #Vancouver
2231119926497026832; 37; False; 1580190243; ~ to live is to suffer, to survive is to find some meaning in the suffering ~ - friedrich neitzsche . . . . . . . . . . . #photography:camera: #photography #photoshoot #photographer #photograph #photographylover #gameoftones #gramslayers #Capture #orange #pmgridchallange #electicshotz #electic_shotz #igtones #igtonez5k #igtones5k #supremeshutter #gramslayers @supremeshutter @gramslayers #teamcanon @canonusa #hongkong #leadinglines #moodygrams #moodynaturelandscapes #lr #lightroom #night #longexposure #hk #night #yourshotphotographer #natgeoyourshot #coronavirus
2222058929638410436; 0; False; 1579110088; Source Naturals Wellness Fizz Fast-Acting Immune Defense Wellness Fizz supports the immune system with a powerful combination of herbs, antioxidants, vitamins, and minerals. This product gives your body a quick, efficient fizz of nutrients for a wellness intervention. Whether you are traveling and entering unknown environments, or if you need fast immune support, this great-tasting cocktail bubbles like a seltzer when taken in water, for a convenient, delicious immune supplement. Fruit Wafers Option Available: 10 Supplement Facts for Fruit Wafers Serving Size: 1 Wafer Calories 5 Sodium 290 mg Total Carb 1 g <2% Vitamin A (as beta-carotene) 5,000 IU Vitamin C (from ascorbic acid) 1 g Zinc (as zinc gluconate) 12 mg Vitamin E (as vitamin E succinate) 30 IU Selenium (as sodium selenite) 40 mcg European Elder Berry Extract (5% flavonoids) 200 mg Yin Chiao Extract (10:1) Complex 170 mg (Forsythia Fruit, Japanese Honeysuckle Flower, Platycodon Root, Chinese Mint Aerial Parts, Lophatherum Stem and Leaf, Chinese Licorice Root and Rhizome, Schizonepeta Aerial Parts, Soy Bean, Burdock Fruit, and Phragmites Rhizome) Echinacea purpurea Root Extract (1.5:1) 100 mg Elecampane Root Extract (4:1) 20 mg Boneset Aerial Parts Extract (4:1) 30 mg Horehound Aerial Parts Extract (4:1) 30 mg Isatis Root Extract (4:1) 20 mg Isatis Leaf Extract (4:1) 20 mg Suggested Use: Dissolve 1 wafer in 8 ounces of hot or cold water every 3 to 4 hours at the first sign of imbalance or before exposure to crowded environments such as offices, restaurants and airplanes. Do not exceed 4 wafers daily. https://www.directlyfromnature.com/Source_Naturals_Wellness_Fizz_10_wafers_Berry_Fla_p/sn-0050.htm #directlyfromnature #wellness #healthyfood #healthylifestyle #healthcare #healthier #immunesupport #health.joint #smoothie_fatloss #immunesystem #immunesystembooster #immunesystemhealth #immuneshot #wellnessformula #simplynourished #beautiwolfgirl #immunestrength #fluseasonsuck #thewarriormoms #fluseasonishere #dontgetsick #fluseason #sourcenaturals #wellnessfizz #corylrodriguez #herbalacademy #coronavirus
2231684257575053615; 0; False; 1580257516; #coronavírus #coronavirus
2231684224522489068; 0; False; 1580257512; CORONAVÍRUS EM PARANAGUÁ? Quer falar com Dr João Zattar, mande WhatsApp: 41 991348913. Compartilhe e ajude cada vez mais pessoas! Dr João Felipe Zattar Aurichio MÉDICO CRM/PR 31638 #viruschina #coronavirus #coronavirusparanagua #medicoparanagua #medicinaparanagua #clinicaparanagua #clinicazattar #drzattar
2231684193409300142; 1; False; 1580257508; Oopsies I dunnit again #memes #coronavirusmemes #coronavirus #dankmemes #funnymemes #edgymemes #funny #wtfmemes
2231684188527889876; 0; False; 1580257508; :backhand_index_pointing_right:Síntomas de #CoronaVirus toma precauciones y no dudes en visitar a un médico si tienes alguno de los siguientes síntomas. :small_orange_diamond:Comparte.
2231684191664675602; 0; False; 1580257508; Um Comitê Estadual de Resposta Rápida aos Vírus Respiratórios, como o Coronavírus, foi criado nesta terça-feira, 28, pelo Governo do Amazonas. Leia a matéria completa no link da bio. #coronavirus #amazonas #manaus #governodoamazonas #doencasrespiratorias
2231684089594160575; 0; False; 1580257496; Amen :folded_hands_medium-light_skin_tone::red_heart::raising_hands: #Amen #Jesus #Church #Godisgood #blessed #Bible #Church #Christian #gym #coffee #sports #love #igdaily #reading #books #God #jesussaves #forgiven935 #jesuschrist #fishing #nba #coronavirus #war #saved
2231683984450332498; 0; False; 1580257484; Canadians stuck in China's coronavirus quarantine zones seek government help to return home Canada’s efforts could include chartering a plane and sending it to pick up the Canadians or getting space on planes leased by other countries #zigzagzeromedia #ZigZagZero #coronavirus #canada #china
2231683809816787441; 0; False; 1580257463; All new episode on the #coronavirus outbreak and what we need to know about it! New listeners are always welcome :beaming_face_with_smiling_eyes: Link in bio. . . . . . . . . . . #podcast #health #china #pandemic #sick #virus #vaccine #laughtolearn #newepisode #antivax #wellness #5amclub #norestforthewicked #episode #46 #new #listener
2231683565842769664; 0; False; 1580257461; #me #metal #motivation #creative #bodybuilding #crossfit #calistenics #yoga #music #moda #model #makeup #creenciabase #winter #summer #kardashian #picoftheday #pink #youtube #mode #trump #memes #sunset #food #coronavirus #coronarvirus
2231683709957089246; 0; False; 1580257461; india finna beat china's population sooner than we think #meme #memes #funny #sandwich #nipple #lol #lmao #kobe #bryant #kobebryant #rip #ripkobe #ripkobebryant #gianna #giannabryant #thebox #roddyricch #tiktok #tiktokmemes #offensive #offensivememes #news #coronavirus #china #virus #pilot #helicopter #coronavirusmemes
2231683755852238448; 0; False; 1580257456; #coronavirus #spit #spreads #death
2231682102516862248; 0; False; 1580257451; #coronavirus #china #memes #rpm #preppertalk #bronchitis #bacterialvaginosis #aids #dallas #repost #urbansurvival #beready #preppernation #virus #doomsdaypreppers #candidiasis #pandemic #preparedness #virologia #paragrafando #studygram #med #biomedicas #brucellosis #chikungunya #chickenpox #flu #hepb #hepatitise #bhfyp
2231683587434804134; 0; False; 1580257436; #coronavirus disque llegó a cali
2231683580170353742; 2; False; 1580257435; Ci sono due siti, in cui si può gardare in diretta i luoghi dove stanno costruendo i due nuovi ospedali per mettere i pazienti infetti dal nuovo Coronavirus in Cina. Guardando gli operai lavorano tutto il giorno, le macchine funzionano tutto il giorno, mi fa piangere. Questa significa la Cina, questa significa il cinese, questa significa la patria! #coronavirus #china #wuhan 武汉加油， 中国加油！
2231683056972761525; 1; False; 1580257428; Inside Wuhan ` #xijinping #wuhan #coronavirus #cina #virus #freeuyghur #geloranews #breakingnews#bebaskanluthfi#opposite6890#fuadbakh#rockygerung#stmmelawan#mahasiswa#mahasiswabergerak#infoterkini#emakemakjamannow#milenial#akalsehat#republikakalsehat#republikjancukers#muslimcyberarmy#tvone#ilctvone#kompastv#beritaterkini#kumparan#reformasidikorupsi#hadifayyadh
2231683515508933213; 0; False; 1580257428; For the people who want to know what it's like to be in an empty mall in #China during the #CoronaVirus outbreak... It's very weird. #Shanghai has become a #GhostTown ! #SuperBrandMall #SuperBrandMallShanghai
2231683458510709004; 0; False; 1580257421; Amen :folded_hands_medium-light_skin_tone::red_heart::raising_hands: #Amen #Jesus #Church #Godisgood #blessed #Bible #Church #Christian #gym #coffee #sports #love #igdaily #reading #books #God #jesussaves #forgiven935 #jesuschrist #fishing #nba #coronavirus #war #saved
2231683447387440922; 0; False; 1580257419; We’re ready to help researchers fight this #coronavirus. We’ve opened a dedicated ordering channel that will provide fast shipping, preferred pricing, the most up-to-date CDC #assay designs, and more. Visit www.idtdna.com.
2231683401516395175; 2; False; 1580257414; #StaySafe #HongKong - @novemberprojecthk was decentralised today with instructions sent to everyone to find a spot and workout #safely without risking contacts with a large group. Some of us wore a #mask for protection and still gathered #together. #CoronaVirus may strike #fear into us but we stay #healthy #workout #training #community #np #nphk #novemberproject #willmissyouguys
2231683236395206465; 0; False; 1580257394; Para ilmuwan memperingatkan virus 2019-nCoV jenis baru dari virus corona yang muncul pertama kali di Wuhan, China, dapat menyebar melalui mata. Dalam tiga minggu, virus mirip SARS ini telah membunuh 26 orang di China dan menginfeksi lebih dari 900 orang di berbagai negara . Dokter China, Wang Guangfa, telah positif terinfeksi virus tersebut. Dia khawatir tertular penyakit itu karena dia tidak memakai kacamata pelindung. Pakar terkemuka ini mengonfirmasi sangat mungkin bagi virus 2019-nCoV masuk ke mata dengan menyentuhnya jika ada di tangan pasien. Dia juga khawatir penyakit yang diduga menyebar melalui bersin dan batuk ini dapat menjelajah seluruh tubuh untuk mencapai mata. Info lengkap di link bio @koransindo . . #SINDOgrafis #CoronaVirus #VirusCorona #VirusWuhan #Beritaviral #SARS #InfoKesehatan #TipsKesehatan #ikatandokterindonesia #infoindonesianews
2231683190804583726; 0; False; 1580257389; :warning:WARNING GRAPHIC IMAGES:warning: Please share this URGENT post about the coronavirus epidemic with your followers as the origin of the virus has been traced to the zone of the Wuhan market where live wild animals like snakes, rats, bats and monkeys were traded before China instituted a temporary ban yesterday. But a temporary ban is NOT enough, WE MUST use our social media platforms to spread awareness and BAN WILD ANIMAL TRADING WORLDWIDE as this is EXACTLY what caused the SARS virus that killed nearly 800 people in 2003! SARS was 17 years ago and yet these markets are doing the exact same thing, selling live wild animals in unhygienic conditions that create diseases with devastating consequences for the entire human race! This new virus, which has no vaccine, has killed 82 people with 2,887 confirmed cases in 15 countries, numbers which have increased 50% SINCE YESTERDAY and 60 million more people are on lockdown to prevent further spreading. Please pray for the world and share this URGENT post with your followers and tag people, celebrities, influencers and news media that need to see this and let’s work together to PERMANENTLY ban the trading of wild animals that create these deadly viruses! From @karmagawa #coronavirus #endanimalcruelty #coronavirusoutbreak #karmagawa
2231683184494919211; 0; False; 1580257388; :warning:info corona ! #corona #coronavirus
2231683099283936258; 0; False; 1580257378; . Importante enfatizar as formas de prevenção! :police_car_light: - Evitar locais de aglomeração: shopping, cinema, Igreja, blocos de carnaval, shows, baladas, etc. - Lavar muito as mãos e caprichar no álcool em gel. - Já poderíamos começar a pensar na idéia de se usar máscaras tb!! :thinking_face: - Não entrar em pânico, mas ter consciência da situação e como prevenir. - Nada confirmado, mas a suspeita existe e precisamos manter atenção!!! . @minsaude @pediatria_objetiva #coronavirus
2231683071365835974; 0; False; 1580257375; Este virus se ha propagado velozmente por el mundo:globe_showing_Europe-Africa:, asegúrate de tomar las precauciones necesarias :hospital::pill: . . . #world #tips #coronavirus #precaution #medicine #health
2231682841385983077; 3; False; 1580257370; #Speechless we are on this one... :skull_and_crossbones: #CoronaVirus :rolling_on_the_floor_laughing::rolling_on_the_floor_laughing::rolling_on_the_floor_laughing: Suggested by @hustledimoney #RealPartyGods @igloouk look yah! :loudly_crying_face:
2231682884796439804; 0; False; 1580257356; Coronaviruses are a group of viruses that cause diseases in mammals and birds. In humans, the virus causes respiratory infections which are typically mild including the common cold but rarer forms like SARS and MERS can be lethal. There are no vaccines or antiviral drugs that are approved for prevention or treatment. Follow these Steps below for Prevention and Recovery.⠀ Dr. Yuen Kwok Yung, a highly respected doctor in Hong Kong during the previous SARS period gave the following advice in a speech yesterday, advising people how to cope, prevent and recover from the “Coronavirus” Follow this link to read his advice and more ..........https://buff.ly/2RVCXHz⠀ #Coronavirus #Immune #Prevention #Recovery
2231682819573290905; 0; False; 1580257345; A propósito del brote de Coronavirus. . . . . #lamemeriadesign #meme #coronavirus #virus #memes #design #diseñadorescolombianos #coronavírus #coronavirusmemes
2231679056804446826; 0; False; 1580257341; things I would look for if #coronavirus would show up in a patient. #health
2231682777817038046; 1; False; 1580257340; Updated. Limits on more stock due to extreme demand due to Corona virus fears. Please call to order these items if they are not online. Ph. 1300 449 262 #masks #gloves #handsanitiser #wipes #medicalsupplies #dentalsupplies #infectioncontrol #corona #coronavirus
2231682752976224486; 0; False; 1580257337; TAKE IT SERIOUSLY! With the current outbreak of the Coronavirus we urge you to take precaution! Here is a tiny bit of info on the #coronavirus!
2231682746424663209; 0; False; 1580257336; Todo se soluciona con Paracetamol :face_with_tears_of_joy:_ _ _ _ #coronavirus #argentina #paracetamolparatodos #simpsons #memesespañol #gracioso #riverdale #boca
2231682666523872093; 1; False; 1580257326; #scraps#witchesbrew#voodoo #mysterymeat#chickengraveyard
2231682624674446310; 0; False; 1580257321; :rolling_on_the_floor_laughing::rolling_on_the_floor_laughing:#funnyposts #dominicanosoy #dominicansbelike #dominicanbelike #orgullodominicano #memesdominicanos #dominicanas #dominicsherwood #dominicana #explorer #explore #voypalpatio #dominicanos #explorepage #explore #funny #funnypost #funnyposts #twitterpost #rd #twittermemes #meme #memes #doninican #dominicanrepublic #dominican #teamdominican #dominicansbelike #dominicangirls #:Dominican_Republic:#teamcoño#teamcoño#tusupite#coronavirus
2231682557111930255; 0; False; 1580257313; #Coronavirus #Venezuela #SocialismoEsMuerte #muchasgracias
2231682557464573851; 0; False; 1580257313; Wabah Virus Corona sudah merebak di negara-negara Asia, tak terkecuali Asia Tenggara, termasuk negara-negara tetangga Indonesia. Selain mencegah masuknya virus melalui perketatan pengawasan terhadap kesehatan wisatawan di bandara, ada baiknya kita mencegahnya dari diri masing-masing. Kenali gejala dan cara pencegahannya yuk, #SahabatAP1! Kalian juga bisa bagikan tips pencegahan lain di kolom komentar. Meluncurrr! #AngkasaPura1 #AP1GoBeyond #CoronaVirus #VirusCorona (Reposted from @ap_airports)
2231682165061969904; 3; False; 1580257306; Send me memes broz...:pensive_face:I’m low on quality content
2231682453101986611; 1; False; 1580257301; Fun fact the limes was originally used to keep flies out, today it may be used to keep #coronavirus away. On a serious note if you’ve traveled in or around that area you should at least get checked. #fortlauderdale #wellingtonfl #miami #islamorada #jupiterflorida #delraybeach #pompanobeach #keywest #keylargo #coralgables #coralspringsfl #hialeah #brickell #wynwood #hollywoodfl #wellingtonfl #doralfl #plantationfl #keybiscayne
2231681850984521825; 6; False; 1580257292; Hoy 28 de enero, hay dos nuevos estudios sobre el #Coronavirus de #wuhan (#2019ncov o #wuhanvirus ) 1)Origin time and epidemic dynamics of te 2019 novel coronavirus Este estudio preliminar comparó las variaciones geneticas en 24 genomas del nuevo coronavirus y apunta a que el inicio de la epidemia fue el 17 de diciembre. Aquí debo mencionar que cuando un virus logra infectar a un nuevo hospedador, durante un lapso de tiempo su variabilidad genética aumenta en búsqueda de encontrar la manera más eficiente de replicarse en él. 2)Full-genome evolutionary analysis of te nivel coronavirus (2019-nCoV) rejects te hypothesis of emergence as a result of a recent recombination event. Esta publicación demostró que el virus no es un mosaico (mezcla) genético de otros #batcoronavirus conocidos (otros coronavirus conocidos que afectan al murciélago) , a su vez demostró que su recombinación no es tan reciente. En otras palabras, el coronavirus de Wuhan tiene características geneticas a nivel de virulencia bastante propias (esto explica su propagación y mortalidad) respecto a otros coronavirus de su origen (el murciélago) Además se explica que este puede haber tenido la capacidad de afectar al humano mucho antes, en vista que su recombinación no es tan próxima al supuesto inicio de la epidemia.
2231682196209743029; 0; False; 1580257280; 1. I thought it was funnier in my head 2. I look like trash but that's okay 3. I'm ready to die #coronavirus
2231682273290363194; 1; False; 1580257280; je ne voulais pas vous faire peur, mais j’ai été en chine dans les derniers mois ..... en espérant que mon séjour à l’hôpital n’avait pas de lien avec le #coronavirus :grinning_face_with_sweat::face_with_tears_of_joy: Ben non! Je n’ai pas été en chine j’étais juste dans le quartier chinois à Montréal :face_with_tears_of_joy: j’espère que ma blague a fonctionné #mtlinfluencer #mtl
2231682245549876081; 0; False; 1580257276; Breaking News . . . . . #milano #welcometofavelas #fire #assault #gta5 #coronavirus #corona #wuhan #gta #trashmilano #cash
2231678983103942355; 1; False; 1580257267; ~Lauren Orlando~ . . . . @laurenorlando88 Who should I do next? Love y’all:smiling_face_with_3_hearts:who wants my snap????? Credits go to: TC: @poopiedits Intro: @4edits.xx Rest of the credits go to all :smiling_face_with_smiling_eyes: #videostarfonts #videostar #edits #laurenorlando #laurenorlandoedits #like #hashtag #notyours #like #leavealike #follow #peachyeditzz #edit #editaudios #cute #viral #worldstar #drake #drama #california #coronavirus #besafe #love #cutie
2231682152580059233; 0; False; 1580257265; Smoking #AshtonCigar before #coronavirus gets me :dashing_away::dashing_away::dashing_away::dashing_away::dashing_away::dashing_away::dashing_away::dashing_away::dashing_away::dashing_away::dashing_away: . . #CigarLife #CigarLifestyle #CigarsNLife #Cigars #CigarStyle #Cigarstagram #CigarsOfInstagram #CigarSmoke #CigarSmoker #CigarSmokers #TankAndBrownCigars #CigarBabes #CigarWoman #ChicksAndSticks #SmokingNow #Tobacco #Lifestyle #LadiesWhoSmoke #CigarEnthusiast #CigarAficionado #CigarSociety #CigarPorn #CigarOfTheDay #CigarLover
2231682144284319801; 0; False; 1580257264; Viagem à China só deve ocorrer em caso de 'extrema necessidade', diz ministério após surto de coronavírus. O Ministério da Saúde emitiu comunicado orientando que brasileiros evitem viajar à China ou embarquem somente em casos de extrema necessidade por causa do surto de coronavírus. A doença provocou 106 mortes na China, onde o número de infectados passa de 4,5 mil. O ministério anunciou nesta terça-feira (28) que investiga um caso suspeito de coronavírus em Minas Gerais. Trata-se de uma estudante de 22 anos que viajou para Wuhan, na China. Ela chegou em território brasileiro no dia 24 de janeiro. De todas as mortes até o momento, 100 foram registrada na província chinesa de Hubei, onde fica a cidade de Wuhan, epicentro da contaminação. Ao menos 15 países em 4 continentes já confirmaram casos importados da doença. :red_triangle_pointed_up:O Coronavirus pode ser transmitido pelos animais (contato com carne de animal silvestre) ou pelos seres humanos (a pessoa contaminada tosse ou espirra passando o virus). :red_triangle_pointed_up:Os sintomas são: Febre, dificuldade para respirar e insuficiência renal. :red_triangle_pointed_up:Os métodos de prevenção são: Lavar bem as mãos, cobrir a boca e nariz ao espirrar, e cozinhas bem carnes e ovos. O Ministério da Saúde elevou a classificação de risco do Brasil para o nível 2, que significa "perigo iminente" e desde o dia 24 de janeiro, os aeroportos da Infraero começaram a veicular um aviso sonoro da Agência Nacional de Vigilância Sanitária (Anvisa) sobre o coronavírus. FONTE: https://g1.globo.com/turismo-e-viagem/noticia/2020/01/28/ministerio-da-saude-orienta-que-brasileiros-so-embarquem-para-a-china-em-casos-de-extrema-necessidade.ghtml :mobile_phone_with_arrow:CONTEÚDO DE QUALIDADE, VOCÊ ENCONTRA AQUI!:mobile_phone_with_arrow: De A a Z Tur, Assessoria especializada em Passaportes, Vistos Consulares, Cidadania Portuguesa, entre outros. Entre em contato conosco e saiba tudo sobre nossa empresa: +55 21 3617-3544 +55 21 99978-3544 vendas@deaaztur.com.br #alerta #China #urgente #coronavirus #viagem #consulado #vistos #passaportes #cidadania #turismo #profissionalismo #deaaztur
2231682134167751588; 0; False; 1580257263; Reposted from @anetek_30001 Posted @withregram • @nom_aly :woman_shrugging::thinking_face:#coronavirusoutbreak . A social media flyer is circulating to alert pet owners in China :China:: . PLEASE DO NOT ABANDON YOUR PETS!! . #pet #pets #petsofinstagram #dog #dogs #dogsofinstagram #cat #cats #catsofinstagram #wildlife #chinawildlife #wildlifeprotection #protectwildlife #protectourwildlife #protectallwildlife #wuhan #wuhancity #wuhancoronavirus #wuhanchina #wuhanvirus #wuhancoronavirus #wuhanpneumonia #coronavirus #coronavirus2020 #coronavirusoutbreak #coronaviruschina #coronaviruses #china #china:China: #mainlandchina #chinamainland
2231682028670087575; 1; False; 1580257250; کروناویروس‌ها(بخش يك) کروناویروس‌ها (نام علمی: Coronaviruses)، خانواده بزرگی از ویروس‌ها هستند که از ویروس سرماخوردگی معمولی تا عامل بیماری سارس را شامل می‌شود. کرونو ویروس‌ها در سال ۱۹۶۵ کشف شدند و مطالعه بر روی آن‌ها تا به‌طور مداوم تا اواسط دهه ۱۹۸۰ ادامه داشت. ساختار کروناویروس‌ها نیز دارای یک ژنوم RNAمعمولی است.افرادی که هم‌زمان دارای بیماری دیگری باشند و کودکان مبتلا به بیماری‌های قلبی، بیشتر در معرض خطر ابتلا به کروناویروس‌ها هستند. معمولاً شدت سرماخوردگی که کروناویروس عامل آن باشد بیشتر است.کرونو ویروس‌ها که پس از راینو ویروس‌ها بزرگترین عامل ابتلا به سرماخوردگی هستند، بیشتر در زمستان و بهار باعث سرماخوردگی می‌شوند.اگرچه کرونو ویروس‌ها بیشتر در حیوانات دیده می‌شوند، اما پنج نوع از آن‌ها دستگاه تنفسیبدن انسان را تحت تأثیر قرار می‌دهد. تشخیص اینکه علت بیماری کرونو ویروس باشد یا خیر کمی مشکل است، چرا که برخلاف راینو ویروس‌ها به سختی در آزمایشگاه رشد و نمو می‌کنند. واژه "کروناویروس" از کلمه لاتین "corona" یا کلمه یونانی "κορώνη" به معنی تاج یا هاله گرفته شده است. این واژه به مشخصه ظاهری ویریون‌ها (شکل عفونی ویروس) که در زیر میکروسکوپ الکترونی دیده می‌شود، اشاره دارد که حاشیه‌ای از سطح بزرگ و پیازدار داشته و یادآور تصویری از یک تاج سلطنتی یا تاج خورشیدی است. کروناویروس‌ها (Coronaviruses) خانواده بزرگی از ویروس‌ها هستند که بیماری‌های مختلفی را از سرماخوردگی معمولی گرفته تا سندرم حاد و شدید تنفسی یا همان SARS (سارس) ایجاد می‌کنند. این بیماری به نام سندرم نارسایی تنفسی خاورمیانه (Middle East respiratory syndrome coronavirus) شناخته شده‌است که به اختصار MERS-CoV خوانده می‌شود.کروناویروس‌ها دستگاه تنفسی فوقانی و تحتانی را در انسان‌ها درگیر می‌کند و عامل یک سوم سرماخوردگی‌های شایع هستند. ادامه در كامنت اول #spfco #science #coronavirus #ncov2019 #wuhan #pcr #genome #dnasequencing #rnasequencing #سپنتا_پايا_فرين #ويروس_كرونا #ووهان #كرونا #نرخ_ارز #نرخ_دلار #نرخ_طلا #شيوع_ويروس_كرونا #شيوع_ويروس_سارس #وزارت_بهداشت #پيشگيرى_از_ويروس_كرونا #ساينس #چين #ويروس #وايرال #كروناويروس #كرونا_ويروس #ويروس_خطرناك #پژوهشگر #محقق #پژوهشگر_علوم_پزشکی
2231681984565306219; 0; False; 1580257245; #bangkok #coronavirus eveyone wearing maska. Already 14 cases in thailand
2231681964708928959; 0; False; 1580257243; Found this gold nugget while scrolling through my old memes - - - #meme #dankmeme #fortnitememes #memesdaily #dailymemes #funnymemes #hilariousmemes #hilarious #funny #meme #dankmeme #transformers #transformersmemes #kobebryant #coronavirusmemes #coronavirus #corona #straya #bayverse #transformersbayverse #transformersrotf #gdaymate #geewun #g1 #tfmemes #autobots #decepticons #starwars #starwarsmemes #starwarsnerd #starwarsfan
2231681948878942117; 3; False; 1580257241; Actualización del Coronavirus 28/01/2020 Ilustraciones por @pictoline . • • • • #Coronavirus #China #wuhan #Usa #Canada #oms #virus #medicina
2231681923946988979; 0; False; 1580257238; Criss cross applesauce. Quality mounting job. #youarefired #unibar #litebarnazi #offroad #chinese #coronavirus #coronavirusoutbreak #coronavirusmemes
2231681919301848306; 0; False; 1580257237; “Coronavírus: o que o cirurgião-dentista deve saber e como atuar O novo coronavírus, que ataca o sistema respiratório, pertence a uma grande família viral e se espalhou a partir da região Wuhan, na China, deixando todos os países em alerta. Com sintomas parecidos com os da gripe, o vírus pode causar doenças respiratórias leves a moderadas, entre elas, a Síndrome Respiratória Aguda Grave (SARS) e a Síndrome Respiratória do Oriente Médio (MERS). Segundo a Sociedade Brasileira de Infectologia (SBI), alguns coronavírus são transmitidos de pessoa a pessoa pelo ar (secreções aéreas do paciente infectado). Na maioria dos casos, a transmissão é limitada e se dá por contato próximo, ou seja, qualquer pessoa que cuidou do paciente - como profissionais da saúde ou familiares -, que tenham tido contato físico e/ou tenha permanecido no mesmo local que o paciente doente. Em caso de suspeita, a(o) cirurgiã(o)-dentista deve encaminhar o paciente para atendimento médico com o descritivo dos sintomas observados pelo profissional, pois os exames laboratoriais realizados por biologia molecular identificam o material genético do vírus em secreções respiratórias.” Mais informações no site da Crosp #clinicadimatteo #coronavirus #crosp #dentistasantoandre
2231681847973440309; 0; False; 1580257229; *runny nose* #meme #memes #bestmemes #instamemes #funny #funnymemes #dankmemes #offensivememes #edgymemes #spicymemes #nichememes #memepage #funniestmemes #dank #memesdaily #jokes #memesrlife #memestar #memesquad #humor #lmao #igmemes #lol #memeaccount #memer #relatablememes #funnyposts #sillymemes #memetime #coronavirus
2231681492413329451; 0; False; 1580257225; Diduga gunakan ilmu kebal, pelaku pencurian motor ini sempat ngamuk dan melepas borgol yang mengikat tangannya. . . Terduga pelaku pencurian motor berhasil diamankan, Jumat (24/1) siang di depan Monumen Bom Bali Legian, Kuta. . . Pelaku sempat mengamuk saat diamankan dan membuat borgol yang mengikat tangan pelaku terlepas. Saat ini pelaku sudah diamankan oleh pihak berwajib. #wuhan #coronavirus #wuhanvirus Lihat Info menarik dan terbaru lainnya di @nih.info . . . . #faktaindo #beritaindonesia #berita #fakta #beritanasional #infoindonesia #infoterkini #beritaterbaru #infoterbaru #beritaterkini #beritajakarta #infojakarta #faktaterkini #videoberita #beritahariini
2231681807514176888; 2; False; 1580257224; Things you should know about the #coronavirus
2231681780922803039; 0; False; 1580257221; Halo! ⁣Sudah tahu kan kalau sekarang kita harus antisipasi akan terpaparnya virus baru Novel Coronavirus (2019-nCoV)? ⁣⁣ Virus baru yang berasal dari Cina ini menyerang sistem pernapasan manusia loh... Kita pasti turut prihatin dan senantiasa yuk saling mengajak untuk peduli memperhatikan langkah-langkah untuk mencegah terinfeksi dari virus yang penyebarannya ditransmisi oleh udara dan kontak fisik⁣ ⁣ Atmospher SKY mampu memfilter udara kamu jadi lebih sehat dengan menjebak virus, debu, bau ke dalam nya. Bukan ke paru paru kamu. ⁣⁣ , lindungi diri dengan pencegahan yang tepat dan efektif. ⁣⁣ ⁣⁣ #coronavirus⁣⁣ #corona ⁣⁣ #cegahvirus⁣⁣ ⁣⁣ ⁣⁣ ⁣
2231681769917022942; 0; False; 1580257220; Los coronavirus son una familia de virus que circulan entre humanos y animales (gatos, camellos, quirópteros, etc). Se han descrito coronavirus que evolucionan y desarrollan la capacidad de transmitirse de animales a humanos y propagarse entre las personas, como es el caso del Síndrome Respiratorio Agudo Severo (SARS) y el Síndrome Respiratorio de Oriente Medio (MERS). . El 31 de diciembre de 2019, autoridades de salud de la ciudad de Wuhan, provincia de Hubei, China informaron sobre la presencia de un conglomerado de 27 casos de Síndrome Respiratorio Agudo de etiología desconocida, estableciendo un vínculo con un mercado de mariscos y animales. El 7 de enero de 2020, las autoridades chinas informaron la presencia de un Nuevo Coronavirus (2019-nCoV) identificado como posible etiología causante de dicho síndrome. . Las infecciones en los humanos con coronavirus comunes muchas veces son leves o incluso asintomáticas, pero se han observado infecciones severas y letales. Ocasionalmente, estos virus, son capaces de causar infecciones respiratorias bajas como neumonía en personas inmunosuprimidas, con condiciones cardiorrespiratorias, ancianos o niños pequeños. . Se debe sospechar infección por 2019-nCoV en personas a cualquier edad que presente fiebre, enfermedad respiratoria aguda (fiebre, malestar general, mocos, tos, dificultad para respirar, dolor muscular, problemas gastrointestinales como diarrea) y que cuente con antecedente de viaje o estancia en la ciudad de Wuhan (China), o haber estado en contacto con un caso confirmado o un caso bajo investigación hasta 14 días antes del inicio de síntomas. . Fuentes y :camera: : google. #pedtips #pediatra #pediatria #puericultura #salud #prevencion #niños #venezuela #centromedicodecaracas #2019ncov #coronavirus #pedtipsinfeccionrespiratoria #pedtipsinfeccion
2231681731094602151; 0; False; 1580257220; EL CORONAVIRUS DE WUHAN: Breve explicación :up_arrow: #coronavirus #wuhan #virus #prevención #convensalud #oms
2231681767266729426; 9; False; 1580257219; :warning:WARNING GRAPHIC IMAGES:warning: about the coronavirus epidemic as the origin of the virus has been traced to the zone of the Wuhan market where live wild animals like snakes, rats, bats and monkeys were traded before China instituted a temporary ban yesterday. But a temporary ban is NOT enough, WE MUST use our social media platforms to spread awareness and BAN WILD ANIMAL TRADING WORLDWIDE as this is EXACTLY what caused the SARS virus that killed nearly 800 people in 2003! SARS was 17 years ago and yet these markets are doing the exact same thing, selling live wild animals in unhygienic conditions that create diseases with devastating consequences for the entire human race! This new virus, which has no vaccine, has killed 82 people with 2,887 confirmed cases in 15 countries, numbers which have increased 50% SINCE YESTERDAY and 60 million more people are on lockdown to prevent further spreading. ban the trading of wild animals that create these deadly viruses! #coronavirus #endanimalcruelty #coronavirusoutbreak #karmagawa #explorepage #news #explore
2231681753179898280; 0; False; 1580257218; #Repost @whoeurope • • • • • • Stay healthy while travelling! :airplane::monorail::tram_car::ferry::bus: :face_with_thermometer: Avoid travel if you have a fever or cough; :hospital: If you have a fever, cough and difficulty breathing then seek medical care quickly; :luggage: Tell your health care provider about any travel history. #coronavirus
2231681707722902760; 0; False; 1580257212; https://toquedeclasse100.blogspot.com/2020/01/coronavirus-entenda-o-que-e-e-como-se.html?m=1 Coronavirus: entenda o que é e como se proteger #Coronavirus #Saúde #China #Brasil #Infecção
2231676733933638270; 1; False; 1580257211; I don’t know how to say it. I wasn’t a Kobe fan or anything but the bond and love for basketball that Kobe and Gigi had really hit hard on me. Just imagining how they found their bodies clutched close holding onto each other. Their last words to each other . I was very shocked and devistated when I first heard of the incident. Just imagining that being me and my dad, they didn’t even have a chance to say a goodbye to their family. :pensive_face: this is too much to take in. I just hope everyone’s doing good with the corona virus spreading in China. Stay save everyone Tags: #kobe #kobebryant #ripkobebryant #ripkobe #ripkobeandgigi #ripedits #ripgigibryant #ripgigi:dove: #ripgigi:broken_heart: #gianna #giannabryant #giannabryant:folded_hands_medium_skin_tone::folded_hands_medium_skin_tone::folded_hands_medium_skin_tone::folded_hands_medium_skin_tone::folded_hands_medium_skin_tone::broken_heart::broken_heart::broken_heart::broken_heart::broken_heart: #edit #edits #sad #rip #love #staysave #coronavirus #coronavirusoutbreak #virus #sickness #flyhigh #sadedit #sadedits:black_circle:
2231681471775976443; 0; False; 1580257210; “A hero dropping off face masks to a police station in Anhui Province in China.“⁣ ⁣ #WuhanSARS #WuhanOutbreak #CCPChina #chinazi #SARS2020 #武漢肺炎 #武汉疫情 #ChinaVirus #CoronavirusOutbreak at #Wuhan #china #武漢疫情 #冠狀病毒 #武漢肺炎 #新型肺炎 #新型コロナウィルス #武漢 #武漢市新型冠狀病毒肺炎 #武漢市 #chinanews #becausechina #faceofchina #massmigration #springfestival #coronavirus #WuhanCoronavirus #WuhanPneumonia #wuhanvirus
2231681680201461547; 0; False; 1580257209; When coronavirus reaches your country #coronavirus
2231681661274952879; 0; False; 1580257207; #memesgamers Yo pasé todo #residentevil solo con cuchillo y eso garantiza que sobreviviré al #coronavirus :smiling_face_with_sunglasses:
2231681652963038516; 0; False; 1580257206; Oof - - - #meme #dankmeme #fortnitememes #memesdaily #dailymemes #funnymemes #hilariousmemes #hilarious #funny #meme #dankmeme #transformers #transformersmemes #kobebryant #coronavirusmemes #coronavirus #corona #straya #bayverse #transformersbayverse #transformersrotf #gdaymate #geewun #g1 #tfmemes #autobots #decepticons #starwars #starwarsmemes #starwarsnerd #starwarsfan
2231681608133724333; 3; False; 1580257200; Ésta debería ser la temporada alta para un hotel de 12 habitaciones cerca de la estación de trenes en el centro industrial chino de Wuhan. El Año Nuevo Lunar chino suele generar unos 3,000 dólares al mes para ese hotel. Sin embargo, el lugar está vacío. Wuhan, el centro de un brote viral mortal, está bloqueado. “No hay un solo cliente”, dijo el propietario del hotel que sólo se identificó con su apellido, Cui. Todavía tiene que pagar renta y servicios. En lugar de contar sus ganancias, calcula perder 1,500 dólares al mes. Amplía los detalles de esta información en la portada de nuestra web #DL #DiarioLibre #Actualidad #Internacional #China #Wuhan #Coronavirus Foto: AP
2231680648275706839; 0; False; 1580257198; Looool I’m dead:face_with_tears_of_joy::face_with_tears_of_joy::skull: • • Follow @memehourr For more #lol #lmao #funny #laughing #memes #dankmemes #memesdaily #memehourr #imjustbait #imjokingfam #china #virus #coronavirus #dumbasses #sneeze
2231681541636382027; 0; False; 1580257192; :warning: Penser à vous désinfecter les mains . #corona #coronavirus
2231681536428526629; 0; False; 1580257192; At times like this. Please do not panic and snatch all available mask to stock up unnecessarily. Put on mask if you feel sick, or worry about falling sick. Maintain hygiene by covering your mouth when coughing and washing hand frequently. Stay healthy! #kpokiadiary #kpokia #wuhanvirus #coronavirus #keepcalm #wearmask
2231681527702680189; 1; False; 1580257191; gonna need to start walking around like this because of #coronavirus #fuckthisshit
2231681520967740119; 0; False; 1580257190; #coronavirus #hulkhogan #corona #coronavirusmemes #coronavirus2020 #coronavirusoutbreak #coronamemes #wwe #wcw #wwf
2231681433793274230; 0; False; 1580257179; O O Ministério da Saúde confirmou nesta terça-feira (28) que investiga três casos suspeitos de coronavírus. Um dos casos acompanhados é em Curitiba (Paraná). Além disso, Belo Horizonte (Minas Gerais) e Porto Alegre (Rio Grande do Sul) também têm casos em investigação. #oms #coronavirus #cuidado #urgente #curitiba #portoalegre #minasgerais #marinacarneiroconsultoriajuridica
2231681424640046518; 2; False; 1580257178; *SNIFF* . . This post is brought to you by NordVPN:trade_mark:. Make sure to like, subscribe and click that bell button so you won't miss any new posts we make! . . 𝙁𝙊𝙇𝙇𝙊𝙒 @rarefrens 𝙖𝙣𝙙 𝙧𝙚𝙘𝙚𝙞𝙫𝙚 (っ◔◡◔)っ 𝓰𝓸𝓸𝓭 𝓵𝓾𝓬𝓴! ᴸⁱᵏᵉ ᶜᵒᵐᵐᵉⁿᵗ ᵃⁿᵈ ᵗᵃᵍ ʸᵒᵘʳ ᶠʳⁱᵉⁿᵈˢ ᶠᵒʳ ᵃᵘˢᵖⁱᶜⁱᵒᵘˢ ᵖʳᵒˢᵖᵉʳⁱᵗʸ~ #pcbuild #meme #lmao #anime #4chan #chainlink #blockchain #sergeynazarov #bitcoin #dogecoin #cryptocurrency #crypto #jojo #fren #dankmemes #anime #hongkong #protests #capitalism #joker #apustaja #coronavirus #china #xijinping
2231681287916286058; 0; False; 1580257174; #Coronavirus | En China :China: dos ciudadanos se pelearon para poder comprar una mascarilla, debido a que ya no hay suficientes :prohibited: y las que se consiguen las venden muy caras. . . . #venezolanosenpanama #venezolanosenecuador #esdevenezolanos #zulia #venezolanosencolombia #venezuelalucha #venezueladice #venezolanos #venezolanosenpanama #venezolanosenelmundo #venezolanosenelexterior #venezolanosenchile #venezolanosenmiami #caracas #maracaibo #zulia #tachira #venezolanosenespaña #venezuelaesresistencia #venezuelalibre #venezolanosenperu #ayudahumanitaria #venezueladijo #vamosbien #ultimahora #retruqueinformativo
2231681339371734164; 2; False; 1580257168; Chinos desesperados fuera de control...#pandemia #coronavirus #venezuelabrutal
2231681205009896523; 0; False; 1580257162; #Repost @scars_and_stripez ・・・ So I have a friend from high school who teaches in #china. He sent me this video and told me in his words... "things are bad. You have no idea" I'm trying to get more media and a statement as to what is really going on so stand by. #Chinese #coronavirus #pandemic
2231681235242822235; 1; False; 1580257156; Coronavirus :Signes, préventions #coronavirus
2231681232937475195; 0; False; 1580257156; #Repost @fightdogmeat_dot_com • • • • • Pets ‘Not’ Spreading Human Coronavirus. Do NOT abandon your pets! The new coronavirus was caused “spillover” via live and dead animals cramped together with illegal wildlife in wet markets. Employees at the wet market were the first to contract the new strain of coronavirus. The virus is spread through contact with infected humans, not through regular contact with pets. The human coronavirus epidemic is causing widespread concern among many pet owners. Domestic pets are being abandoned on the streets in unprecedented numbers in China, to fend for themselves. Abandoned pets cannot fend for themselves! DO NOT ABANDON YOUR PETS! Wet markets place people, plus living and dead animals in close contact, making it easy for a virus to jump species. Spillovers happen in markets where live and dead animals are sold for food. Read the full article on our FDM website: www.FightDogMeat.com. Fight Dog Meat. Registered Charity. #wuhan #wuhanchina #china #dog #dogs #stopanimalabuse #stopanimalcruelty #coronavirus
2231681241072247278; 0; False; 1580257156; #Repost @pediatria_objetiva Made by @Image.Downloader · · · · Importante enfatizar as formas de prevenção! :police_car_light: - Evitar locais de aglomeração shopping, cinema, Igreja, blocos de carnaval, shows, baladas, etc. - Lavar muito as mãos e caprichar no álcool em gel. - Já poderíamos começar a pensar na idéia de se usar máscaras tb!! :thinking_face: - Não entrar em pânico, mas ter consciência da situação em Belo Horizonte (MG) Porto Alegre (RS) Curitiba (PR) Os pacientes se enquadram na definição de casos suspeitos doença por apresentarem sintomas, como febre, tosse e dificuldade de respirar. Além histórico de viagem, nos últimos 14 dias, para China. Nada confirmado, mas a suspeita existe e precisamos manter atenção!!! Ajudem a divulgar as informações corretas! :folded_hands::heavy_check_mark: #coronavirus #cuidese #cuidado #saudeeprevencao #lavarasmaos #higienedasmaos #orientacao #nutricionistairissilva
2231681161774828604; 2; False; 1580257147; #adictosdigitales el CORONAVIRUS!! Despidos masivos en Intel! una RTX 2060 con GPU de 2080!? todo eso y más en las tecnoticias de aquí!:warning: https://youtu.be/rF_91D23JtI . #rtx #intel #amd #coronavirus #plagueinc #steam #gamer #gaming #pcbuild #pcmasterrace #pcgamer #pc #estamosenelviaje . recuerda que estamos en patreon por si te gusta todo el contenido que hacemos y deseas apoyarnos aparte hay material extra ahí :face_screaming_in_fear::face_screaming_in_fear::warning::warning: https://www.patreon.com/drogadigital
2231681156667226855; 0; False; 1580257146; MERS-CoV je virus koji uzrokuje respiratorne infekcije kod ljudi i životinja, uzrokuje povišenu tjelesnu temperaturu, kašalj te teškoće sa disanjem, također može uzrokovati hroničnu pneumoniju i ponekad dovesti do otkazivanja bubrega. Novi virus je drugačiji od Corona virusa koji uzrokuje SARS (2003.) i različit je od endemskih ljudskih coronavirusa. Kako bi se smanjio rizik i spriječilo širenje infekcije, jednostavne preventivne mjere su: dobra respiratorna higijena, uključujući i pranje ruku, izbjegavanje dodirivanja očiju, usta i nosa, sanitarno odlaganje oralnih i nosnih pražnjenja, kao i izbjegavanje kontakta s bolesnim ljudima. #coronavirus #china #medicine #bih #bihmedicina
2231680872470788424; 0; False; 1580257139; Miles de chinos intentan pasar a Hong Kong luego que se anunciara el cierre de la frontera para quienes lleguen desde Wuhan. #coronavirus https://t.co/xUQ07xajLa
2231681040726905526; 2; False; 1580257133; The black plague walked so coronavirus could run - MH . . . . . . . . . . . . . . #coronavirus #cnn #fakenews #news #comicbooks #tmnt #fanart #cosplay #artofinstagram #memeoftheday #badmemes #dankmemes #memed #newmemesdaily #memer #originalmemes #politicalcartoons #politicalmemes #memesforlife #memestar #republican #democrats #superhero #memeindonesia #memez #wholesomememes
2231681034177267210; 0; False; 1580257132; #TravelHistory #CoronaVirus #Tet2020
2231680999667080244; 1; False; 1580257128; #breakingnews #jamaica #cuba #earthquake #tsunami #eastcoast #miamibeach #florida #usa #jamaicaearthquake #cubaearthquake #kobe ##gianna #gigibryant #kobebryant #helicoptercrash #world #earth #mothernature #iran #war #trump #usa #iraq #bagdad #missleattack #coronavirus
2231680988887123101; 0; False; 1580257126; :microbe: Ülkelere göre güncelleme #coronavírus Çin Halk Cumhuriyeti: 4.610 Tayland: 14 Hong Kong: 8 Tayvan: 8 Japonya: 7 Makao: 7 Singapur: 7 Avustralya: 5 ABD: 5 Malezya: 4 Güney Kore: 4 Fransa: 3 Kanada: 2 Vietnam: 2 Kamboçya: 1 Almanya : 1 Nepal: 1 Sri Lanka: 1 (* Yeni) . . . . . . #turkey #türkiye #corona #korona #virüs #coronavirüs #sondakika #istanbul #bursa #izmir #ankara #hasta #hastalık #virus #coronavirus #haber #haberler #sondakikahaberler #çin #china #wuhan #güncel #güncelhaber #güncelhaberler #coronaviruses #coronaviruese #new #news #sondakikahaberleri
2231680955484373198; 3; False; 1580257122; Sumber : @dinkesdki Berikut nomor hotline kami terkait pelaporan terduga dan informasi lebih lanjut terkait coronavirus :backhand_index_pointing_up::backhand_index_pointing_up::backhand_index_pointing_up: . . . . . #dinaskesehatan #dinaskesehatanjakarta #DinkesDKI #infokesehatan #coronavirus #hotline
2231680389846548934; 0; False; 1580257121; Link in bio #music #coronavirus #gbc #lilpeep #underground #emo #fuckthesehashtagsaregay #discover #explore
2231680605503253402; 1; False; 1580257121; Are we all gunna die? #china #coronavirus #virus #worldend #like4likes #likeforlikes #likeforfollow
2231680909430437666; 0; False; 1580257117; Çin’deki ölüm sayısı resmi verilere göre 131 oldu. #sondakika #coronavirus #koronavirüsü #dünya #breakingnews #world #kiyamet #doomsday
2231680767979969059; 0; False; 1580257110; Ill continue to drop Corona virus memes until the suspected case at UWI Hospital now is confirmed ... Turn on post notifications so you don't miss out #coronavirus #corona #earthquake #jamaicanhistory #jamaica #jamaicansbelike #kartel #vybzkartel #jamaicaearthquake #mosquito #blackplague #kobebryant #portroyal
2231680741187811608; 7; False; 1580257097; Así vamos en lo que va de año!!! :face_with_medical_mask::sleepy_face::zany_face::fire: . . #kobe #guaido #lapatilla #jamaica #lapatilla:watermelon: #elnacional #mancheta #juanguaido #lamancheta #coronavirus #kobebryant #terremoto #australia
2231680674557270464; 0; False; 1580257089; *OBAT VIRUS CORONA* *Soal:* Hari hari ini dunia dikejutkan dengan mewabahnya virus Corona di China. Semakin menakutkan lagi, virus ini menyebar melalui udara biidznillah dan belum ada obatnya. Apa yang seharusnya dilakukan kita sebagai mendengar berita berita ini? Terlebih kecemasan bertambah karena sudah mulai masuk ke negara 2 tetangga kita seperti Singapura , Thailand , Vietnam ? Jawab : Obatnya insyaALLAH adalah VCO, biidznillah sembuh, denhan qadarALLAH , asam Laurat asam kaprat dan asam kaprilat yg ada dlm vco bersifat antivirus anti bakteri dan antiprotozoa, tubuh mereka diliputi oleh lapisan lipoprotein yg didalamnya ada minyak, dengan minum vco biidznillah, minyak yg ada dlm tubuh virus tersebut tertarik keluar bergabung dengan vco yg ada di luar tubuh virus, akibatnya lapisan lipoprotein akan berlubang krn minyak yg ada di dalamnya tersedot keluar, tubuh virus akan mengecil karena isinya keluar, matilah virus tersebut, masyaALLAH betapa dahsyatnya VCO ciptaan ALLAH. Di Amerika Prosefor Kabara telah membuat zat antivirus dari VCO yg mereka sebut sebagai Lauricidin Bahan utama antivirus tersebut adalah asam laurat yg di isolasi dari VCO. Selamat share dan mencoba CS : 082334127675 Atau klik shopee.co.id/rasyil880925 #ayosehat #sehatbersamaalafiat #pilihancerdasherbalberkualitas #PAUS #PakaiAlAfiatUntukSehat #vco #minyakvco #corona #viruscorona #coronavirus #obatviruscorona #wuhan #penyakit #herbalmedicines
2231680651378350234; 0; False; 1580257086; #coronavirus #epidemic #global @medi_xpress
2231680313971658947; 1; False; 1580257078; - Germany confirmed that a 33-year-old man is the country's first known case of ‪coronavirus.‬⁣ ⁣ ‪ ⁣ #WuhanSARS #WuhanOutbreak #CCPChina #chinazi #SARS2020 #武漢肺炎 #武汉疫情 #ChinaVirus #CoronavirusOutbreak at #Wuhan #china #武漢疫情 #冠狀病毒 #武漢肺炎 #新型肺炎 #新型コロナウィルス #武漢 #武漢市新型冠狀病毒肺炎 #武漢市 #chinanews #becausechina #faceofchina #massmigration #springfestival #coronavirus #WuhanCoronavirus #WuhanPneumonia #wuhanvirus
2231680102169872425; 0; False; 1580257067; Achis! :sneezing_face: _____________________ #meme #memes #bestmemes #instamemes #funny #funnymemes #dankmemes #offensivememes #edgymemes #spicymemes #nichememes #memepage #funniestmemes #dank #memesdaily #CoronaVirus #memesrlife #memestar #memesquad #humor #lmao #igmemes #lol #memeaccount #memer #relatablememes #funnyposts #sillymemes #nichememe #memetime
2231680485084832413; 0; False; 1580257066; This morning @nyt gave an update about #coronavirusoutbreak. The numbers are shocking. Since I’m in Singapore, close to potentially dangerous areas. Plus, I’m traveling. I made a short video update for you on the situation in Singapore. It’s quite normal here. Some extra attention to public places and more disinfecting treatments and air cleaning in the places of tourist attraction. It feels safe here. There is a lot of information walking around social media, some people intentionally create panic. Please, read information about #coronavirus only from realizable official sources. Here are the latest numbers from @nyt: :police_car_light:The number of known cases of the new virus rose by nearly 60 percent overnight. A shortage of test kits has led experts to warn that the real number may be higher. :police_car_light:After repeated offers of assistance, China will allow in international health experts to help with research and containment. :police_car_light:China said that 106 people had died from the virus, which is believed to have originated in the central city of Wuhan and is spreading across the country. :police_car_light:The number of confirmed cases increased to 4,515 according to the National Health Commission. The youngest confirmed case is a 9-month-old girl in Beijing.
2231680463985234659; 0; False; 1580257064; Face masks sold out everywhere... . . . . . . #facemask #littledory #小鱼干 #抱紧我的小鱼干 #Disney #disneylife #Disneyplush #plushie #plushielife #coronavirus
2231680426305208916; 0; False; 1580257059; #china #shenzhen #cny #clouds #somethingintheair #coronavirus #2019ncov
2231680419888034422; 0; False; 1580257059; KERAJAAN MASIH BERHUBUNG DENGAN PENDUDUK MALAYSIA DI WUHAN Setakat ni, rakyat Malaysia kat China khususnya di Wuhan masih lagi selamat. Syukurlah... apa yang pasti adalah kerajaan tengah lakukan sedaya upaya untuk mengawal bukan je risiko jangkitan daripada terkena rakyat kita sendiri, tapi untuk didik masyarakat agar tak cepat sebarkan berita tak sahih. Kita taknaklah keadaan huru-hara pada benda yang belum pasti lagi. Seramai 49 rakyat Malaysia di Wuhan tengah dipantau keadaan mereka hasil dari kerjasama kedutaan Malaysia di Beijing dan Konsulat Jeneral di Xi'an, China. Apa yang kita harapkan sekarang ni adalah harapan dan doa kepada semua pesakit, tak kiralah negara dan bangsa, sebab penyakit ni tak kira status bila dah terkena. Sekali lagi, kami nak ingatkan korang agar ikuti saranan penjagaan kebersihan diri dari Kementerian Kesihatan Malaysia (KKM). Baca selanjutnya di orangkata.my (link di bio) #ORANGKATAMY #IsuSemasa #Wuhan #Coronavirus #China
2231680382408176812; 0; False; 1580257054; Pode ter soado um pouco estranho relacionar uma tragédia com benefícios. Mas nós só evoluímos quando temos problemas, quando estamos passando por tempos de crise é que botamos a mão na massa em prol de um futuro melhor. Criamos a roda para solucionar o problema de locomoção. Criamos até mesmo a medicina para curar doenças. Se tudo está ocorrendo bem, não nos esforçamos para nada pois não há nenhuma necessidade à ser suprida. Mas quando o problema vem a porta é ai que começamos a agir em prol da esperança. O Corona Vírus é um problema que ajudou a revolucionar a engenharia. Um hospital chinês será criado em apenas 6 dias! Isso é um grande feito para a humanidade, a doença foi algo lamentável, mas sem ela não nos preocuparíamos em colocar a mão na massa. #resiliencia #desenvolvimentopessoal #frases #poemas #versos #academia #academiamasculina #conhecimento #leitura #reflexao #aprendizado #masculinidade #filosofia #estoicismo #corona #vírus #virus #coronavírus #coronavirus #apraga #peste #pestenegra #china #caos #epidemia #pandemia #infecção #2020 #doença #g1
2231680356376281181; 0; False; 1580257051; Brace ourselves，希望大家能夠捱過呢關，身體健康，仲有記住同心抗疫唔係together fighting diseases呀！唔係個個字都有例句，因為ig carousell頁數限制，不過大家諗到有咩句子可以喺下面comment:backhand_index_pointing_down_light_skin_tone:寫出黎呀～。 #醫護的命也是命 #醫護 #撐醫護罷工 #coronavirus #wuhanvirus #肺炎 #武漢肺炎 #武漢疫情 #武漢爆疫症 #wars #epidemic #wuhancoronavirus #大三罷 #香港三罷 #hkdse2020 #hkdseeng #hkdseenglish #hkdse2020eng #dsevocab #hongkongdse #hkdse2021 #ieltsvocabulary #toeflvocabulary #toeflvocab #ieltsspeaking #dsespeaking:volcano: #dsepaper1 #ieltswriting
2231680333064278053; 1; False; 1580257048; Here is an updated stats on Corona Virus 01/28/2020 End of the Day. https://lnkd.in/dmdemcb Datasource: WHO/CDC/NHC #tableau #tableaupublic #VizForSocialGood #Coronavirus #WHO #CDC #NHC #Wuhan #WuhanCoronavirus #WuFlu #WuhanFlu #ncov2020 #nCoV #torontotug
2231680254790057226; 0; False; 1580257039; El coronavirus: más de 4500 casos y aún no sabemos cómo se contagia Leé la nota completa en @bieinoticias #linkinbio. . . . #coronavirus #virus #casos #alerta #mundial #salud #china #alemania #biei #health #contagio @who
2231674892676128099; 138; False; 1580257027; Thank you for your messages and concerns。Please be safe everyone. | Thailand has reported 14 cases of infection; Hong Kong has eight; the United States, Taiwan, Australia and Macau have five each; Singapore, South Korea and Malaysia each have reported four; Japan has seven; France has four; Canada have three; Vietnam has two; and Nepal, Cambodia and Germany each have one. • • •#corona#coronavirus#taiwan#肺炎#高雄市 #高雄#mask#口罩
2231680112260983426; 2; False; 1580257022; Thank you for your messages and concerns。Please be safe everyone. | Thailand has reported 14 cases of infection; Hong Kong has eight; the United States, Taiwan, Australia and Macau have five each; Singapore, South Korea and Malaysia each have reported four; Japan has seven; France has four; Canada have three; Vietnam has two; and Nepal, Cambodia and Germany each have one. • • •#corona#coronavirus#taiwan#肺炎#高雄市 #高雄
2231680092052341989; 1; False; 1580257020; Dale Like, comparte y síguenos @ntuskchets #meme #memes #memesespañol #jajaja #chile #instachile #instamemes #viral #chiledesperto #renunciapiñera #coronavirus
2231679429879704621; 0; False; 1580257017; Repost @cordova.media Seorang pejabat Kemenlu China, bernama Lijian Zhao memposting di akun twitternya, video pembangunan rumah sakit yang dibangun untuk pasien yang terjangkit virus Corona. Rumah sakit yang dibangun selama 16 jam ini, berbentuk box dilengkapi dengan teralis besi di jendelanya dan dan kunci yang diletakkan di pintu bagian luar.⁣ ⁣ Di postingan tersebut, ia juga menuliskan, "Let's pray for Wuhan & China", mari berdo'a untuk Wuhan dan China. Sudah jamak diketahui bahwasanya pemerintah China dari Partai Komunis China menganut paham atheisme. Namun dalam kondisi darurat seperti ini, salah satu anggotanya mengajak berdo'a untuk Wuhan dan China yang saat ini dilanda wabah virus Corona. Sudah menjadi fitrahnya, manusia bahkan ateis sekalipun, ketika dalam kesulitan, membutuhkan pertolongan dari Tuhan Yang Maha Kuasa.⁣ ⁣ "Dan dia dibantah oleh kaumnya. Dia berkata: 'Apakah kamu hendak membantah tentang Allah, padahal sesungguhnya Allah telah memberi petunjuk kepadaku'. Dan aku tidak takut kepada [malapetaka dari] sembahan-sembahan yang kamu persekutukan dengan Allah, kecuali di kala Tuhanku menghendaki sesuatu [dari malapetaka] itu. Pengetahuan Tuhanku meliputi segala sesuatu. Maka apakah kamu tidak dapat mengambil pelajaran [daripadanya]?" [QS. Al-An'am: 151].⁣ ⁣ "Dan sesungguhnya Kami jadikan untuk [isi neraka Jahannam] kebanyakan dari jin dan manusia, mereka mempunyai hati, tetapi tidak dipergunakannya untuk memahami [ayat-ayat Allah] dan mereka mempunyai mata [tetapi] tidak dipergunakannya untuk melihat [tanda-tanda kekuasaan Allah], dan mereka mempunyai telinga [tetapi] tidak dipergunakannya untuk mendengar [ayat-ayat Allah]. Mereka itu sebagai binatang ternak, bahkan mereka lebih sesat lagi. Mereka itulah orang-orang yang lalai" [QS. Al-A'raf: 179] . Revisi: di video tertulis 16 hari, yang benar adalah 16 jam sebagaimana yang tertulis di postingan Twitter tersebut. ⁣ #coronavirus #viruscorona #wuhan #china #ccp #xijinping
2231680071507137165; 2; False; 1580257017; S.O.S (Selamatkan Kami) by I Made Arya Dwita Dedok, 40 cm x 60 cm cm, Wood Cut on Paper, 2003 #indonesianartist #internationalartist #printmaking #woodcut #coronavirus #savewuhan #savetheworld #loveandpeace #imadearyadwitadedok #dedokbali #madearyadedok #artstudio #artgallery #contemporaryart #prayforwuhan
2231680006738969488; 0; False; 1580257009; A new coronavirus is causing respiratory infections mostly in Hubei Province, China. Today, B.C.’s first case was confirmed through testing at our BC Centre for Disease Control (BCCDC) public health lab. The risk to British Columbians remains low at this time and all necessary precautions are being taken to prevent the spread of infection. * Dr. Danuta Skowronski of BCCDC spoke to reporters during a news conference on January 24, 2020 to update the public on the virus. The team at BCCDC also toured Minister of Health Adrian Dix around the facility to show what the #publichealth team is doing to monitor the risk of #coronavirus. * If you have been travelling and you become ill, or if you become ill after you return home, tell your health care provider about recent travel and your symptoms. You should also tell your provider if you had close contact with a sick person or had another high-risk exposure such as direct contact with animals. Learn more on our website.
2231679923692885394; 0; False; 1580256999; . #amitiequote #hadits #riwayatabudawud #doaberlindungdaripenyakityangberbahaya #coronavirus #sunnah #hijrah #doa #muslimah
2231679907225980062; 0; False; 1580256997; #prayforchina Why is this hashtag not viral? People are suffering. People are dying. It could have been our country. Our hospitals. Our pain. Why does the average person not know what is happening? We import goods from there every day. Dont think it wont affect us. Dont think "out of sight, out of mind". Just pray. Because it could have been us. It still can be. #supportchina #staysafechina #1lifechina #china #supporthumans #helptheworld #saveourbrothersandsisters #lovelife #coronavirus
2231679893024129787; 0; False; 1580256996; 2020. 01.29 확진자 5517 사망자 131 #코로나바이러스 #확진판정 #우한폐렴 #coronavirus
2231679879467161042; 0; False; 1580256994; Stay safe y’all . ~Smug . . . . . . #thighs #thighhighs #thighhighsocks #thighighstockings #thighhighsocksarelife #thighhighsockobsession #anime #animelife #animegirls #2dgirl #2dgirls #2dgirlsdoitbetter #animethighs #animethighhighs #animegirl #skirts #memes #memesdaily #memesdaily #cultured #coronavirus
2231679879047746324; 0; False; 1580256994; Bismillah . عَنْ ثَوْبَانَ قَالَ قَالَ رَسُولُ اللَّهِ -صلى الله عليه وسلم- « يُوشِكُ الأُمَمُ أَنْ تَدَاعَى عَلَيْكُمْ كَمَا تَدَاعَى الأَكَلَةُ إِلَى قَصْعَتِهَا ». فَقَالَ قَائِلٌ وَمِنْ قِلَّةٍ نَحْنُ يَوْمَئِذٍ قَالَ « بَلْ أَنْتُمْ يَوْمَئِذٍ كَثِيرٌ وَلَكِنَّكُمْ غُثَاءٌ كَغُثَاءِ السَّيْلِ وَلَيَنْزِعَنَّ اللَّهُ مِنْ صُدُورِ عَدُوِّكُمُ الْمَهَابَةَ مِنْكُمْ وَلَيَقْذِفَنَّ اللَّهُ فِى قُلُوبِكُمُ الْوَهَنَ ». فَقَالَ قَائِلٌ يَا رَسُولَ اللَّهِ وَمَا الْوَهَنُ قَالَ « حُبُّ الدُّنْيَا وَكَرَاهِيَةُ الْمَوْتِ » . .Dari Tsauban, ia berkata bahwa Rasulullah shallallahu ‘alaihi wa sallam bersabda, “Hampir saja para umat (yang kafir dan sesat, pen) mengerumuni kalian dari berbagai penjuru, sebagaimana mereka berkumpul menghadapi makanan dalam piring”. Kemudian seseorang bertanya,”Katakanlah wahai Rasulullah, apakah kami pada saat itu sedikit?” Rasulullah berkata,”Bahkan kalian pada saat itu banyak. Akan tetapi kalian bagai sampah yang dibawa oleh air hujan. Allah akan menghilangkan rasa takut pada hati musuh kalian . . #wahn #wuhan #corona #virus #coronavirus #koronavirus #china #tiongkok #indonesia #sukoharjo #magelang #jogja #yogyakarta #karanganyar #solo #soloraya #klaten #wonogiri #sragen #surakarta #jakarta #bandung #semarang #surabaya #malang #bogor #bekasi #batam #padang #makassar
2231679866347392269; 0; False; 1580256993; #starbucks #stores #china #corona #virus #coronavirus #bussiness #world
2231679802619103072; 0; False; 1580256985; Hai Schoolers:hand_with_fingers_splayed: Masih di acara Morning Shock nihh, Schoolers pasti tau kan tentang virus Corona yg sudah menyebar dibeberapa negara; namun beberapa negara juga mencegah agar virus Corona tersebut tidak meluas, salah satu gerakan agar tidak menyebar yaitu Bandara menyediakan fasilitas Thermal Scanner lohh, supaya Schoolers gak ketinggalan infonya So keep stay tune only on FourTwo Radio:radio: . :camera_with_flash: By CNN #coronavirus #thermalscanner #pencegahanviruscorona
2231676676681921997; 0; False; 1580256980; • • ¿CORONAVIRUS EN ECUADOR :Ecuador:? • • En el siguiente vídeo, el @drglennyoong nos explica que debemos hacer en el “supuesto caso” que ya esté el virus en el país, y cómo prevenirlo! :loudspeaker: • • De igual forma, estás RECOMENDACIONES te van a ayudar a elevar tu sistema inmunológico y prevenir decaimiento, en casos de procesos gripales y cambios climáticos, muy comunes en esta época. • • ¡Te esperamos! :hundred_points: • • :green_circle:PREVIA CITA:green_circle: :round_pushpin:Avenida plaza dañin. Cdla. La Fae mz 41 villa 9 (a lado de Hyundai) :mobile_phone: 0999497339 :telephone_receiver:5027945 • • #coronavirus #virus #inmunesystem #climatechange #coronavirusecuador #coronavirusoutbreak #vitaminac #mediconaintegrativa #detox
2231679713113042166; 1; False; 1580256974; ummm that’s not a coincidence :grimacing_face:#coronavirus #racooncity #umbrellacorporation
2231679696536407545; 0; False; 1580256972; A través de @sesa_qroo :woman_light_skin_tone:‍:medical_symbol: , el @gobiernodequintanaroo que encabeza @carlosjoaquininsta fortalece las acciones de coordinación para el cuidado de la salud de la gente :family_man_woman_boy_boy: ante eventos de riesgo de salud pública como el #coronavirus #QuintanaRoo
2231679530066330458; 126; False; 1580256969; #Coronavirus | En China :China: dos ciudadanos se pelearon para poder comprar una mascarilla, debido a que ya no hay suficientes :prohibited: y las que se consiguen las venden muy caras.
2231679622500356085; 0; False; 1580256964; This is why I don't engage in the social life ladies and gentlemen - - - #meme #dankmeme #fortnitememes #memesdaily #dailymemes #funnymemes #hilariousmemes #hilarious #funny #meme #dankmeme #transformers #transformersmemes #kobebryant #coronavirusmemes #coronavirus #corona #straya #bayverse #transformersbayverse #transformersrotf #gdaymate #geewun #g1 #tfmemes #autobots #decepticons #starwars #starwarsmemes #starwarsnerd #starwarsfan
2231679371973010785; 0; False; 1580256964; Sonra bu virüs nereden çıktı..? #virus #china #çin #sağlık #grip #coronavirus #corona
2231679346154471310; 1; False; 1580256962; What would you do?:face_with_medical_mask::face_with_open_mouth: . #coronavirus #coronavirusoutbreak #virus #wuhan #wuhanvirus #coronaviruschina #wuhanchina #corona #coronovirus
2231679602619924317; 0; False; 1580256961; It’s truly sad to see Kobe gone so soon. My mom loved to watch him and Shaq play. To commemorate his passing people have bought many of Kobe named items and my Kobe shoes sold out instantly too. Last weekend you had yeezys yeshaya and air max 1 Cny come out same day and the loop line was long for these Cny. Then you had Kobe past away and this coronavirus brake out making everyone go crazy and buy masks. I still have some Bape mask for sale if anyone is interested. Be in style for this virus. Wave runner 3D keychains Lv Carhartt custom beanie Bape metrocards Dunk brown camo high sz 7 and 7.5 Kobe 6s concord sz 8 . . . . . . . . . jwongboutique.com Prices are always cheaper in store!!! Share info with me and I’ll post! $5 per day loop info locally in nyc! ALWAYS BUYING AND TAKING IN NEW CONSIGNMENTS. PREFER TO BUY NEW OVER USED. WEBSITE UPDATED DAILY, OVER 2100 ITEMS. ALWAYS TAKING IN ITEMS FOR CLEANING! STAY TUNE FOR NEWS AND UPDATES. Use#Jwongboutique to be featured. #NYC #hypebeast #Jordan #supreme #sneakers #kith #bape #holiday #nike #manhattan #custom #denim #cement #yeezy #sns #suprememarketplace #streetwear #adidas #mask #soho #700 #metrocard #coronavirus #palace #chicago #supremeforsale #bapeforsale #350 #2020
2231679602735329087; 0; False; 1580256961; :face_with_medical_mask:How contagious is the Wuhan coronavirus? :face_with_medical_mask: We don't exactly know at the moment. The virus went from being relatively localised to rapidly expanding to 4,500 cases across the world (and 106 deaths). Researchers use a value called the reproduction number to determine exactly how contagious a virus is – it's the average number of other people that one infected person will infect in a community without immunity. The WHO believes the #coronavirus R0 is between 1.4 and 2.5. For comparison, the SARS epidemic virus R0 was between 2 and 5. From an article by C Raina MacIntyre, read more at theconversation.com. #corona #wuhan #wuhanvirus #epidemic #virus #health #travel #china
2231668692689991676; 0; False; 1580256960; “A room which appears to have been set up by the government as a quarantine site for the coronavirus in Hong Kong.”⁣ ⁣ From Vernon Yuen (vernon_yuen) on Twitter.⁣ ⁣ ⁣#news #breakingnews⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣ #worldnews⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣ #coronavirus #wuhanvirus #wuhancoronavirusoutbreak #WuhanCoronavirus⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣ #coronavirusoutbreak #corona #ncov2019 #ncov⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣ #武漢肺炎 #武汉疫情⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣ #China #Wuhan⁣⁣⁣⁣⁣ #StandWithWuhan⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣ #LunarNewYear #NewYear #SpringFestival⁣⁣ ⁣⁣⁣#hongkong
2231679212960300566; 0; False; 1580256915; CORONA VIRUS AND MASKS There is understandably mounting concern about the spread of this virus and we have been contacted by many people seeking facemasks. Current medical advice as of today (29 January) is that there is NO NEED for the general public to be wearing masks. The only people who should wear masks in relation to this virus are those who are unwell. If this is the case you are advised to attend the Emergency Department of your local hospital or your GP. But PLEASE phone ahead to warn them that you are coming. . #visitwagga #visitwaggawagga #coronavirus #masks #health
2231678792028815370; 1; False; 1580256865; And I just started my gym membership.
2231213266445904032; 0; False; 1580201370; #denmark #denmark:Denmark: #denmarkbykristian #nielsbobojesen #jyllandsposten #libertedexpression #dessindepresse #coronavirus @courrierinter #courrierinter Wow four hours:face_screaming_in_fear:
2227803816002529039; 0; False; 1579794931; Actualidad En @esculapiomedical somos especialistas en materiales médicos :syringe::lab_coat::man_light_skin_tone:‍:medical_symbol: :heavy_check_mark:Vendemos equipos, materiales, y mobiliarios médicos :heavy_check_mark:Somos distribuidores autorizados FENGH MEDICAL . Tenemos disponibles: ➤ Kit de cirugía Bariátrica ➤ Autosuturadoras ➤ Stent ➤ Suturas ➤ Mobiliario ➤ Gelfoam ➤Cotonoide ➤ Marcapaso Medtronic ➤ Cateters ➤ Cera para huesos ➤ Mallas de prolene ➤ Mallas especiales Y si lo que buscas no lo tenemos, ¡te lo ubicamos! Atendemos emergencias las 24 horas :hundred_points: ___________________________________ 𝗖𝗼𝗻𝘁𝗮𝗰𝘁𝗮𝗻𝗼𝘀: :mobile_phone_with_arrow: 0412-7927594 / 0424-5815588 / 0251-4185944 :envelope_with_arrow: Direct message (DM) @esculapiomedical :envelope: Email: esmeuca@hotmail.com :round_pushpin:Estamos ubicados en Barquisimeto, en la carrera 25 entre calles 20 y 21 :outbox_tray:: Hacemos envíos a todo el país. #coronavirus #salud #medicina #cirugía #informacion #esculapiomedicaluniverse #tienda #producto #barquisimeto #vzla #venezuela
2231679565515551171; 0; False; 1580256957; O coronavírus surgiu na China e já foram registrados casos em outros países da Ásia e também nos Estados Unidos. O vírus causa doença pulmonar, com sintomas como febre, tosse e falta de ar, e pode levar à morte. A OMS divulgou um elevado risco de epidemia global, mas ainda não trata-se de um emergência de saúde global, sendo mantido os mesmos protocolos. @corenrn #virus #utilidadepublica #coronavirus #china #saudeglobal #enfermagem #medicina #farmacia #cienciabiologicas #cienciabiologicas
2231679481310282241; 0; False; 1580256947; #coronavirus #facemask Be safe then sorry...
2231679197230423342; 1; False; 1580256944; 《 PER YENNA SOLLE 》By:JKR Feat @_mxc718_ #malaysiasong #tamilsong #malaysongcover #malaysiacoversong #malayboy #perenna #peryennasolle #jiwangvideo #jiwang #santesh #rabbitmac #sheejay #amalina #mymuna #coronavirus
2231679399212503857; 0; False; 1580256937; Yommy - - - #meme #dankmeme #fortnitememes #memesdaily #dailymemes #funnymemes #hilariousmemes #hilarious #funny #meme #dankmeme #transformers #transformersmemes #kobebryant #coronavirusmemes #coronavirus #corona #straya #bayverse #transformersbayverse #transformersrotf #gdaymate #geewun #g1 #tfmemes #autobots #decepticons #starwars #starwarsmemes #starwarsnerd #starwarsfan
2231679281419531251; 0; False; 1580256923; *Enemy spotted* - - - #meme #dankmeme #fortnitememes #memesdaily #dailymemes #funnymemes #hilariousmemes #hilarious #funny #meme #dankmeme #transformers #transformersmemes #kobebryant #coronavirusmemes #coronavirus #corona #straya #bayverse #transformersbayverse #transformersrotf #gdaymate #geewun #g1 #tfmemes #autobots #decepticons #starwars #starwarsmemes #starwarsnerd #starwarsfan
2231679236506484047; 0; False; 1580256918; #SOMERandom: 27/365 #kobebryant #nyc #kyrieirving #empirestatebuilding #grammys #latino #coronavirus #arcteryx #jasonpolan #dickblick
2231679205853329867; 0; False; 1580256914; [SHINGATA CORONAVIRUS] arribó al aeropuerto de #Haneda en #Tokio la primera aeronave chárter que repatria a nipones que se encontraban en #Wuhan,la ciudad en emergencia por el brote del nuevo #coronavirus. #速報 #新型コロナウイルス #中国 #2020年1月29 #noticiasnippon
2231677457189102444; 2; False; 1580256913; These rats ain’t out here finna take the blame for Corona. :face_with_thermometer::face_with_medical_mask::dizzy_face: :rat: #coronavirus #coronavirusoutbreak #coronavirusmemes
2231679143694916907; 1; False; 1580256910; With the headlines growing increasingly scary every day, you may have questions about who's at risk and if there's anything you should be doing to keep yourself and your family safe. ⠀ ⠀ Read the blog and learn what steps should you take if you're travelling... Visit @www.popsugar.com.au⠀ ⠀ ⠀ ⠀ ⠀ ⠀ .⠀ .⠀ .⠀ .⠀ #AHSS #AHPs #Alliedhealth #health #healthcare #resources #support #directory #coronavirus
2231679127455046710; 0; False; 1580256905; Very wholesome - - - #meme #dankmeme #fortnitememes #memesdaily #dailymemes #funnymemes #hilariousmemes #hilarious #funny #meme #dankmeme #transformers #transformersmemes #kobebryant #coronavirusmemes #coronavirus #corona #straya #bayverse #transformersbayverse #transformersrotf #gdaymate #geewun #g1 #tfmemes #autobots #decepticons #starwars #starwarsmemes #starwarsnerd #starwarsfan
2231679109293813074; 0; False; 1580256902; Kisah horor viral tahun lalu siap jadi film. . Kisah misteri KKN di Desa Penari rencananya diangkat menjadi film layar lebar. Tak tanggung-tanggung, biaya yang diperlukan untuk produksi film tersebut mencapai Rp15 miliar. . Film terbaru bergenre horor bertajuk KKN di Desa Penari bakal digarap rumah produksi MD Pictures. Kabarnya, proses syuting film terbaru ini dilakukan di hutan daerah Jogja. . Manoj Punjabi selaku produse MD Pictures mengatakan, KKN di Desa penari merupakan film horor dengan biaya produksi cukup tinggi. Bahkan, totalnya melebihi sederet film yang pernah dibuatnya. . “Saya jujur, so far budget-nya sangat tinggi. Sudah melebihi film-film drama besar. Enggak tahu budget-nya berapa. Kayaknya hampir di atas Rp15 miliar,” terang Manoj Punjabi seperti dilansir Liputan6.com, Senin (20/1/2020). . Manoj Punjabi antusias menggarap film horor ini lantaran kisahnya yang viral dan ditunggu banyak orang. Dengan biaya produksi yang tinggi, dia berharap film terbaru itu laris di pasaran. . “Jadi saya mau all out di sini. Dan berani kan keluar budget. Biasanya horor bisa paling 20 persennya. Penonton film Indonesia punya ekspektasi tinggi dari KKN ini. Saya tidak mau mengecewakan mereka. Itu jadi misi saya,” imbuh dia. . Artikel : Liputan6.com #wuhan #coronavirus #wuhanvirus Lihat Info menarik dan terbaru lainnya di @nih.info . . . . #faktaindo #beritaindonesia #berita #fakta #beritanasional #infoindonesia #infoterkini #beritaterbaru #infoterbaru #beritaterkini #beritajakarta #infojakarta #faktaterkini #videoberita #beritahariini
2231679080997263994; 0; False; 1580256899; Tetap jaga kesehatan dan selalu pergunakan masker ya.. semoga kita semua tetap aman dan sehat.. punya stok masker berlebih lebih baik.. #corona #coronavirus #kesmas #keluargaberencana #promosikesehatan #publichealth #germas #papua #promosikesehatan #indonesiasehat #promkes #kankerserviks #cegahkankerserviks #puskesmasindonesia #puskesmasakreditasi #hindarinarkoba #bidan #ibumenyusui #ibuhamil #BahayaNarkoba #stunting #asi #merokok #Psikitropika #posyandu #puskesmas #rsud #kemenkes #printposter #alatkesehatan
2231679065841422297; 0; False; 1580256897; #Repost @voaindonesia with @repostsaveapp ・・・ Selain tewaskan lebih dari 100 orang, Virus Corona jenis baru guncang berbagai sisi kehidupan warga dunia. Tidak hanya ekonomi, bahkan juga berpotensi goyang pariwisata Indonesia. . Semoga virusnya gak sampai ke Indonesia ya, Gais… . #Corona #Wuhan #WuhanJiayou #China #Indonesia #coronavirus
2231679034006648996; 1; False; 1580256893; I feel sick guys #memes #dankmemes #funny #hilarious #funnymemes #coronavirusmemes #coronavirus #worldwar3memes #ww3
2231679028501384751; 0; False; 1580256893; Vídeo novo no canal!! Link na bio!!! #vivendonojapao #brasileirospelomundo #brasileirosnojapão #coronavirus #japão #japan #prevencao #saude #saudeebemestar #sapiênciajapan
2231679013202742692; 0; False; 1580256891; Reposted from @leangreenie If not for your health, if not for our planet, if not for the animals then FOR WHAT? . Farmers are literally burning the lungs of our planet to clear land for cattle in the Amazon rainforest. 1 billion wildlife were killed in the Australian fires because of climate change worsening the drought, we then culled 5,000 camels because they were "drinking our water". Now we see the Coronavirus, caused by consuming and handling dead animals. . The most powerful single thing you can do to help our environment, our health and the animals is shift to a vegan diet. . . . . . . . #animalagriculture #coronavirus #amazonfires #fire #bushfires #animals #animal #australia #australian #australianfirefighters #australianfires #endsuffering #endexploitation #speciesism #animalliberation #animalactivist #animallovers #vegetarian #vegan #veganism #leangreenie#govegan #veganlove #crueltyfree #vegansofig #veganlife #vegan #animallover
2231678999235389171; 1; False; 1580256889; I’m so thankful we made it back to Indonesia before the rampant spread of the coronavirus. :face_with_medical_mask::speak-no-evil_monkey:Now, if only it will go awayyyy because we’ve got some more traveling we’d like to do before we’re officially outta here! :victory_hand_light_skin_tone: :airplane: . PSA - whatever city/country you’re in & continent you’re on, I hope you’re washing your hands religiously, not touching your face/eyes/mouth, regularly disinfecting objects/surfaces that could easily become contaminated & just trying your best to steer clear of this virus at all costs!!! :woman_gesturing_NO_medium-light_skin_tone: . . . . . #saigon #hochiminhcity #hochiminh #vietnam #travel #travelingram #traveling #travelgram #traveler #traveltheworld #wanderlust #mytravelgram #passionpassport #travelphotography #southeastasia #southeastasiatravel #iloveasia #architecture #architecturephotography #architecturelovers #coronavirus #latergram
2231678994252434462; 0; False; 1580256889; How have medical epidemics effected markets in the past? #coronavirus :microbe::man_health_worker_light_skin_tone::woman_health_worker_medium_skin_tone: . . Here you will find an illustration of the yields of the S&P500 in the first 6 months following the announcement of a virus outbreak and the performance in the following 12 months. It is important to remember that you should not take an event in isolation and make impulsive decisions about short-term market movements... . . #thefinancialespresso #finance #markets #investment #virus #riskmanagement #opportunity #think #historical #tables #charts #marketreaction #debtfree #diyinvestor #selfhelp #knowledge #financiallitteracy
2231678999570705665; 0; False; 1580256889; Esto se va a descontrolar #LaTíaJusta #Coronavirus #LaTiaJusta
2231678988002842878; 0; False; 1580256888; Destroy the commy threat - - - #meme #dankmeme #fortnitememes #memesdaily #dailymemes #funnymemes #hilariousmemes #hilarious #funny #meme #dankmeme #transformers #transformersmemes #kobebryant #coronavirusmemes #coronavirus #corona #straya #bayverse #transformersbayverse #transformersrotf #gdaymate #geewun #g1 #tfmemes #autobots #decepticons #starwars #starwarsmemes #starwarsnerd #starwarsfan
2231678987038705464; 0; False; 1580256888; FAST 9 (Trailer Release Friday)⁣ ⁣ He’s lived his life a quarter mile at a time. The Road To #F9 Concert & Trailer Drop is this Friday at 8:00PM.⁣ ⁣ Turn on post notifications⁣ ⁣ Movie Schedule : Link in bio⁣ ⁣ #SilverbirdGhana #tuesdayMotivation #Ghana #nigeria #lagos #accra #2020goals #moviepremiere #january #afro #shatta #tuesdayMood #cinema #Ghanaians #marriage #momo #sark #mendeservebetter #MichealJackson #ghanaianwedding #naijawedding #titi #tuesdathoughts #instablog #nollywood #coronavirus⁣
2231678986499415574; 0; False; 1580256888; #CoronaVirus #coronavirusoutbreak #coronavirusmemes
2231678948827690843; 4; False; 1580256883; Second slide is the saddest thing to happen to this country - - - - - - - - - - - - - - - - - - - - - - - - #meme #memes #memesdaily #dailymemes #:( #tetriscomeback #coronavirus
2231678945237812184; 0; False; 1580256883; Setelah Sunda Empire dan Keraton Sejagat, muncul "kerajaan" baru bernama King of The King di Kota Tangerang. Spanduknya yang dipasang di kawasan Poris sudah ditertibkan oleh Satpol PP. . . Pimpinan Ketua Umum IMD (Indonesia Mercusuar Dunia) Juanda mengklaim beliau adalah King of The King atau Raja Diraja dari semua raja di dunia. . . "Itu adalah Raja Diraja, nanti beliau lah yang akan melantik dari seluruh presiden dan raja-raja di seluruh dunia,". . . Juanda juga mengklaim, King of The King menduduki dua lembaga keuangan tertinggi dunia. Pertama adalah UBS atau Union Bank Switzerland dan IMD (Indonesia Mercusuar Dunia). King of The King yang sering dipanggil Mister Dony Pedro itu disebut-sebut menjabat sebagai Presiden UBS dan memiliki kekayaan Rp 60 ribu Triliun di bank tersebut. . . Juanda mengatakan, kekayaan tersebut merupakan aset yang ditinggalkan Soekarno dan resmi diserahkan kepada King of The King. Ada beberapa surat yang diklaim merupakan surat aset peninggalan Soekarno di Bank Swiss. . . Dia mengatakan kekayaan tersebut nantinya akan diambil untuk tiga hal utama. Pertama melunasi utang-utang luar negeri Indonesia, kedua membagikan kepada masyarakat Indonesia, dan ketiga untuk membeli alutsista (Alat Utama Sistem Senjata). . . "Dibagikan ke rakyat dari Sabang sampai Merauke per kepala Rp 3 miliar," kata dia. #wuhan #coronavirus #wuhanvirus Lihat Info menarik dan terbaru lainnya di @nih.info . . . . #faktaindo #beritaindonesia #berita #fakta #beritanasional #infoindonesia #infoterkini #beritaterbaru #infoterbaru #beritaterkini #beritajakarta #infojakarta #faktaterkini #videoberita #beritahariini
2231678862584225516; 0; False; 1580256873; Cidadãos americanos sendo evacuados de Wuhan por um #boeing747 da #kalittaair . #wuhan #coronavirus #wuhanvirus #aviação #EUA #American #virus #china @avioesemusicas
2231678770528376565; 0; False; 1580256862; :fire: So much for that crisis... #australia #australiafires #virus #china #corona #coronavirus #kag #maga #potus #draintheswamp #liberals #soros
2231678748121645456; 8; False; 1580256859; Coronavirus notes - Stay safe. Delivering some supplies to Chinese doctors to help curb the spread of the virus — hopefully giving doctors a somewhat safer environment to treat more people. There are already stories of people profiting and taking advantage of others during these times. Or even selling counterfeit products. As a society, battling these ever changing viruses are hard enough. Let’s use 2020 as a true rallying point to come together and be more systematic at preparation, preventing, and treating widespread illness. At the end of the day, our DNA binds us together and viruses don’t discriminate. #coronavirus #cdc #who #health #virus #china
2231678722462174521; 1; False; 1580256856; #coronavirus :wolf_face::new_moon:
2231678677574220814; 7; False; 1580256851; Le #coronavirus c’est soft comparé à ça :microbe: #memes #memecine #familymedicine #internalmedicine #congres #surgery #medicine #residency
2231678632971282040; 5; False; 1580256846; كل شيئ يحدد لسبب ما .... ارض الوطن :Iraq::pleading_face: - - - - - #iraq:Iraq: #autogramtags #iraqfashionpost #iraqia #bagdad #style #fashionstyle #fashionable #shopping #explorers #exblore #اجنبي #بوست #ootdfashion #outfitoftheday #wiwt #ootdstyle #shanghai #china:China: #visitchina #chinadestinations #hijabfashion #hijabstyle #hijabtrend #hijabi #wintertime #snow #coldday #snowy #coronavirus
2231678566985688512; 0; False; 1580256838; Post muto #lepancine #coronavirus
2231678535494712396; 3; False; 1580256834; @vadhird cuídate solo toma modelo. #coronavirus #modelotime #keepittrucha
2231678537761498548; 0; False; 1580256834; #chine #virus #protection #info #coronavirus #prevention #paris #information #china #wuhanvirus #wuhan #help
2231678492546940705; 0; False; 1580256829; CORONAVÍRUS PODE TER CHEGADO AO PARANÁ, CASO SUSPEITO EM #CURITIBA. O Ministério da Saúde confirmou no fim da tarde de hoje (28) que o Brasil tem três casos suspeitos de coronavírus. Além de uma estudante de 22 anos, que está internada em Belo Horizonte, mais duas pessoas têm suspeitas de portar o vírus. Uma delas está em Porto Alegre (RS) e outra em #Curitiba (PR). Segundo o ministério, esses pacientes se enquadram na atual definição de caso suspeito. Eles apresentaram febre e pelo menos um sinal ou sintoma respiratório; além de terem viajado para a China, país onde a contaminação teve início, nos últimos 14 dias. O ministério não ofereceu mais detalhes sobre os casos. Dados do ministério apresentados na manhã desta terça-feira mostraram que, no período de 3 a 27 de janeiro, foram analisados 7.063 suspeitas de pessoas com coronavírus no Brasil. Desses, 127 exigiram a verificação mais detalhada e apenas o caso da estudante em Belo Horizonte havia sido enquadrado como suspeita. Diante da epidemia que tem se espalhado rapidamente pela Ásia e atingindo também países da Europa e da América do Norte, o ministério recomenda que os brasileiros evitem viagens à China. O ministro Luiz Henrique Mandetta pediu para que as viagens apenas sejam realizadas se forem necessárias. “Nós desaconselhamos e não proibimos as viagens para a China. Não se sabe, ainda, qual é a característica desse vírus que é novo; sabemos que ele tem alta letalidade. Não é recomendável que a pessoa se exponha a uma situação dessas e depois retorne ao Brasil e exponha mais pessoas. Recomendamos que, não sendo necessário, que não se faça viagens, até que o quadro todo esteja bem definido”, disse durante entrevista à imprensa. #coronavirus #parana #curitiba #portalcambe
2231678459965716200; 0; False; 1580256825; :rolling_on_the_floor_laughing:c:rolling_on_the_floor_laughing:h:rolling_on_the_floor_laughing:i:rolling_on_the_floor_laughing:n:rolling_on_the_floor_laughing:a:rolling_on_the_floor_laughing:№1:rolling_on_the_floor_laughing: • • • • meme constructed by @tiffanys_days • • • •:backhand_index_pointing_down: Follow @smd_meme if u want sum more • • • • #china #shanghai #china:China: #coronavirus #ebola #chinatown #dank #memez #ayy #lmao #dankmemes #daily #memeo #funny #memester #smd_meme #dankmemesdaily #memestgram #xd #lmfao #funnypictures #dailyjokes #dailymemes #memesdaily
2231678454621816839; 0; False; 1580256824; Love conquers all :red_heart::loudly_crying_face::exclamation_mark: • • • #virus #malware #windows #coronavirus #hiv #cybersecurity #bacteria #china #microbiology #hospital #science #wuhan #pediatr #cerrahginekoloq #program #ginekoloq #psixoloq #canli #sunimayalanma #ortoped #ginekoloqcerrah #qadinxestelikleri #erroziya #azerbaijan #urek #baku #travmatolo #xestexana #coronavirusoutbreak
2231676079949572738; 0; False; 1580256804; Urgjencë shëndetësore në Kinë: një person duke dhënë shpirtë me koronavirus në spitalin Wuhan. #albania #kosova #tirana #tiranacity #prishtina #prishtinacity #shqiperia #coronavirus #cina #china #wuhan
2231678276196121503; 1; False; 1580256803; Love conquers all :red_heart::loudly_crying_face::exclamation_mark: • • • #virus #malware #windows #coronavirus #hiv #cybersecurity #bacteria #china #microbiology #hospital #science #wuhan #pediatr #cerrahginekoloq #program #ginekoloq #psixoloq #canli #sunimayalanma #ortoped #ginekoloqcerrah #qadinxestelikleri #erroziya #azerbaijan #urek #baku #travmatolo #xestexana #coronavirusoutbreak
2231678222005043202; 0; False; 1580256797; I’m not tho... :eyes: - - - - - #coronavirus #memes #meme #funny #explore #explorepage #quote #quotes #viral #instagram #offensivememes #dankmemes #follow #humor #lol #lmao #comedy #edgymemes #fun #memesdaily #daily #relatable #dank #entertainment #kobe #twitter #memestagram #memepage #like #trending
2231677675947296520; 0; False; 1580256790; Leaked Texts Show Coronavirus Is Much Worse Than We Thought via @informoverload (Full Video) On My Website www.LIFEANDENTERTAINMENT.com #awareness #coronavirus #biowarfare
2231678139008570906; 0; False; 1580256787; DM FOR YOUR TOONS, ALBUM COVERS, DESIGNS and LOGOS. We are ever ready and have the fastest delivery time... Take a shot for the gram. KingRayThaArtist got you covered.. #toonme #happy #mood #love #holiday #vacation #relationshipgoals #relationshipgoals #cool #shotoniphone #couplegoals #cartoon #cool #love #peace #6lack #drake #coronavirus #laughter #smile #girls
2231677978851771183; 0; False; 1580256780; #coronavirus chegando no Brasil
2231678021793041404; 0; False; 1580256773; Damn it be like that sometimes #coronavirus #memesdaily #dankmemes #thicc #meme #china
2231677966420868083; 0; False; 1580256766; Info útil para los extremistas https://t.co/vHvTkFj8eN #coronavirus #sars #mers #coronavirusecuador #información
2231677925820981353; 0; False; 1580256761; Love conquers all :red_heart::loudly_crying_face::exclamation_mark: • • • #virus #malware #windows #coronavirus #hiv #cybersecurity #bacteria #china #microbiology #hospital #science #wuhan #pediatr #cerrahginekoloq #program #ginekoloq #psixoloq #canli #sunimayalanma #ortoped #ginekoloqcerrah #qadinxestelikleri #erroziya #azerbaijan #urek #baku #travmatolo #xestexana #coronavirusoutbreak
2231677913783369689; 2; False; 1580256760; Migo, qual vai ser seu look do carnaval? Eu: #humor #piadas #engraçados #memebrasil #coronavirus #lascados
2231677862738658595; 2; False; 1580256754; Coincidencias? Sería una prueba más de como llenan el inconciente de mensajes planeados para luego llevarlos a cabo... Entiendan de una vez que nos gobiernan psicópatas. ("propagamos un virus y luego comercializamos las vacunas que necesitarás" ) Definición de anagrama Así pues el origen de la palabra “anagrama” proviene del latín “anagramma” y ésta a su vez del griego “ἀνάγραμμα”. Si queremos decifrar el significado de la palabra “anagrama” de su origen griego encontraremos que el prefio “ana-“ significa movimiento hacia atrás o de vuelta y “gramma” que significa “letra”. Los anagramas tienen su origen ya en la antigüedad. Los pueblos hebreos y judíos utilizaban anagramas para decifrar escrituras secretas a través del cábala. De igual manera los anagramas eran usados por los griegos y romanos. Sin embargo el poeta y literato griego Licofrón de Calcis del siglo III a. C es conocido como el inventor de los anagramas. Historicamente es conocida la anécdota de su vida en que éste formó un anagrama del nombre del emperador egipcio Ptolomeo (en escritura griega) resultando de éste un elogio agradable para el emperador. #coronavirus #billgates #umbrella #subliminal #inconciente #despertar #masoneria #nuevoordenmundial #noalnuevoordenmundial #newworldorder #fucknewworldorder #antisistema
2231677807675344374; 0; False; 1580256747; :police_car_light:Ahora que el #coronavirus está en alerta mundial tomemos aún más conciencia de la importancia de enseñar este hábito en casa. :grinning_face_with_sweat:Confieso que en ocasiones de "abollo" total en casa, se me ha olvidado recordarles a alguno de los 3 niños que se laven las manos :woman_facepalming_medium_skin_tone: :person_raising_hand_medium_skin_tone:Estaré más pendiente :hand_with_fingers_splayed_medium-light_skin_tone::sweat_droplets: :white_heavy_check_mark:Al llegar de la calle/parque/colegio :white_heavy_check_mark:Antes de cada comida :white_heavy_check_mark:Al botar basura :white_heavy_check_mark: Al ir al baño :thinking_face:Qué otra ocasión importante? . . :sweat_droplets::hand_with_fingers_splayed_medium-light_skin_tone:Le has enseñado a tus hijos a lavarse las manos y su importancia? Déjenme un :person_raising_hand_medium_skin_tone: y si te falta ponerle más atención déjame un :woman_facepalming_medium_skin_tone: Confienso ser un poco descuidada :flushed_face::see-no-evil_monkey: . . :purple_heart:Riega la voz :speaking_head:mientras más conciencia, más salud! Menciona :backhand_index_pointing_down_medium_skin_tone:comparte :raising_hands_medium_skin_tone: :police_car_light:Recuerda hablar con tus niños sobre los virus y las bacterias, entenderán más y será más fácil convencerlos :winking_face_with_tongue: #habitossaludables #coronavirus #habitossanos #alertamundial #superacion #creatividad #crianza #maternidad #maternidadreal #crianzarespetuosa #montessori #superacionpersonal #disciplinapositiva #mamadetres #apoyoemocional #panama #pty #panamacity #venezolanosenpanama #autoestima #tips #mamareal #actividadesparaniños #mamabloguera
2231677743695470130; 0; False; 1580256740; DM FOR YOUR TOONS, ALBUM COVERS, DESIGNS and LOGOS. We are ever ready and have the fastest delivery time... Take a shot for the gram. KingRayThaArtist got you covered.. #toonme #happy #mood #love #holiday #vacation #relationshipgoals #relationshipgoals #cool #shotoniphone #couplegoals #cartoon #cool #love #peace #6lack #drake #coronavirus #laughter #smile #girls
2231677711692519287; 0; False; 1580256736; #doomsdayclock #endofdays #gabrielshorn #fourhorsemen #rapture #endoftheworld #wearefucked #wildfires #nuclearwar #locusts #earthquakes #climatechange #climatechangeisreal #crisis #doomsday #notaprepper #weather #coronavirus
2231677686567375561; 1; False; 1580256733; I don’t understand why they haven’t acted sooner on this, we need to act now if we’re going to combat this virus.
2231448659432787359; 0; False; 1580256728; Nigeria ranked one of the most corrupt countries in the world, an AI predicted coronavirus and much more on @askifa.ng with @tide_creme #Askifadaily #coronavirus #samsungs20 #galaxys20 #artificialintelligence #nigeria #mostcorrupt
2231677625582146388; 0; False; 1580256725; Good luck to these #Skema students I met in Shanghai! They came to #Shanghai recently for some abroad study opportunity and were forced to go back to France because of the #CoronaVirus outbreak. The visa is lost when one leaves China... Picture 1: Victor, William and Lara. Picture 2: Anne-Laure, Chris and Joachim.
2231677602490573804; 1; False; 1580256723; "Mencegah Sebelum Kena" . Masih tak tahu mengenai simtom CORONAVIRUS? . ini info tepat untuk anda. . "Share info ini untuk memberi manfaat kepada semua" . #coronavirus #info #stayhealthy
2231677594686803662; 0; False; 1580256722; #tipsparenting #parenting #parentingislami #parentinganak #parentingislam #parentingnabawiyah #belajarparenting #tipsorangtua #parentingquotes #tipsmendidikanak #ilmuparenting #polaasuh #tipsparentinganak #infoparenting #anakpintar #tipsmpasi #mpasimenutunggal #mpasi4bintang #tuturmama #berbagiresepmpasi #mpasiid #corona #coronavirus #raffiahmad #rinanose #nikitamirzani
2231677523260131532; 0; False; 1580256713; O vírus que infectou recentemente um crescente número de pessoas na China e que tem sido noticiado por todo o mundo, é um coronavírus. Os coronavírus são um grupo de vírus conhecidos por causar doenças que podem ir de um simples resfriado à pneumonia atípica. . :face_with_medical_mask: O modo de transmissão do vírus só acontece entre humanos, através do ar, da tosse ou espirros, através do toque com outra pessoa ou do contato físico com objetos e superfícies contaminadas. Por este motivo, e pelo fato de que nesta altura do ano milhares de pessoas viajarem para outros países . . :backhand_index_pointing_right: Os sintomas que podem surgir com a infecção por este coronavírus são semelhantes aos da pneumonia, como tosse, febre e dificuldades respiratórias. Em alguns casos pode mesmo ser fatal, principalmente em pessoas com saúde debilitada. . O Brasil apresenta 3 casos de suspeita do vírus sendo um deles no Paraná, com isso passa a se enquadrar no nível 2 (de perigo iminente) quando há suspeitas e não mais no nível 1 que seria de alerta. A partir da confirmação de um caso da doença o país entra no nível 3. . #laboratorio #analisesclinicas #exames #exameslaboratoriais #MaisVida #saude #coronavirus #virus
2231677523987955396; 1; False; 1580256713; VANS PEREKAT . Ready size insole: 21: 15cm 22: 15,5cm 23: 16cm 24: 16,5cm 25: 17cm (Rp 150.000,-) . 26: 17,5cm 27: 18cm 28: 18,5cm 29: 19cm 30: 19,5cm (Rp 155.000,-) . 31: 20cm 32: 20,5cm 33: 21,5cm 34: 22cm 35: 22,5cm 36: 23cm (Rp 160.000,-) . Kemungkinan error 0.5 - 1 cm . Pastikan mengecek size sebelum melakukan transfer. Karena kami TIDAK melayani penukaran size :) . Mohon untuk mengirim ulang gambar yang akan di order. Agar meminimalisir kesalahan orderan :) ­­­ . For order : WA: 081339157676 . #sepatuanak #sepatuanaklucu #sepatuanakbranded #sepatuanakmurah #sepatuanakcewek #sepatuanakimport #sepatuanaksport #sepatuanakled #sepatuanakboot #sepatuanakperempuan #jualsepatuanakmurah #jualsepatuanak #sepatuanakcowok #tipsparenting #mpasi #coronavirus #maiaestianty #raffinagita
2231677457434846041; 13; False; 1580256705; :see-no-evil_monkey:
2231677420708302733; 0; False; 1580256701; The Wuhan coronavirus is a worrisome pandemic affecting many areas in the world. To ensure the safety of our clients, our limousines are disinfected with alcohol wipes after every trip. In the mean time, we remind all to don a surgical mask and practise good hand hygiene! #best #limo #hand #hygiene #disinfection #wuhan #virus #coronavirus #corona #transit #airport #limousine #safety
2231677377147028049; 0; False; 1580256696; DM FOR YOUR TOONS, ALBUM COVERS, DESIGNS and LOGOS. We are ever ready and have the fastest delivery time... Take a shot for the gram. KingRayThaArtist got you covered.. #toonme #happy #mood #love #holiday #vacation #relationshipgoals #relationshipgoals #cool #shotoniphone #couplegoals #cartoon #cool #love #peace #6lack #drake #coronavirus #laughter #smile #girls
2231677315147362213; 4; False; 1580256688; How do you feel when you see this picture. ? #coronavirus #whatsinyourpocket #wuhancoronavirus
2231677290650325078; 1; False; 1580256686; No Brasil, o Ministério da Saúde colocou o país em alerta para o risco de transmissão do novo coronavírus. Até o momento, é considerado como caso suspeito do novo coronavírus, paciente com sintomas da doença como febre, tosse e dificuldade para respirar. Além disso, o paciente precisa ter viajado para área com transmissão ativa do vírus nos últimos 14 dias antes do início dos sintomas. __ :light_bulb:É um vírus que tem causado doença respiratória pelo agente coronavírus, recentemente identificado na China. Para redução do risco de adquirir ou transmitir doenças respiratórias, especialmente as de grande infectividade, orienta-se que sejam adotadas medidas gerais de prevenção, como realizar frequente higienização das mãos, principalmente antes de consumir alimentos, utilizar lenço descartável para higiene nasal, cobrir nariz e boca quando espirrar ou tossir, evitar tocar mucosas de olhos, nariz e boca. Além disso, não compartilhar objetos de uso pessoal, como talheres, pratos, copos ou garrafas, manter os ambientes bem ventilados, etc. __ :light_bulb:Cuide da alimentação, vamos cuidar da IMUNIDADE!!! Seu intestino é responsável por cerca de 80% da imunidade. Cuide dele através da alimentação, inclua fibras no seu dia a dia, probióticos (kefir, iogurte natural), alimentos antioxidantes e muita água. . . . . . . . . . . . #crossfitrecife #btrecife #sop #candidiasevaginal #endometriose #colicasmenstruais #tentantes #emagrecimentorecife #lowcarb #jejumintermitente #cetogenica #milagredojejum #recife #pina #shoppingriomar #riomarrecife #riomartradecenter #emagrecimentorecife #smartfit #blacklions #unbroken #nutricionistarecife #desinchar #coronavirus #coronavirus #wuhan #china #oms
2231677283496558949; 0; False; 1580256685; @t_doe_91 Straight up carnal #modelotime #modelo #coronavirus #Fuckdying
2231677254656346244; 0; False; 1580256681; Repost from @redehiperfarma using @RepostRegramApp - O novo coronavírus vem assustando o mundo pela velocidade com que se espalha. Ele pode causar desde um resfriado comum até síndromes respiratórias graves. Recém nascidos e idosos são mais sensíveis aos sintomas. Veja as principais orientações da Sociedade Brasileira de Infectologia para evitar infecções por vírus: 1) Evitar contato próximo com pessoas com infecções respiratórias agudas; 2) Lavar frequentemente as mãos, especialmente após contato direto com pessoas doentes ou com o meio ambiente e antes de se alimentar; 3) Usar lenço descartável para higiene nasal; 4) Cobrir nariz e boca ao espirrar ou tossir; 5) Evitar tocar nas mucosas dos olhos; 6) Higienizar as mãos após tossir ou espirrar; 7) Não compartilhar objetos de uso pessoal, como talheres, pratos, copos ou garrafas; 8) Manter os ambientes bem ventilados; 9) Evitar contato próximo com animais selvagens e animais doentes em fazendas ou criações. #RedeHiperfarma #CuidandoDeVocêESuaFamília #PrevençãoÉAqui #Hiperatendimento #coronavirus
2231677152390467170; 0; False; 1580256669; With the rising concern of the Coronavirus worldwide, some people, especially travelers and those working in the tourism industry, are choosing to forgo the traditional handshake as the virus can easily be spread by touch. After coming into contact with the virus on a surface (such as a door handle or currency), it can live of the palm of the hand or inside of fingers then easily passed on to others. Instead, you may encounter individuals or choose to yourself, 'fist pump' or pleasantly signal a 'preference not to have contact' with the gentle raise of a hand and a universally known kind smile. Please be conscious and courteous of this in your travels locally and abroad. #yqrtravel #yqrtravelagent #yqrtravelagency #safetravels #coronavirus #travelprotection #precaution #yourhealthmatters #stayhealthy #traveltheworld #travelsafe #worldtraveler
2231677014339673309; 0; False; 1580256653; Waspada Virus Corona! . Belakangan ini, topik mengenai kasus virus corona yang mewabah di wilayah Cina sedang merebak di berbagai media. . Topik tersebut berhasil membuat semua orang yang mengetahuinya merasa khawatir. . Tetap tenang, Sahabat. Virus ini bisa dicegah. . https://mandiribersama.org . #mandiribersama #semuabisamandiri #virus #corona #coronavirus #respiratorysystem #mers #sars #who #yatimmandirijakartatimur
2231676386376853618; 0; False; 1580256639; :crown::crown::crown:THE BREAD FELLOWS PODCAST:crown::crown::crown: . Episode 11 is now UP! It's food for thought, with some added spice. Ha! . In this clip, we are calling out ALL sistahs that are purposely destroying the black household, using their children as pawns and punishing stand up fathers! . Also on this episode, we talk about "purpose" vs "calling", "complacency" vs "contentment", the Chinese "Bat Soup" virus and MUCH more!!! . so PULL UP and BREAK BREAD!!! Youtube link in BIO!!! @breadfellowspodcast #LetTheWordBeHeard #TheBreadFellowsPodcast #BreadFellowsTV #WEgotSomeThingsToSay #fathers #mothers #coronavirus #WEgottaDoBetter #fortheculture #podcasts #currentevents #urban #nyc #thelastsupper #breakbread #impact #usneverthem #news #roundtable #nycpodcast #QAMyasharahla #WEthreeForHe #stateoftheculture #media #companion #brotherhood #wearetherevolution #bethechange
2231676872245593234; 0; False; 1580256636; Hablando tanto de #coronavirus en estos días, lo mas importante es la #prevencion :sneezing_face: Recomendados estos consejos de @acorlco
2231676821712436663; 5; False; 1580256630; Ce virus qui a causé cette maladie a été dénommé 2019-nCoV. Identifié en Chine. Un virus de la famille coronavirus. Faut prier pour le pays:folded_hands: Faut prier pour le monde:folded_hands: . . . Un mot pour les gens qui l'ont déjà attrapé :writing_hand: :red_heart:Double tape si ce post t'a aidé. N'oublie pas de le partager:man_raising_hand:tu peux aider quelqu'un sans même le savoir. . . . Follow @clapclap460 Follow @clapclap460 Follow @clapclap460
2231676821787391933; 1; False; 1580256630; Stop misinformation, wear your masks and wash your hands thoroughly. Ema > Evelyn > my baby #coronavirus #australiabushfires #wuhanvirus
2231676806025737622; 1; False; 1580256628; Beyaz Saray, ABD ve Çin arasındaki uçuşları askıya almayı düşünüyor. #amerikaliturkler #amerikadahaber #amerikadayasayanturkler #amerikadayasam #amerikahaber #washingtondc #trump #turkey #türkiye #corona #korona #virüs #coronavirüs #hastalık #virus #coronavirus #haber #haberler #çin #china #wuhan #güncel #güncelhaber #güncelhaberler #coronaviruses #coronaviruese
2231676706039627612; 4; False; 1580256616; • Os vírus são agentes infecciosos muito pequenos, menores que qualquer célula, 10 a 350 milimicra de diâmetro (é muito pequeno). Eles são basicamente pacotes de ácido nucleico e proteína. Possuindo um capsídeo (proteínas que formam uma espécie de capa) e material genético (podendo ser de DNA ou RNA). Alguns vírus ainda podem possuir envelope (que é uma membrana plasmática). Como eles não conseguem se reproduzir sozinhos (sem um hospedeiro, ou seja, uma célula), os vírus não são considerados seres vivos. Eles são basicamente pacotes de ácido nucleico e proteína. Alguns pesquisadores se referem a eles como os Zombies da microbiologia (loco né). Ah existem milhões de vírus que infectam milhões de tipos celulares. #virus #virose #estruturaviral #virologia #microbiologia #parasitas #coronavirus
2231676699456942227; 0; False; 1580256615; O Ministério da Saúde divulgou hoje que há 3 brasileiros suspeitos de terem contraído o Coronavírus. Conheçam os protocolos recomendados pela OMS para previnir o contágio do coronavírus. . :hot_springs:Lave sempre as mãos com água e sabão ou álcool em gel. . :prohibited:Ao tossir ou espirrar cubra o nariz e a boca com um papel ou com o com os braços com o cotovelo flexionado. . :cross_mark:Evite contato com pessoas que possuem sintomas de gripes ou resfriados. . :name_badge:Cozinhe bem todos os alimentos. . :cross_mark:Evite contato com animais silvestres sem proteção adequada. #oms #coronavirus #prevenção #dicasparaviajantes
2231676383600636960; 2; False; 1580256611; This kid is not messing around! :beer_mug::test_tube: #corona #coronavirus #ronavirus
2231676662538067804; 0; False; 1580256611; Aga be adam yine ölmüş . . . . . . . . . . . . . Etiketler : #adam #caycihuseyin #coronavirus #hayallet #deprem #elazig #ekonomi
2231676652914723307; 0; False; 1580256610; Infected soldier of NBCP Troops (Nuclear, Biological and Chemical Protection troops of the Russian Armed Forces). The 4th level of biological hazard. Location: Blagoveshchensk. . . . . . #glitchhorror#horror#unnervingimage#cursedimage#art#glitch#glitchart#creepy#aesthetic#digitalart#warart#deathfiles#creepystuff#biohazard#biologicalhazard#NBCP#NBCPtroops#russianarmy#coronavirus#art#spookyart#vhs#vhsaesthetic#vhsart#art#scaryart#blagoveshchensk#russia
2231676640265876995; 0; False; 1580256608; O surto do novo coronavírus deixou o mundo todo em estado de alerta. Com mais de 4.500 pessoas infectadas e mais de 100 mortes confirmadas, a China tenta conter a propagação da doença. Considerada o epicentro da contaminação, a cidade de Wuhan se encontra em quarentena, com hospitais lotados e com a missão arrojada anunciada na semana passada: construir um hospital com cerca de 1.000 leitos em 10 dias. O governo chinês anunciou a construção de 2 hospitais de emergência para atender aos novos casos do surto, e a obra do primeiro já começou e tem data para inaugurar, 3 de fevereiro. O hospital seguirá o modelo de construção modular pré fabricada, o mesmo utilizado em Xiaotangshan, Pequim em 2003 durante o surto de SARS. Vale ressaltar que o caráter das construções são emergenciais e que muito provavelmente após o controle e normatização da situação, serão desativadas como em Pequim. Em situações extremas como essa, apenas com a tecnologia da construção modular conseguimos feitos como esse. Mil novos leitos, com isolamento e todos os equipamentos e recursos necessários para o controle e combate à doença em 10 dias. É surreal pensar na loucura da produção, mas é mais ainda pensar em quantas vidas serão salvas com esse método ágil. Imagine essa mesma situação sem essa possibilidade. O contágio, a demanda por leitos, medicamentos e atendimento, áreas de isolamento provisórias e precárias. Quanto tempo a mais levaria para conter um como esse? Um feito desses, juntamente com toda a parte de pesquisa e esforços médicos, é crucial para salvar uma população. #construcao #construçãomodular #arquiteturamodular #coronavirus
2231676609647516607; 0; False; 1580256604; 눈코입을 통해 모두 감염 된다니 이번 주말엔 애들 이 마스크 씌워서 다녀야겠어요ㅜㅜ #그렇다고집에만있을수도없고 #스네프 #스노클링마스크 #sneff #우한폐렴 #코로나바이러스 #coronavirus #우리아이성장주치의 #눈금 #초등학교방학 #초등방학생활
2231676459994602906; 2; False; 1580256587; #건강최고 제가 그닥 깔끔한 편은 아닌데 마스크나 손씻기로만 안심이 덜되서 알콜소독솜도 구입해 봅니다~ 가격도 저렴하고 가방이나 지갑속에 넣어다니기도 좋은 사이즈라 괜찮네요:thumbs_up: 역시 불안할 땐 뭐라도 쟁여둬야 안심이 되는 자본주의병:face_savoring_food::face_savoring_food: . #뉴클린스왑#의료기장터#알콜솜#일회용 #코로나바이러스#우한폐렴#중국폐렴 #대한민국에서사라져라#coronavirus #마스크#손씻기#개인위생#멸균#소독 #무서워#모두모두#안전하게#일상템
2231675439008845506; 0; False; 1580256585; Not on my watch Bill Gates :face_with_monocle::syringe: #coronavirus #dontbelievethehype
2231676378961901787; 0; False; 1580256577; Coronavirus dengan mutasi sekunder yang baru. Lebih dasyat dari apa yang dilihat. Beware!!! #coronavirus #mutation #supervirus #besafe #bestrong #world #2020
2231676343704073088; 1; False; 1580256573; DM FOR YOUR TOONS, ALBUM COVERS, DESIGNS and LOGOS. We are ever ready and have the fastest delivery time... Take a shot for the gram. KingRayThaArtist got you covered.. #toonme #happy #mood #love #holiday #vacation #relationshipgoals #relationshipgoals #cool #shotoniphone #couplegoals #cartoon #cool #love #peace #6lack #drake #coronavirus #laughter #smile #girls
2231676318478810067; 0; False; 1580256570; #coronavirus #meme #funny #sparecoochie #corona:beer_mug: #science #asians
2231676274582461291; 0; False; 1580256564; Esto le faltó al otro :v . . . . . . #coronavirus #residentevil #idk
2231676256571611487; 4; False; 1580256562; Quem é Curitibano levanta a mão #coronavirus #humor #memes #Curitiba #cidade #vírus #interagir
2231675686985132962; 3; False; 1580256559; El JOVIE CABE, fue víctima del CORONA-VIRUS... acompáñenme a ver esta triste historia :face_with_tears_of_joy::face_with_tears_of_joy::face_with_tears_of_joy::face_with_tears_of_joy::face_with_tears_of_joy::face_with_tears_of_joy: . . Patrocinan: @licoresexpressoficial @hector_padilla_ @santahelena_barbershop @albeiro_barberstudio @ostreriaelchavo @lacheka :movie_camera: @elcomelin @el_embalaito @elcabe7 #videosderisa #barranquilla #solohumor #coronavirus
2231676125071238819; 0; False; 1580256547; Do you know Coronavirus (2019-nCoV) is a new virus with no available vaccine or medicine? Here are 3 simple ways to prevent transmitting virus to others. #coronavirus #2019nCoV #sihatmilikku #walkthetalk
2231676117269844161; 0; False; 1580256546; #keepmesafe #coronavirus #wuhanvirus
2231676062744230400; 1; False; 1580256539; 5th day of cny Back to :school:, :office_building: Taking temperature, wearing :face_with_medical_mask:, Drink more :potable_water:, avoid crowded places. Wash hands :folded_hands::folded_hands::folded_hands: #coronavirus #health
2231676049130018170; 0; False; 1580256538; Kimchi Warrior VS. Virus :leafy_green::leafy_green::leafy_green::leafy_green::leafy_green::leafy_green::leafy_green::leafy_green::leafy_green::leafy_green::leafy_green::leafy_green: Have you ever heard of #KimchiWarrior Warrior? Have you ever tried Kimchi? Please subscribe my Channel https://www.youtube.com/user/KimchiWarrior1 #kimchiwarrior #gochugirl #webseries #Animation #cartoon #kids #characters #cosplay #Costumes #comiccon #서코 #코스프레 #김치워리어 #고추걸 #김치워리어코스프레 #애니메이션 #onggibot #BTS #onggi #옹기봇 #옹기 #강영만 #youngmankang #swineflu #koreanfood #bts #coronavirus @herosong7777
2231676041957916707; 0; False; 1580256537; Do you know Coronavirus (2019-nCoV) is a new virus with no available vaccine or medicine? Here are 3 simple ways to prevent transmitting virus to others. #coronavirus #2019nCoV #sihatmilikku #walkthetalk
2231676027476860210; 0; False; 1580256535; #coronavirus
2231676008636148699; 0; False; 1580256533; Do you know Coronavirus (2019-nCoV) is a new virus with no available vaccine or medicine? Here are 3 simple ways to prevent transmitting virus to others. #coronavirus #2019nCoV #sihatmilikku #walkthetalk
2231675986372663034; 1; False; 1580256530; Um motorista de ônibus japonês foi infectado com o novo coronavírus após ter contato com turistas chineses, disseram autoridades na terça-feira, o primeiro caso relatado de uma possível transmissão dentro do Japão. O motorista, com idade entre 60 e 69 anos, residente na província de Nara, transportou dois grupos de turistas da cidade de Wuhan, onde se concentra o surto de coronavírus, entre 8 e 16 de janeiro, informou o Ministério da Saúde do Japão. O caso aumenta preocupações sobre a propagação do vírus que surgiu em Wuhan no final do ano passado, matando 106 pessoas e infectando mais de 4.500. A confirmação de qualquer disseminação sustentada do vírus de humano para humano fora da China, bem como de mortes, reforçaria o argumento do Comitê de Emergência da Organização Mundial da Saúde para considerar novamente se deve declarar uma emergência de saúde pública de interesse internacional. O motorista japonês transportou turistas entre Tóquio e Osaka e começou a apresentar sintomas em 14 de janeiro. Ele foi hospitalizado 11 dias depois em Nara, segundo o Ministério da Saúde. Quando transportou o primeiro grupo de chineses, ele não estava usando máscara, informou a emissora NHK. O governo não divulgou o trajeto do ônibus entre Tóquio e Osaka e nem os hotéis em que os turistas ficaram hospedados. Uma autoridade do ministério disse em entrevista coletiva que o motorista teve contato próximo com 18 pessoas depois de ter contraído o coronavírus, incluindo familiares e colegas de trabalho, e que todas elas estão sob observação. Foto: Reuters Pedestres usam máscara de proteção em um bairro comercial de Tóquio Acesse o nosso site na seção de notícias > Japão para ler a matéria completa :backhand_index_pointing_right: www.alternativa.co.jp #alternativaonline #coronavirus #chinesesnojapao
2231675872354605338; 1; False; 1580256516; The number of confirmed cases of the deadly coronavirus in Australia is continuing to grow, with symptoms ranging from feeling "very, very, ill" to just "mildly unwell". If you have any concerns, get in touch with a healthcare professional immediately. :face_with_medical_mask:
2231675866173944210; 0; False; 1580256516; DM FOR YOUR TOONS, ALBUM COVERS, DESIGNS and LOGOS. We are ever ready and have the fastest delivery time... Take a shot for the gram. KingRayThaArtist got you covered.. #toonme #happy #mood #love #holiday #vacation #relationshipgoals #relationshipgoals #cool #shotoniphone #couplegoals #cartoon #cool #love #peace #6lack #drake #coronavirus #laughter #smile #girls
2231675862247778539; 1; False; 1580256515; :cyclone::face_with_monocle: •⁣ Send this to a friend:cyclone: •⁣ •⁣ #meme #memes #ps4 #wshh #hood #coronavirus #funny #xbox #dankmemes #offensivememes #edgymemes #spicymemes #69 #memepage #gaming #dank #memesdaily #shitpost #dankmeme420 #hiphop #witcher #worldstar #grapejuiceboys #playstation #kobe #sexy #corona #weed #reddit #420
2231675856435374820; 1; False; 1580256515; “Did you visit Wuhan in the last two weeks?” :man_gesturing_NO_light_skin_tone: #coronavirus #yeowoozit #moistboi
2231675791220215810; 2; False; 1580256507; Stay safe everyone #coronavirus #notupinhere
2231675204596152138; 0; False; 1580256500; Gn #dankmemes #memes #meme #dankmeme #cod #codmemes #codzombiesmemes #codzombies #corona #coronavirus #coronavirusmemes #coronavirusoutbreak #china #chinamemes #funny #funnymemes
2231675733130764407; 0; False; 1580256500; BILL GATES in (Munich, Germany) ALLUDED in 2017 TO THE COMING EMERGENCE OF A Designer Virus that would Exterminate 30 Million!!!! #billandmelindagatesfoundation #billgatesquotes #coronavirus #pneumonicplague #newyorktimes #worldhealthorganization #cdc #news #plague2020 #eschatology #biowar #eugenics #china #globalepidemic #science #epidemiology #aignerauryyel #agenda21 #agenda2030 #world #currentaffairs #exitthematrix #matrix2020 #aliceinwonderland #wuhan #wuhanchina #beijing #germwarfare
2231675696479030586; 0; False; 1580256496; BILL GATES in (Munich, Germany) ALLUDED in 2017 TO THE COMING EMERGENCE OF A Designer Virus that would Exterminate 30 Million!!!! #billandmelindagatesfoundation #billgatesquotes #coronavirus #pneumonicplague #newyorktimes #worldhealthorganization #cdc #news #plague2020 #eschatology #biowar #eugenics #china #globalepidemic #science #epidemiology #aignerauryyel #agenda21 #agenda2030 #world #currentaffairs #exitthematrix #matrix2020 #aliceinwonderland #wuhan #wuhanchina #beijing #germwarfare
2231675655383921202; 0; False; 1580256491; Marc gihadbauer . . . . . . . #funnyvideos #haha #memes #illness #china #blackhumor #haha #witzig #alman #memes #keller #likeforlikes #likeforfollow #wuhan #virus #corona #coronavirus #deutschrap #tiktokmemes #tiktokgirls #tiktok #alman #almanmemes #capitalbra #nimo #mero428 #kmn
2231675661668318101; 0; False; 1580256491; BILL GATES in (Munich, Germany) ALLUDED in 2017 TO THE COMING EMERGENCE OF A Designer Virus that would Exterminate 30 Million!!!! #billandmelindagatesfoundation #billgatesquotes #coronavirus #pneumonicplague #newyorktimes #worldhealthorganization #cdc #news #plague2020 #eschatology #biowar #eugenics #china #globalepidemic #science #epidemiology #aignerauryyel #agenda21 #agenda2030 #world #currentaffairs #exitthematrix #matrix2020 #aliceinwonderland #wuhan #wuhanchina #beijing #germwarfare
2231675548604990053; 0; False; 1580256478; Please read! - - #cosplay#cosplayersofinstagram#cosplayers#coronavirus
2231675499213908793; 1; False; 1580256472; follow me for more content @phrog.exe • • • tags: #meme #memes #funny #dankmemes #memesdaily #funnymemes #lol #dank #ww3memes #like #follow #lmao #dankmeme #edgymemes #offensivememes #corona #fortnite #comedy #dailymemes #edgy #coronavirus #frog #funnymeme #instagram #jokes #tiktok #haha #phrog #iran #trump
2231674756964737941; 0; False; 1580256472; People are fighting over face masks in #Shanghai, #China 28/01/2020. . #coronavirus #ChinaPneumonia #CoronaVirus #wuhanvirus
2231675477547197419; 0; False; 1580256469; Recuerda que en Ecuador no hay casos confirmados de #Coronavirus. Conoce varios tips que tenemos preparados para que tu estadía sea segura y placentera en el país de los cuatro mundos. ¡El Gobierno Nacional trabaja por tu salud y la de los ciudadanos y la de todos los visitantes! . . . #PrevenciónEsSalud
2231675238846934874; 0; False; 1580256461; #coronavirus #sars #wuhanvirus
2231675325292840929; 0; False; 1580256451; Nada mejor para combatir el #CoronaVirus que un parrandón de jueves en #LaCelosa. 30% de descuento en licor nacional • :telephone:Info: 310 2330570 :round_pushpin:Cll 24 # 75-40 • #modelia #celosa #vallenato #amigos #bogota #colombia #rumbavallenata #Parranda #licores #parrandaenvivo #barbogota #rumba
2231675244543181239; 2; False; 1580256442; “Wabah Mematikan”⁣⁣ •⁣⁣ THA'UN DALAM SEJARAH ISLAM⁣⁣ _⁣⁣ "Jika kalian mendengar tentang wabah (tha’un) di suatu negeri, maka janganlah kamu memasuki negeri itu. Apabila kalian berada di negeri yang terjangkit wabah itu, maka janganlah kalian keluar darinya karena hendak melarikan diri darinya.” - HR Muslim⁣⁣ ⁣⁣ Pada 17 Hijriyah (sekitar 639 M) di negeri baru tersebut, muncul satu wabah penyakit (tha’un) di Amwas, satu daerah di Palestina (Syam). Para sejarawan muslim klasik hampir tidak ada yang melewatkan peristiwa wabah dahsyat ini ketika menulis kepemimpinan Khalifah Umar.⁣⁣ ⁣⁣ Wabah tha’un yang menyebar di Amwas merupakan penyakit kulit mematikan. Sejenis penyakit kusta atau lepra. Ia berasal dari virus yang awalnya menyerang hewan ternak. Orang yang terjangkit akan muncul borok pada kulitnya.⁣⁣ ⁣⁣ Wabah sangat cepat menyebar di seluruh negeri Syam. Banyak manusia terjangkit sehingga dalam tempo singkat puluhan ribu jiwa meninggal dunia. Di antara mereka yang menjadi korban adalah Abu Ubaidah dan Mu’adz bin Jabar, dua sahabat Nabi yang masyhur.⁣⁣ _⁣⁣ ⁣⁣ Para sahabat yang hidup di masa tersebarnya wabah tha’un mematuhi sabda Rasulullah. Sebagai contoh, Ketika Khalifah Umar memanggil Abu Ubaidah kembali ke Madinah, dengan penuh rasa hormat sahabat yang menjadi tameng Rasulullah di Perang Uhud itu menolak.⁣⁣ ⁣⁣ Beliau menulis dalam suratnya yang ia tujukan untuk sang khalifah:⁣⁣ ⁣⁣ “Wahai Amirul Mukminin, aku telah memahami keperluan Anda. Tetapi aku sedang berada di tengah-tengah kaum Muslimin yang sedang ditimpa malapetaka di Syam ini. Dan tidak patut aku menyelamatkan diri sendiri. Aku tidak mau meninggalkan mereka sampai Allah menjatuhkan takdir-Nya atas diriku dan mereka. Bila surat ini telah sampai di tangan Anda, bebaskanlah aku dari perintah Anda dan izinkanlah aku tetap tinggal di sini.” (Al-Basya, 2005: 7)⁣⁣ ⁣ Umar menangis membaca surat sahabatnya itu. Tidak lama berselang, terdengar berita duka bahwa Abu Ubaidah menjadi salah satu korban dari wabah mematikan tersebut. Para sejarawan muslim mencatat sekitar 25.000 sampai 30.000 korban meninggal akibat wabah tha’un di Syam. Salah satu wabah penyakit terparah dalam sejarah Islam. ⁣ _
2231675217012672658; 3; False; 1580256438; One last day of adventure in Thailand before heading back to China to face the adventure of the #Coronavirus :face_with_medical_mask: #TheGrandchampsLife #ChiangMai
2231675190219574810; 1; False; 1580256435; #xijinping no sense of humor #coronavirus gonna get him!
2231675177436427380; 1; False; 1580256434; Slightly Off Topic Podcast Episode #37 Kobe, Coronavirus, Guns, and Super Bowl Predictions #kobe #kobebryant #coronavirus #wuhanvirus #guns #superbowl https://anchor.fm/blake-anderson8/episodes/Episode-37-Kobe--Coronavirus--Guns--and-SB-predictions-eaghni
2231674820247050603; 0; False; 1580256426; :fearful_face: Corona Virus :microbe: #coronavirus #coronaviruses #coronavirusoutbreak #coronavirusmemes #memesderisa #memes #meme #dankmemes #memes:face_with_tears_of_joy: #videosderisa #videosderisas #memelodia
2231674014798401102; 6; False; 1580256422; viendo un video asi diario, se que lograre bajar de peso en caliente:flexed_biceps_medium-light_skin_tone::rat: #CoronaVirus :face_vomiting:
2231675013638222741; 0; False; 1580256414; Wabah atau penyakit menular, sudah dikenal sejak zaman Nabi Muhammad SAW. Pada masa itu, wabah yang cukup dikenal adalah pes dan lepra. Dan saat ini yang terjadi di Cina adalah Virus Corona. Nabi pun melarang umatnya untuk memasuki daerah yang terkena wabah, apakah itu pes, lepra, maupun penyakit menular lain. . Rasulullah bersabda, "Jika kalian mendengar tentang wabah-wabah di suatu negeri, maka janganlah kalian memasukinya. Tetapi jika terjadi wabah di suatu tempat kalian berada, maka janganlah kelian meninggalkan tempat itu" (Hadits Riwayat Bukhari dan Muslim) . Ini merupakan metode karantina yang telah diperintahkan Nabi Muhammad SAW untuk mencegah wabah tersebut menjalar ke negara-negara lain. Untuk memastikan perintah tersebut dilaksanakan, Nabi Muhammad mendirikan tembok di sekitar daerah yang terjangkit wabah dan menjanjikan bahwa mereka yang bersabar dan tinggal akan mendapatkan pahala sebagai mujahid di jalan Allah, sedangkan mereka yang melarikan diri dari daerah tersebut diancam malapetaka dan kebinasaan . Semoga bermanfaat. Tag dan share ke orang-orang terkasih mu:smiling_face_with_halo: . #viruscorona #wabahpenyakit #perintahrasul #Corona #sabdarasul #quotesislamic #China #Indonesia #Malaysia #singapore #Coronavirus #islamituindah
2231671012843623433; 0; False; 1580256401; How to wear a mask :face_with_medical_mask::man_facepalming_medium-dark_skin_tone::face_with_tears_of_joy::face_with_tears_of_joy: - His message is correct but for use during the #coronavirus issues or flu season this type of mask is only good for people infected!!! It is not I repeat not good for u to stop receiving germs. See the sides they are loose and have gaps. A proper n95 particulate respirator is what u need. Surgical grade or anything that is snug fitted and has adjustment straps to tighten.. The 3m 8511 is a good start. There should be no gaps anywhere. The removal is correct buy grabbing the straps and never touching the mask and discarding it. They are only good for one use and aren't very easy to breath trough for long periods of time ... Just sharing information :hundred_points: - - #germs #flu #china #america #trendingnow #travel #help #information #knowledgeispower #follow #repost #explorepage #n95mask #facemask
2231674868724719645; 0; False; 1580256397; Vet Sabia?! Utilidade pública! :police_car_light: Corona vírus! Diante da emergência de um novo vírus denominado 2019novel-Coronavírus, detectado na China em dezembro de 2019, a Organização Mundial da Saúde (OMS) está monitorando a situação epidemiológica e fazendo alertas de prevenção e preparação a todos os países. :globe_showing_Americas: ⠀ Os Coronavírus comumente causam infecções também em animais, porém as investigações ainda estão em andamento para identificar a fonte animal (incluindo espécies) e estabelecer o papel potencial de um reservatório animal nessa doença.:paw_prints: O Ministério da Agricultura, Pecuária e Abastecimento (MAPA) está acompanhando a situação em contato com o Ministério da Saúde, que já emitiu orientação técnica para vigilância e atenção à saúde no Brasil em conformidade com diretrizes da OMS, que podem ser verificadas no Boletim Epidemiológico 4, de janeiro de 2020. Com base nas informações disponíveis, não se sabe se o 2019-nCoV tem algum impacto na saúde dos animais e nenhum evento específico foi relatado em qualquer espécie animal, até o momento.:hourglass_not_done: ⠀ Os médicos veterinários devem manter um alto nível de vigilância e relatar às autoridades veterinárias qualquer evento incomum detectado em qualquer espécie animal.:exclamation_mark: ⠀ Fonte: Ministério da Agricultura. #medvetdoamor #medvetlove #medveterinaria #medicinaveteriaria #academicavet #coronavirus #coronavírus #saudepublica
2231674838525764086; 0; False; 1580256393; Look at this Corona graph #coronavirus
2231674764664141943; 1; False; 1580256393; From China to #HongKong with dangerous behaviour ... such a filthy atheist. People from Wuhan came to Hong Kong to spit in the elevator to spread the virusCorona. Disgusting... I wouldn't be surprised some infected Chinese come purposely to infect us to spread their disease. #nCoV2019 #coronavirus #WuhanCoronavirus #CoronavirusOutbreak #China
2231673733421453139; 11; False; 1580256387; :microbe: CORONA VÍRUS :microbe: Aquel drama! • • • #Coronavirus #Barranquilla #Carnavales #Colombia #Acetaminofen #GoodVibes #GoodVibesOnly #aboutcoronavirus #world #china
2231673960221843260; 2; False; 1580256381; Just thought this was necessary:grinning_face_with_sweat:.... #dank #succ #memes #funnymemes #funny #memes4u #memes4life #memesforyou #memesforlife #edgymemes #dankmemes #meme #memez #memesrlife #memesarelife #memer #memesdaily #dailymemes #offensivememes #explorepagememes #explorepage #explore #coronavirus
2231674732083988827; 0; False; 1580256381; Hmmmmmmmmmmmmmm :flushed_face: #coronavirus #virus #plague #plaguedoctor #plagueinc #hmmm #buzzlightyear #mytimehascome #kungfupanda #gru #minions #mikewazowski #linus #linustechtips #witcher #china #usa #australia
2231674727838037947; 0; False; 1580256380; is you sleep...time to wake up. This reminds me of Resident Evil. The truth is always hidden in plain site before it’s brought to light for masses to see. there is a biological research lab near the city where the Coronavirus outbreak originated and it has a familiar logo. Shanghai Ruilan Bao Hu San Biotech Limited seems to be linked to the Umbrella Corporation from Resident Evil. Another ironic coincident is that Corona is an anagram of ‘Racoon’, fans of Resident Evil know that the original outbreak in the game started in Raccoon city, and the outbreak was called the “T-Virus” #UnplugTheMatrix:globe_showing_Europe-Africa::electric_plug: #TrillSankofa #Coronavirus #ResidentEvil #TVirus #TCells #Biological #Chemical #BiologicalWarfare #Disease #Outbreak #TheMatrix #TheMatrix4
2231674669739966917; 0; False; 1580256373; "Il est très peu probable que le coronavirus 2019-NCoV survive à un transport en avion, a fortiori en soute, où les températures sont extrêmes. En cas d'envoi en bateau, le trajet est « trop long pour la suvie du virus »" selon la DGS. 𝐐𝐮𝐞𝐥 𝐞𝐬𝐭 𝐯𝐨𝐭𝐫𝐞 𝐚𝐯𝐢𝐬 ? #instagram #information #informare #news #coronavirus #chine #épidémie #virus #2020 #colis #shopping #livraison
2231674610978863599; 0; False; 1580256366; Mencegah lebih baik daripada mengobati :folded_hands: semoga kita sehat semuanya ... jaga kesehatan semuanya guys ... hati hati dengan virus yang sedang mewabah :flexed_biceps:⁣ #repost @raffinagita1717⁣ ⁣ #virus #corona #coronavirus #coronavirusoutbreak #wuhan #ncov #wuhanchina #coronavírus #viruscorona #raffiahmad #nagitaslavina #baimpaula #uyakuya #sule #orangterkenal #orangterkenalcom #artisindonesia #selebriticlub #selebriti #selebritiindonesia #selebrity #beritaartis #pasanganartis #multitalenta #infoartis #love #followbackinstantly #f4follow #selebgramhits
2231674009255007212; 0; False; 1580256350; Video by bbcnews | IG #coronavirus #coronaviruses #coronavirusoutbreak #wuhancoronavirus #wuhanchina #wuhanvirus #chinavirus
2231673906610487933; 1; False; 1580256282; As Rick Grimes would say: CARL! KARL! CKRAL!!! :downcast_face_with_sweat::recycling_symbol::green_heart::man_zombie::seedling::woman_zombie::sheaf_of_rice:
2231673505150065912; 0; False; 1580256258; Kopi pun tidak mampu menahan nya :beaming_face_with_smiling_eyes::face_with_tears_of_joy: __________________________________________ Ada vidio yang menarik ? Jgn lupa tag @indopostgram.id Follow n support: @indopostgram.id @indopostgram.id @indopostgram.id ___________________________________________ #lucu #ketawangakak #komedi #instagram #viral #trending #dagelanvideo #dagelan #indopostgram #tiktok #tiktokindonesia #tiktokgeneration #masterchef #rajangakak #indonesia #tiktokhits #tiktokindia #lfl #lfl:yellow_heart: #ngkakkocak #wuhan #coronavirus #maknews #youtube #world #funny #tiktokmemes
2231672397543301745; 0; False; 1580256149; Residents in Wuhan, China are shouting encouragement and singing songs from their apartment windows to boost morale amidst the coronavirus quarantine. Wuhan is the centre of the deadly outbreak, and all 11 million residents have been advised to stay at home. #coronavirus #coronaviruses #coronavirusoutbreak #wuhancoronavirus #wuhanchina #wuhanvirus #chinavirus
2231671451216765141; 1; False; 1580255989; We missed "Shitty Meme Monday" so here's "Terrible Meme Tuesday" #ThreatLevelMidnight #HatersWillSayItsPhotoshopped #JoeBidensFingerFetish2020 #NowThisIsAnAvengersLevelThreat
2231667757964317052; 9; False; 1580255549; None
2231663777299127551; 2; False; 1580255075; None
2231663386240489633; 0; False; 1580255028; Engraçado, somos considerados por eles um Portugal racista, mas quem no fim é que pedem ajuda? Portugal, claro, mas também Portugal não pode esquecer que há portugueses na China em Wuhan, talvez há espera de ajuda. Nada contra, só acho uma extrema hipocrisia, só isso. #portugal #china #wuhan #coronavirus
2231632997056495925; 2; False; 1580251405; 20200129 - 코로나바이러스 조심합시다! - #고과장 #캐릭터 #일러스트 #코로나 #바이러스 #코로나바이러스 #코로나바이러스조심 #illust #illustration #그림 #drawing #마스크 #coronavirus
2231607900387456244; 0; False; 1580248691; :frowning_face_with_open_mouth: sound on #wuhan #coronavirus
2231549435674302011; 2; False; 1580241444; Haaaaaa! Ecco perche':face_with_tears_of_joy::face_with_tears_of_joy::face_with_tears_of_joy:devo eliminare ancora tre o quattro persone:face_with_tears_of_joy::face_with_tears_of_joy::face_with_tears_of_joy:che stressano da mori' :face_with_tears_of_joy::face_with_tears_of_joy::face_with_tears_of_joy:Pensavo di averli eliminati tutti gli scassac..........#noielephoto #noiamicidibenny #misteralobaalobazi #ectodicaffà #coronavirus #ciringhito #coronavirusoutbreak #businessamisuradidonna #breakingdawnpart1 #breakingbad #fantasilandialadiversiontotal #hairstyle #gianlucavacchistyle #pioeamedeo #flaviobriatore #matteosalvini #robadadonne
2231365940696460375; 1; False; 1580219570; Mais notícias sobre o Coronavirus... Já são 2,7 mil infectados. Número de mortes chega a 106!!! O embaixador do Brasil em Pequim (China) afirma que não é possível evacuar brasileiros da cidade Wuhan, onde há uma epidemia do vírus. Porém, ao menos 11 países já estudam formas de retirar seus cidadãos da área. Brasil sendo Brasil. Triste realidade... A UNICAMP, referência para epidemias infecciosas na região de Campinas, cria plano de combate ao vírus e define protocolo para identificar casos suspeitos. A unidade tomará medidas de isolamento em pacientes com sintomas. Brasil não tem registros suspeitos e confirmados. #care #health #saude #cuidado #coronavirus
2230688241026814000; 0; False; 1580138782; Китайский нг. :China::right-facing_fist::left-facing_fist::Russia: Не смотря на ситуацию в Китае, хорошо проводим время:beaming_face_with_smiling_eyes: "Когда дела совсем плохи, остается только смеяться" :grinning_face_with_sweat: Ну, а вообще, все не так уж и плохо.:winking_face: #dalian #новосибирск #nsk #novosibirsk #coronavirus #коронавирус #nsk54
2214364471130971373; 0; False; 1578192865; Guess I have #coronavirus
2165656492787060796; 16; False; 1572386393; My favorite thing: Going where I've never been! #dancelikenobodyswatching #gyoen #nationalpark #nationalgarden #japanesegarden #adreamcametrue #explore #newplaces #coronavirus #travel #memories #september2019 #travellers #september2019 #makingmemories #asia #japan #tokyo :Japan:
2231674614147293882; 1; False; 1580256366; :fearful_face: Corona Virus :microbe: #coronavirus #coronaviruses #coronavirusoutbreak #coronavirusmemes #memesderisa #memes #meme #dankmemes #memes:face_with_tears_of_joy: #videosderisa #videosderisas #memelodia
2231674598822658389; 0; False; 1580256365; La provincia china de Hubei, centro del brote del nuevo coronavirus, informó de que otros 25 pacientes infectados murieron y reportó también 840 nuevos casos. . . Las autoridades sanitarias de Hubei dijeron en un comunicado que hasta el momento en la provincia se han registrado un total de 125 muertes y 3.554 casos de infección. El brote comenzó a finales de diciembre en la capital de la provincia, Wuhan. . . El Gobierno chino ha aceptado que la Organización Mundial de la Salud (OMS) envíe expertos internacionales lo antes posible para que colaboren en la lucha contra el coronavirus, anunció este martes la entidad sanitaria. . . #internacionales #China #CoronaVirus #Noticias . . Más detalles en nuestra historia
2231669256596448342; 0; False; 1580256364; #Repost @arnoux.art • • • • • • #coronaviruses #coronavirus #virus #becareful #pandemia #diagnosis #usa:United_States: #usaroadtrip #please #becareful #usanews #alert #noticias #noticiaimportante #noticiasqueimportan #important #importantes#informaciones #information #informa #ultimanoticiavzla #noticias #noticiaimportante #noticiasenespañol #noticiasalud #alerta
2231674567357489508; 4; False; 1580256361; OK- so here’s another update to stem some of the confusion and panic around CORONAVIRUS :folded_hands_medium-dark_skin_tone: • Yes, we now know that #coronavirus can be transmitted from human to human • Analysis of data has suggested that 1 contagious person will transmit the virus to 2-3 other people • There is some conflicting advice from schools/childcare centres. Currently the government is suggesting only those with symptoms (such as fever, cough, shortness of breath) and those who have had contact with coronavirus directly remain away from school until cleared by a doctor. Many schools however, including Miss S’, have asked that any child who has travelled to China does not return to school within 14 days of arriving back in Australia (this has to do with the incubation period of the virus) • Miss S is at school today - hysteria isn’t going to help. As I say to patients if I kept her home every time something is happening (like #influenza season, a gastro outbreak) she would never ever go • IF you have symptoms (like fever, cough, shortness of breath), if you’ve had contact with someone with coronavirus- please let your clinic know BEFORE you go so they can isolate you and protect everyone else in the waiting room and the staff. It’s crucial you warn them :raising_hands_medium-dark_skin_tone: • There are 5 confirmed cases in Australia and no deaths • We believe the incubation period of coronavirus is 7-14 days - the virus, the outbreak is still being investigated so we are still waiting on some details • Great hand hygiene is key to preventing spread :thumbs_up_medium-dark_skin_tone: • There’s no need to panic :folded_hands_medium-dark_skin_tone: • For key other details see my post from 3 days ago :victory_hand_medium-dark_skin_tone::victory_hand_medium-dark_skin_tone: #thewholesomedoctor #health #medicine #doctor #evidencebasedmedicine #doctorsofinstagram #preventativehealth #preventativemedicine
2231674548171018289; 0; False; 1580256359; :backhand_index_pointing_right:O Ministério da Saúde confirmou hoje (28/01/20) primeiro suspeito de Coronavírus em nosso país. :warning::warning::warning: . . :backhand_index_pointing_right:De acordo com o ministro da saúde,Luiz Henrrique Mandetta, uma estudante de 22 anos que esteve na China na cidade de Wunhan no período de 29 de agosto 2019 a 24 de janeiro deste ano, na qual retornou para Belo Horizonte, onde está em internada em observação. Ela está em isolamento, e em respeito o nome da mesma está em sigilo. O Grau de atenção aumenta no país, já houveram 7063 rumores, sendo que 127 exigiram verificação por meio de exames. . . :backhand_index_pointing_right:O nível de alerta :police_car_light:aumentou do nível 1 para 02 de perigo iminente, caso seja confirmado a suspeita passaremos para nível 03, declarou o secretário de vigilância em Saúde. O que muda nesse nível é o grau de vigilância, inclusive em aeroporto e portos, atualmente todas as pessoas vindas da China nos últimos 14 dias, que apresentem febre e sintomas respiratórios podem ser considerados suspeitos. . . . :camera:#repost @portalfarmaceutico Fonte: agência Brasil em foco / Ministério da Saúde. #coronavirus #china #brasil #saúde #ministériodasaúde #enfermagemporamor #enfermagemcomamor #enfermeira #nursing #enfermagemlove #enfermagemaartedecuidar #enfermagemdadepressao #enfermagemobstétrica #enfermeiro #dicasdeenfermagem #dicasdeenfermagemm #enfermeirandas #enfermeiros #plantao #aph #atendimentoprehospitalar
2231674512661908100; 0; False; 1580256354; :fearful_face: Corona Virus :microbe: #coronavirus #coronaviruses #coronavirusoutbreak #coronavirusmemes #memesderisa #memes #meme #dankmemes #memes:face_with_tears_of_joy: #videosderisa #videosderisas #memelodia
2231674508551579574; 5; False; 1580256354; Wait just a second :thinking_face::thinking_face: #coronavirus
2231674471399728425; 0; False; 1580256349; Repost by @_reposta ——— Hi #Healthies Sampai saat ini Virus Novel Corona masih menjadi kekhawatiran banyak orang. Namun, selain mencari tahu sumber virus tersebut, kita juga perlu menjaga diri sendiri agar terhindar dari Virus tersebut. Virus corona dapat di cegah dengan kondisi badan sehat dan imunitas yang baik. Selain itu, berperilaku hidup bersih dan sehat menjadi hal utama untuk mencegah terjadinya penularan 2019-nCoV. #CoronaVirus #nCoV #novelCoronaVirus sehatnegeriku.kemkes.go.id Follow kami: Facebook : Kementerian Kesehatan RI Twitter : @kemenkesRI Youtube : Kementerian Kesehatan RI flickr : sehatnegeriku :telephone_receiver:HALO KEMENKES 1500567 (24 hours) #kemenkesfact #kemenkestips #KEMENKESRI #sehatnegeriku
2231674445016911109; 4; False; 1580256346; O surto do coronavírus, que já matou 106 pessoas e supera os 4 mil infectados na China, coloca em alerta diversas modalidades esportivas. Competições estão sendo canceladas ou transferidas para outros países. O Comitê Olímpico Internacional (COI) acompanha a propagação da doença, a menos de seis meses da Olimpíada de Tóquio, que tem início em 24 de julho. Por enquanto, O Ministério da Saúde do Japão confirmou apenas um caso de coronavírus em um homem que não esteve na China. ⠀ Foto: Mark Ralston/AFP ⠀ #toquio #japão #olimpiadas #coronavirus
2231670811668664769; 0; False; 1580256342; Bu bölümde, Uzak doğu ve Avrupa'ya bela olmuş corona virüsünü inceliyoruz. İyi Seyirler :movie_camera: - Sayfayı Takip etmeyi unutmayalım:smiling_face_with_smiling_eyes: - @urasmedya1 :backhand_index_pointing_left: . - #corona #koronavirüsü #coronavirus #saglikliyasam #sağlık #china #wuhan #nedir #salgın #iyiseyirler
2231674393317396569; 0; False; 1580256340; VANS PEREKAT . Ready size insole: 21: 15cm 22: 15,5cm 23: 16cm 24: 16,5cm 25: 17cm (Rp 150.000,-) . 26: 17,5cm 27: 18cm 28: 18,5cm 29: 19cm 30: 19,5cm (Rp 155.000,-) . 31: 20cm 32: 20,5cm 33: 21,5cm 34: 22cm 35: 22,5cm 36: 23cm (Rp 160.000,-) . Kemungkinan error 0.5 - 1 cm . Pastikan mengecek size sebelum melakukan transfer. Karena kami TIDAK melayani penukaran size :) . Mohon untuk mengirim ulang gambar yang akan di order. Agar meminimalisir kesalahan orderan :) ­­­ . For order : WA: 081339157676 . #sepatuanak #sepatuanaklucu #sepatuanakbranded #sepatuanakmurah #sepatuanakcewek #sepatuanakimport #sepatuanaksport #sepatuanakled #sepatuanakboot #sepatuanakperempuan #jualsepatuanakmurah #jualsepatuanak #sepatuanakcowok #tipsparenting #mpasi #coronavirus #maiaestianty #raffinagita
2231674318727000489; 0; False; 1580256331; A Chinese friend told me that he was stared at weirdly in the Paris metro wearing his mask. Yesterday I heard that an Asian woman wearing a mask was insulted and expelled from a train by the other passengers. Incidence like this has triggered lots of debate and anger on the internet recently. But before jumping into the battle of anti-discrimination, what draws my attention first is the different usage of masks in China and in France during this coronavirus crisis: According to the French Ministry of Health, one is encouraged to wear a mask only when showing coronavirus symptoms. Wearing a mask by the non-sick population to avoid catching the disease is NOT recommended. People are encouraged to wash hands often and to cover their mouths when they sneeze or cough. In China, people have been educated that wearing a mask is a way to PREVENT or decrease the chance of getting infected by the coronavirus, as well as avoid passing the virus to others. That’s why so many Chinese people race to buy masks for themselves and their families. What’s more, after living through SARS and the pollution PM2.5, protecting one’s health with a mask has become a habit. As a result, to a French, wearing a mask indicates that someone is already sick, while for a Chinese, wearing a mask is also a self-protection measure. This different interpretation of wearing a mask may have caused misunderstanding and public panic. Anyway, wearing a mask does no harm to others, on the contrary, it protects us especially that the coronavirus has an incubation period of 1-14 days, so even a person without any symptoms can also be a virus carrier. So next time you see a Chinese tourist in a metro wearing a mask, there’s no need to be scared. (I don’t know if the difference I described also applies to other countries. If so, please kindly forward the message.) #wearingmask #coronavirus #misunderstanding #discrimination #sliceoflife #tinyeyescomics
2231674260601278351; 0; False; 1580256324; #hurricanehurk #gaymemes #memes #bestmemes #instamemes #funny #funnymemes #dankmemes #offensivememes #edgymemes #spicymemes #nichememes #memepage #funniestmemes #dank #memesdaily #jokes #memesrlife #memesquad #humor #lmao #igmemes #lol #memeaccount #coronavirus #relatablememes #funnyposts #sillymemes #nichememe #memetime
2231674175534173066; 0; False; 1580256321; What are the signs and symptoms of novel coronavirus? How does it spread? What is the California Department of Public Health doing to protect your health? Learn more with our FAQ: https://bit.ly/36CjxNg #coronavirus #novelcoronavirus #nCoV2019 #virus #CDPH #corona #publichealth #health #china #wuhan #USA #California #symptoms #Illness #spread #outbreak #coronavirusoutbreak #prevention #safety #FAQ #information #infographic #Cali #CDC #response
2231674216973203565; 0; False; 1580256319; This filter is my favorite thing rn. #witchyvibes #gothgirl #alien #beanie #hairstyles #emogirl #alternativegirl #redlipstick #instagram #instafilters #newaccount #haircolor #alternativeworld #alternativefashion #makeup #coronavirus #egirl #2020 #photography
2231673310146838480; 2; False; 1580256308; Who doesn’t need an immune boost right now? We love IV vitamin therapy to help support immunity! #vitaminc #vitamindrip #coronavirus @surfaceskinlab
2231674117996663755; 0; False; 1580256307; #coronavirus #virus #CORNONAVIRUSMEMES #CHINA
2231674083317446807; 0; False; 1580256303; :cow::cow::cow:⁣ ⁣⁣⁣ 𝐒𝐔𝐒𝐔 𝐂𝟐𝐉𝐎𝐘 𝐌𝐈𝐍𝐔𝐌𝐀𝐍 𝐔𝐍𝐓𝐔𝐊 𝐊𝐄𝐒𝐈𝐇𝐀𝐓𝐀𝐍...⁣ ⁣ :sake:• Keluaran dan diKilangkan di 𝐌𝐚𝐥𝐚𝐲𝐬𝐢𝐚⁣ ⁣ :sake:• Gabungan Susu Formula & 𝐒𝐮𝐬𝐮 𝐊𝐨𝐥𝐨𝐬𝐭𝐫𝐮𝐦 dari New Zealand⁣ ⁣ :sake:• Diperkaya dengan Susu 𝐊𝐚𝐥𝐬𝐢𝐮𝐦𝐓𝐫𝐮 𝐂𝐚𝐥 𝐃𝟕 dari Glanbia US⁣ ⁣ :sake:• Mempunyai keunikan dengan 𝐀𝐫𝐨𝐦𝐚 𝐕𝐚𝐧𝐢𝐥𝐥𝐚⁣ ⁣ :sake:• 𝟏𝟎 𝐓𝐚𝐡𝐮𝐧 di pasaran Indonesia dan 3 Tahun di Malaysia⁣ ⁣ :sake:• 𝐌𝐮𝐝𝐚𝐡 𝐃𝐢𝐛𝐚𝐰𝐚 kemana mana ⁣ ⁣ :sake:• Sesuai Untuk 𝐒𝐞𝐦𝐮𝐚 𝐏𝐞𝐫𝐢𝐧𝐠𝐤𝐚𝐭 𝐔𝐬𝐢𝐚⁣ ⁣ :sake:• Telah Mendapat Pengesahan 𝐇𝐚𝐥𝐚𝐥 𝐉𝐚𝐤𝐢𝐦⁣ ⁣ :red_apple: Jom try susu kolostrum C2joy pm tepi Cik. Suzy :face_blowing_a_kiss:⁣⁣⁣⁣ ⁣⁣⁣⁣ #fenomenaC2Joy⁣⁣⁣⁣⁣ #C2Joy⁣⁣⁣⁣⁣ #susukesihatan⁣⁣⁣⁣⁣ #InfuenzaA⁣⁣⁣⁣⁣ #kalsium⁣⁣⁣⁣⁣ #colostrum⁣⁣⁣⁣ #corona⁣⁣⁣⁣ #coronavirus⁣⁣⁣⁣ #coronavirusoutbreak⁣⁣⁣⁣ #diabetes⁣⁣⁣⁣ #kencingmanis⁣⁣⁣⁣ #buahpinggang⁣⁣ #kidneystones⁣⁣ #cancer⁣⁣⁣⁣ #eczema⁣⁣⁣⁣ #resdung⁣⁣⁣⁣ #denguefever⁣⁣⁣⁣ #nochemicals⁣⁣⁣⁣ #nosugar
2231674052875716476; 0; False; 1580256300; Give me a few minutes, I'll let you know how this is going to play out. #coronavirus #plagueinc
2231674031516694937; 0; False; 1580256297; VANS PEREKAT . Ready size insole: 21: 15cm 22: 15,5cm 23: 16cm 24: 16,5cm 25: 17cm (Rp 150.000,-) . 26: 17,5cm 27: 18cm 28: 18,5cm 29: 19cm 30: 19,5cm (Rp 155.000,-) . 31: 20cm 32: 20,5cm 33: 21,5cm 34: 22cm 35: 22,5cm 36: 23cm (Rp 160.000,-) . Kemungkinan error 0.5 - 1 cm . Pastikan mengecek size sebelum melakukan transfer. Karena kami TIDAK melayani penukaran size :) . Mohon untuk mengirim ulang gambar yang akan di order. Agar meminimalisir kesalahan orderan :) ­­­ . For order : WA: 081339157676 . #sepatuanaklaki #sepatuanakcowok #sepatuanak #sepatuanaklucu #sepatuanakbranded #sepatuanakmurah #sepatuanakcewek #sepatuanakimport #sepatuanaksport #sepatuanakled #sepatuanakboot #sepatuanakperempuan #jualsepatuanakmurah #jualsepatuanak #sepatuanak #tipsparenting #mpasi #coronavirus #maiaestianty #raffinagita
2231674001082748683; 1; False; 1580256293; Not an alcoholic, just tryna be safe man :baguette_bread:TAG A FRIEND:baguette_bread: :bread:𝐅𝐎𝐋𝐋𝐎𝐖: @explosivetoasts :bread: :bread:𝐅𝐎𝐋𝐋𝐎𝐖: @explosivetoasts :bread: :croissant:𝐁𝐀𝐂𝐊𝐔𝐏: @explosivetoasts.v2:croissant: :croissant:𝐁𝐀𝐂𝐊𝐔𝐏: @explosivetoasts.v2:croissant:
2231673998601360074; 0; False; 1580256293; Um laboratório de pesquisa biológica localizado na China, tem sua logomarca igual a da Umbrella Corporation. Alguém tem o telefone do Leon aí??:rolling_on_the_floor_laughing: :joystick::zombie::video_game: . . . . . #residentevil #coronavirus #umbrellacorporation #retrogamer #gaming #survivorhorror
2231673844704546658; 0; False; 1580256275; Waking up for work after the holidays:cat_face::paw_prints::sleeping_face: #prayforhongkong #fear #coronavirus #fuckthegovernment #catsofinstagram #AmericanCurl #美國捲耳貓 #捲耳貓 #卷耳貓 #美短 #Cat #貓 #Meow #喵 #喵星人 #主子 #香港貓 #hkcat #香港貓奴 #港短 #貓奴 #ねこ #猫 #ぬこ#ねこ部 #アメリカンカール #むにゃげーず #ふわもこ部 #:cat_face: #:cat:
2231673814236202317; 0; False; 1580256271; Coronavirus nCoV Top 10 (# of confirmed cases) China: 5494 Thailand: 14 Hong Kong: 8 Taiwan: 8 Japan: 7 Macau: 7 Singapore: 5 Australia: 5 USA: 5 Malaysia: 4 Jan 28 - 23:33 GMT #coronavirus #coronavirusupdates #Coronavirus888
2231673622186654501; 0; False; 1580256262; Snoop dog . . . . . . . . #funnyvideos #haha #memes #illness #china #blackhumor #haha #witzig #alman #memes #keller #likeforlikes #likeforfollow #wuhan #virus #corona #coronavirus #deutschrap #tiktokmemes #tiktokgirls #tiktok #alman #almanmemes #capitalbra #nimo #mero428 #kmn #snoopdog
2231673715426630300; 0; False; 1580256259; Ante la epidemia por el nuevo coronavirus :face_with_medical_mask:, compartimos información importante sobre los síntomas y como prevenir el contacto con este virus mortal. #chfpr #health #salud #puertorico #nutricion #wellness #nutrition #excercise #ejercicios #medicina #saludvisual #vista #ojos #coronavirus
2231673686940054845; 0; False; 1580256256; “Frontline female doctors and nurses cut their hair to save time disinfecting. In a country where there is always a male narrative, women are never taken seriously, but in times of crisis, women always rush to the front. May they be safe.” 一線女醫護們為節省時間紛紛剪髮 在一個從來只有男性敘事的國家裡，女性從來不被重視，但危機時刻又總是女性衝在最前面，願她們都平安 From There4I on Twitter. ⁣ ⁣#news #breakingnews⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣ #worldnews⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣ #coronavirus #wuhanvirus #wuhancoronavirusoutbreak #WuhanCoronavirus⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣ #coronavirusoutbreak #corona #ncov2019 #ncov⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣ #武漢肺炎 #武汉疫情⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣ #China #Wuhan⁣⁣⁣⁣⁣ #StandWithWuhan⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣ #LunarNewYear #NewYear #SpringFestival⁣⁣ ⁣
2231673545774532563; 0; False; 1580256255; Important Information! Very Serious :megaphone::megaphone::megaphone::megaphone: Ministry of health’s emergency notification to the public that the Coronavirus influenza outbreak is very serious & fatal. Zero percent cure if you are infected. It is spreading from China to various countries. The prevention method is to keep the throat moist, recommended not to keep throat dry. Always, do not hold your thirst because once the membrane in the throat is dried, the virus will invade into the body within 10 mins. Drink 0.5 to 0.8 liter of warm water, 0.3 – 0.5 liter for kids, according to age. If you feel your throat is dry, do not hesitate to drink water. Also suggested not to drink plenty at one time as it doesn’t help, instead continue to keep the throat moist. Till the end of March, better to avoid crowded places, wear a mask as needed especially in a train or public transportation stay away from fried and spicy foods and load up with vitamin C. The symptoms 1.repeated high fever 2.prolonged coughing after a fever 3. Children are prone 4.Adults usually feel uneasy / headache and mainly respiratory-related 5. highly contagious :police_car_light: Please do share this information without fail! #CoronaVirus #Spreadtheword #chinavirus #china #ConsultonDocco360
2231673671066810994; 0; False; 1580256254; #lammo #meme #memes #memes:face_with_tears_of_joy: #memedaily #dailymeme #dailymemes #dankmemes #dankmeme #funnymemes #funnymeme #corona #coronavirus #drunkmemes #drunkmeme #drunk #drinking #pub
2231673617455243588; 0; False; 1580256248; I hope all the countrys/humans are going to get better #drawing #countryhumans #countryhumansfrance #countryhumanscanada #coronavirus
2231673615492380067; 0; False; 1580256247; #coronavirus :warning: À savoir .
2231673541077952438; 7; False; 1580256239; Let's hope the new virus is contained quickly.
2231673536664270978; 0; False; 1580256238; Joli clin d'oeil à l'actualité :face_with_medical_mask: #statue #art #sculpture #monument #detournement #parcducinquantenaire:Belgium::red_heart: #cinquantenaire #Brussels #bruxelles:Belgium: #belgium #belgique:Belgium: #promenade #ballade #studies:books: #pollution #rechauffementclimatique #coronavirus
2231673508488734759; 0; False; 1580256235; Esta também no meu dirito avisar-vo #coronavirus #carlos_capaji @carlos_capaji
2231673499712601808; 0; False; 1580256234; Oof • • • • • #corona #coronavirus #coronavirusoutbreak #coronavirusmemes #anioop #fat #fatguy #familyguy #thesimpsons #fortnite #callofduty #movie #meme
2231673302431255720; 0; False; 1580256229; #coronavirus #france #china #wuhan #usa #simulation #protection #virus #wuhanvirus #chine #epidemie
2231673419668507904; 4; False; 1580256224; :v #coronavirus
2231673349021781113; 0; False; 1580256216; #coronavirus #:face_with_medical_mask::face_with_medical_mask::face_with_medical_mask: #:airplane:. #:prohibited:
2231673333149393929; 1; False; 1580256214; Platicando sobre el #Coronavirus por #w1420
2231658800541571043; 0; False; 1580256207; When I first got in china and saw people in masks:face_with_medical_mask:...at first I didn’t understand why because where I come from, I have never seen people walking around in masks..I never knew I will need one so desperately someday, wearing one :face_with_medical_mask: is no fun, its hard to breathe normally ,mostly if you walking fast,climbing stairs or talking... currently keeping indoors..if I don’t think about it,life just seems normal.I’m somehow caught in between this is happening and this is just a dream .like one day life is normal then the other day I can’t go out in crowded places I have to put on the mask avoid hugging people shaking hands and so on .nothing much is going on.people are either on lockdown or indoors the streets are almost empty .... but we are praying for God protection :folded_hands:. #alittleworriedaboutit #godisincontrol #godwillseeusthrough #coronavirus #coronavirusoutbreak #africaninchina
2231673156871375211; 60; False; 1580256193; Let’s talk about a real-life public health concern: viral infection and outbreak of disease.⁣ ⁣ :eyes: There is a deadly virus spreading across the globe. It kills over 650,000 people per year and preys on the most vulnerable populations. In fact, it has killed over 8,000 people in the United States this year alone.⁣ ⁣ :face_screaming_in_fear:It’s not Coronavirus... it’s the flu.⁣ ⁣ But let’s talk about coronavirus for a moment.⁣ ⁣ What exactly is “Coronavirus”? ⁣ ⁣ :face_with_medical_mask: Coronaviruses are a large family of viruses that cause respiratory illness in people & animals. (SARS and MERS are other forms of coronavirus.) The current outbreak is called 2019-nCoV.⁣ ⁣ :China: As of this time, the majority of cases are in China, with isolated cases confirmed in Washington, California, Arizona, and Illinois due to recent travel to Wuhan, China. No person-to-person spread has been detected at this time and the virus is NOT currently spreading in the United States. (Pulled from the CDC database @ 4:30 pm 1/28/20.)⁣ ⁣ :petri_dish: The virus can range from little to no symptoms to people being severely ill and dying. Symptoms include fever, cough, and/or shortness of breath. There are 4,583 cases of coronavirus & 106 deaths confirmed worldwide as of Tuesday morning.⁣ ⁣ :police_car_light:IMPORTANT: The immediate health risk from 2019-nCoV is considered LOW in the United States.⁣ ⁣ Now, let’s circle back around to actual viral risk.⁣ ⁣ :microbe: The flu kills up to 650,000 people per year, yet we are more concerned with and panicked about the extremely low risk of contracting 2019-nCoV.⁣ ⁣ Familiarity breeds indifference, am I right? ⁣ ⁣ Coronavirus is new and scary sounding. The flu is “old news.” Yet, from a risk perspective, you should be more concerned with contracting the flu. You are far more likely to contract (and possibly die from) the flu than coronavirus.⁣ ⁣ :rescue_worker’s_helmet: From a public health perspective, coronavirus is something worth watching but let's be realistic about actual risk here.⁣ ⁣ Get your flu shot.⁣ Wash your hands.⁣ Cover your mouth when you cough/sneeze.⁣ Consider canceling travel plans to China for the time being. #coronavirus #thisispublichealth
2231672553269390388; 6; False; 1580256185; El JOVIE CABE, fue víctima del CORONA-VIRUS... acompáñenme a ver esta triste historia :face_with_tears_of_joy::face_with_tears_of_joy::face_with_tears_of_joy::face_with_tears_of_joy::face_with_tears_of_joy::face_with_tears_of_joy: . . Patrocinan: @licoresexpressoficial @hector_padilla_ @santahelena_barbershop @albeiro_barberstudio @ostreriaelchavo @lacheka :movie_camera: @elcomelin @el_embalaito @elcabe7 #videosderisa #solohumor #coronavirus
2231673062675466875; 0; False; 1580256182; Still too soon:crying_face: my Great great great great great great great great great great great great great great great great great great great great great great great great great great great great great great great great great great great great great great great great great great great great great great great great great great Grandpa died there :pensive_face::folded_hands::red_heart: . . . :right_arrow: @spewege :left_arrow: :right_arrow: @spewege :left_arrow: :right_arrow: @spewege :left_arrow: . . . #perc30memes #perc30 #dankermemes #coronavirus #memetime #caronavirus #memeimages #newestmemes #recentmemes #starterpackmeme #memedose #memehumor #69memes #sickmeme #oldmeme #shitpostmemes #memeculture #monstersincmemes #martincabello #coronavirusmemes #goofymemes #joeswanson #wwiiimemes #stupidmemes #crazymemes #weebmeme #wtfmeme #shreckmemes #historicalmemes
2231672997497143389; 0; False; 1580256174; Ultimate protection.⁣ ⁣ From geofflo610on Twitter.⁣ ⁣⁣ ⁣#news #breakingnews⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣ #worldnews⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣ #coronavirus #wuhanvirus #wuhancoronavirusoutbreak #WuhanCoronavirus⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣ #coronavirusoutbreak #corona #ncov2019 #ncov⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣ #武漢肺炎 #武汉疫情⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣ #China #Wuhan⁣⁣⁣⁣⁣ #StandWithWuhan⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣ #LunarNewYear #NewYear #SpringFestival⁣⁣ ⁣
2231672986977589133; 0; False; 1580256173; :police_car_light:Si regresas de un viaje o estás por salir del país, mantente alerta ante posibles síntomas y sigue estas recomendaciones de salud. Para más información llama gratis al :telephone_receiver: 133 SALUD - MINSA :Peru: #coronavirus #saludyquiropractica #coronavirusperu #coronavirusprevención
2231668320688784707; 0; False; 1580256172; Wuhan market from where the Coronavirus emerged #wuhan #chiba #eatibghabits #coronavirus #yuck #pigs #snakes #grose
2231672978111100687; 2; False; 1580256171; It all makes sense now :hushed_face: #umbrella #residentevilmemes #residentevil #raccooncity #racooncity #coronavirus #china #geekthugz
2231672012395567908; 0; False; 1580256170; :B_button_(blood_type):IG SM:O_button_(blood_type):KE :droplet: :droplet: :droplet: :droplet: :droplet: :droplet: :droplet: :droplet: :droplet: #ww3 #ww3memes #memes #meme #funny #dankmemes #memesdaily #funnymemes #lol #dank #humor #like #follow #lmao #dankmeme #edgymemes #offensivememes #anime #love #fortnite #comedy #dailymemes #edgy #memestagram #funnymeme #instagram #wuhan #tiktok #coronavirusmemes #coronavirus
2231672373291363678; 4; False; 1580256165; want to lose weight!? Watch this video daily!:movie_camera: #CoronaVirus #Virus #WeightLoss #Gym #Motivation #Obesity #Fitness
2231672903829492369; 2; False; 1580256163; #angelaesthetic #coronavirus
2231672818238542008; 0; False; 1580256160; Being chinese in any country other than china right now. #coronavirus #coronavirusindia #China #Wuhan #Hubei
2231672875458666854; 1; False; 1580256159; Howdy - :right_arrow:send to friends:left_arrow: - - - - - *hashtags* #meme #memes #funny #dankmemes #lol #memesdaily #funnymemes #dank #follow #like #fortnite #lmao #dankmeme #love #anime #edgymemes #humor #comedy #edgy #offensivememes #fun #america #la #london #britain #clique #coronavirus
2231672793125436085; 0; False; 1580256149; :warning:Problema de saúde pública INFORME DA SOCIEDADE BRASILEIRA DE INFECTOLOGIA SOBRE O NOVO CORONAVÍRUS. #lahem #coronavirus #virus #unifasb
2231672745064864780; 0; False; 1580256144; Surah Az Zumar: 10 . “Hanya orang-orang yang bersabarlah yang disempurnakan tanpa batas” . Maksudnya tanpa batas adalah tanpa takaran dan tanpa ukuran. Oleh karenanya tidak ada balasan melebihi balasan sabar. . . . . . #gamisbigsize #coronavirus #sabar #lifequote #gamisbusuifriendly #quotescinta #gamisbrukat #gamissetsyari #mukenah #sabarlahdiriku #mukenamotif #mukenamewah #sabarituindah #gamismuslim #mukenarayon #gamismaxmara #quotesforlife #businessquotes #sabar #mukenapremium #islamicquote #mukenadewasa
2231672642248178358; 1; False; 1580256131; Solution :index_pointing_up_light_skin_tone: #14fevrier #saintvalentin #coronavirus #ohcava #actualité #medias #cestlavie #illustration #henriettedebordeaux #dessindujour #mercredi #bisous #coeursurtoi
2231672624933861563; 0; False; 1580256129; When you get close to #TheBay and the #Coronavirus starts to scare you so you do your best to hide from #germs lol
2231672602635842486; 0; False; 1580256127; Indonesia lebih canggih dari cinaa:face_with_tears_of_joy: #recehkantwitter#dagelan #dagelaankekinian #twitter #twitterquotes #awreceh_id #corona #coronavirus
2231672586452906293; 0; False; 1580256125; :radioactive:KILLER VIRUS ARE U PREPARED?: My coronavirus defense supplies arrived from Amazon.com yesterday. Over the next several days I shall continue to stockpile water, and enough dry foods to sustain me for at least 30 days, if they end up eventually locking down Los Angeles in quarantine, like they have the Chinese city of Wuhan, ground zero for where this killer virus allegedly emerged.:face_with_medical_mask:Currently, over 50 million people are in mandatory lockdown and quarantine within the city, and are not allowed to leave. There are physical and military blockage/barriers to keep everyone from leaving the perimeters of the city, In an effort to contain the virus. However, over the weekend the mayor of the city admitted that over 5 million people had left the city and are/have traveled throughout the world, several days prior to the lockdown. :radioactive:If you have not heard anything about this killer Coronavirus yet (and I would be shocked if you haven’t) I strongly advise you jump onto YouTube right now and search “coronavirus update” and get up to speed real fast! Unfortunately, by the time you read this, most facemasks and protective gloves will probably be sold out most everywhere. There has been a run on them over the last several days. You want to look for respirators that are N95 filter rated. Also, the respirator must form a tight seal around your nose and mouth, otherwise the other types will do you little good for protection. If the virus begins to spread widely throughout your area, you are also going to need:eye:protection, goggles that seal around the eyes like swimming goggles. Because it has been found that the virus can easily enter through your eyes as well. Any mucous membrane is a point of entry. The virus can also live on hard surfaces for up to five days! They are saying that anyone infected can look, feel and appear perfectly normal with no symptoms for up to 14 days, while the virus is in its incubation period. During the incubation period, they believe that the individual is just as highly contagious as they would be if they were presenting symptoms similar to having a cold and/or the flu. Get busy! #coronavirus #coronavirusoutbreak #killervirus
2231672571246180649; 1; False; 1580256123; Take my temp if you have to :thermometer:
2231672560324316693; 0; False; 1580256122; #coronavirus #coronavirusoutbreak #illness #immunesystem #stayhealthy
2231672511578124442; 0; False; 1580256116; #coronavirus #gripe #china #fernando #madurocoñoetumadre
2231672457135080076; 2; False; 1580256109; :wedding::folded_hands_medium_skin_tone::⁣ ⁣ Faith is seeing light with your heart, when all your eyes see is darkness.⁣ ⁣ This world def needs a prayer January has been hitting us hard all around the world.⁣ ⁣ #canada #church #faith #love #hope #travel #prayforaustralia #prayforchina #prayforcuba #prayforflorida #prayforjamaica #coronavirus #naturaldisaster #travel #wanderlust #explore #spreadlove #picoftheday #photooftheday #ootd #nature
2231672393624226067; 0; False; 1580256102; PAGI ZOB, NIH ADA SIHITAM SANGAR SPECS HYPENO FG BLACK. WARNA HITAMNYA BIKIN PENAMPILAN SEPATU INI SANGAR ABIS. MANTUL POKONYA. Rp.359.000 SAJA UDAH DAPAT KALIAN BAWA PULANG NIH DAN DAPATKAN BONUS MENARIK DARI TOKO KAMI. - Size : 38 39 40 41 42 43 - Order :telephone: 08815317485 - #specs#sfsindo#sfs#ortuseight#adidas#nike#calci#mizuno#puma#sepatubola#sepatufutsal#coronavirus#sepaturunning#worldwar3#specsmetasala#specslightspeed#specsilluzion#specsaccfuri#ortusjogosala#ortushorizon#ortusmirage#ortuscatalyst#specsaccslaz#ortusjogosalavolta#ortuscatalystlegionfg#specshypeno
2231672325703398748; 0; False; 1580256094; Posted @withregram • @pmrkotabelud Info On Wheels Team JaPenKB turun padang semalam 28/01/2020 untuk mengedarkan risalah dan penyampaian maklumat berkenaan; :large_blue_diamond: Novel Coronavirus (2019-nCoV) :large_blue_diamond: Langkah-langkah Pencegahan :large_blue_diamond: Tanda & Gejala Di harapkan agar semua warga Kota Belud untuk sentiasa mengambil langkah berjaga-jaga bagi membendung penularan wabak ini. Mohon juga untuk tidak panik dan terus menerus menyebarkan info yang belum pasti kesahihannya memandangkan pelbagai maklumat viral yang palsu di media sosial kini, pastikan anda merujuk kepada laman web / Page Facebook Kementerian Kesihatan Malaysia. #InfoOnWheels #coronavirus #JapenSabah #JaPenKB #SayangiMalaysiaku #MalaysiaBersih #SharedProsperity
2231672140122437712; 9; False; 1580256094; Make sure you're taking appropriate measures to avoid getting sick this flu season. :face_with_medical_mask: Check out this list of preventive habits from the World Health Organization and remember to wash your hands often porque uno nunca sabe. // credit: @who⁠ .⁠ .⁠ .⁠ .⁠ .⁠ .⁠ .⁠ .⁠ .⁠ .⁠ .⁠ .⁠ .⁠ #sick #coronavirus #preventivemeasures #fluseason #worldhealthorganization
2231672275422600019; 0; False; 1580256088; Waspadai coronavirus yang sedang melanda beberapa negara di berbagai belahan dunia. Apa itu Coronavirus ? Apa saja gejala yang ditimbulkan? Dan bagaimana cara mencegahnya? Cari tahu infonya di postingan instagram Jimshoney yuk! Dan jangan lupa untuk selalu waspada dan jaga kesehatan kamu ya! . . #staysafe #corona #coronavirus #jimshoney
2231671956000813074; 19; False; 1580256086; Siendo el juego mas descargado, Plague Inc se hace famoso por el brote del coronavirus. Se trata de un videojuego que tiene ya 8 años, permitiéndonos "simular" los distintos tipos de enfermedades que podrían propargarse en la vida real por todo el mundo, gastando puntos para hacer evolucionar a tu enfermedad y hacerla inmune cada vez a más cosas, además de añadirle síntomas al gastar más puntos. Recientemente el estudio ha querido advertir de que el título no refleja un estricto modelo científico en cuanto a la propagación de enfermedades.⁠ ⁠ ⁠ ⁠ ⁠ ⁠ ⁠ ⁠ ⁠ #coronavirusgame #coronavirus #plagueinc #chinase #videoconsolas #portatiles #computadora #consolas #videojuegos #juegos #indigamer #videogamers #gaming #games #playstation #videojuego #videogames #gamer #indigames #pcgamer #ps4 #xboxone #switch #pc
2231672252628606129; 0; False; 1580256085; AHAHAHA SHARE IT . #coronavirus #memes #dankmemes #superdankmemes #funny #coronavirusmemes #like4likes #sub4subs
2231672233260781533; 0; False; 1580256083; #CORONAVIRUS, información general, cuando ir al médico, texto e importante #video para que aprendamos a cuidarnos. Por favor, seguir las indicaciones!!! Para ver todo, clic en mi link del perfil. Abrazo.
2231672228203144000; 1; False; 1580256082; Que veo, un rival :face_with_tears_of_joy::face_with_tears_of_joy::face_with_tears_of_joy: . . . @memes_de_enfermeria @memes_de_enfermeria Siguenos aquí :sparkles::globe_showing_Americas::index_pointing_up: Y déjanos tu comentario :star-struck: . . . #dengue #coronavirus #virus #viral #enfermeríaalpoder #rival #competencia #colombia #memes:face_with_tears_of_joy: #enfermeria:syringe::pill: #posturno:hospital:
2231672173634250568; 0; False; 1580256076; 한국질병관리본부에서 제공한 ‘우한폐렴’에 대한 FACT CHECK LIST입니다. Please don’t be MISINFORMED! #coronavirus #factsonly #misinformation #cdckorea
2231672154970548930; 0; False; 1580256073; :face_screaming_in_fear::anxious_face_with_sweat: #coronavirus #coronavirusoutbreak
2231672151614040029; 2; False; 1580256073; Vape mail from China came in today...fawkkkkk knew I shouldn't of watched Pandemic last night:face_with_tears_of_joy: #coronavirus #vapenation #vapemail #vapeshop #vapelove #eliquid #vape #ejuice #pandemic
2231672095358981175; 0; False; 1580256066; Pada saat ini, yang sedang banyak dibicarakan adalah corona virus. Virus ini sudah banyak menelan korban jiwa dan sedang menyebar keseluruh dunia. Untuk membantu mencegah CORONA VIRUS dan virus lainnya menyerang tubuh kita. Maka penting bagi kita untuk meningkatkan SISTEM IMUN/ DAYA TAHAN TUBUH. Bagaimana cara meningkatkan sistem imun/ daya tahan tubuh? Konsumsilah NUVIT rutin setiap hari sebanyak 1-2 kapsul 1-2 kali sehari. *Bisa dikonsumsi mulai usia 5 tahun Info dan order klik bit.ly/mcidurensawitndit #nuvit #nuvitmci #immunebooster #coronavirus #readystocknuvit
2231672064356715514; 0; False; 1580256063; #WHO #coronavirus Lembrando os principais sintomas: febre, dor, dificuldade para respirar, tosse, diarreia e pneumonia.
2231671379536085508; 0; False; 1580256062; Dizi: Stranger things Şarkı: bilmiyorum bunu , , , , , , , , , , , , , , , , , , , #strangerthings #netflix #iamsomerhalder #thevampirediaries #thevampirediariesedit #lyrics #şarkıedit #şarkı #youtube #lyricsedits #a #beautifuldestinations #americanbully #country #korona #corona #coronavirus #china #purple #makeupartist #orphanblack #joker #lyrcis #happynewyear #billieeilish #oscar #özelharekat #polisözelharekat #asker #vatan
2231672031783757486; 0; False; 1580256059; When did making decisions become hard * * * * * * * * * * #meme #memes #dankmemes #single #lonely #corona #coronavirus #china #wuhan #music #relationshipgoals #friendship #fridgegoals #explorepage #celebrity
2231671990434484875; 16; False; 1580256054; El brote del coronavirus que se inició en la ciudad china de Wuhan (provincia de Hubei) y ya se cobró la vida de 106 personas en el país asiático podría interrumpir el funcionamiento de las fábricas donde Apple produce sus dispositivos, informa este 28 de enero Bloomberg citando a varios expertos. El medio indica que el gigante tecnológico produce sus aparatos principalmente en dos factorías chinas: una perteneciente a Foxconn, en la ciudad de Zhengzhou, y una de Pegatron Corp., en Shanghái. A pesar de que ambas instalaciones se encuentran a una distancia de más de 500 kilómetros del foco del brote, sus empleados aún así corren el riesgo de entrar en contacto con el coronavirus. Según Bloomberg, Apple tiene aproximadamente 10.000 empleados en China, mientras que varios millones más participan en el funcionamiento de la red de suministro de componentes para sus productos. · · · #rtenespañol #actualidadrt #rtplayes #noticias #news #coronavirus #china #apple
2231671991811514940; 0; False; 1580256054; Story From Ben Kavanagh The Irish Psychologist. Today is Ben Kavanagh’s birthday. The Irishman is teaching psychology in Wuhan and says he should be out at the local Irish bar in the city celebrating with friends. Tomorrow, he had planned on returning to Europe to do some traveling. He remembers first hearing about the coronavirus as “a disease similar to SARS” around December 31. “Sir, can I go, I’ve got SARS,” he remembers one student in his class saying as a joke. Now, he’s trying to pass the time with Netflix and keeping in touch with friends and family. Kavanagh is one of 11 million Wuhan residents who are under travel restrictions. They are now essentially quarantined inside the city limits. Kavanagh went to a nearby supermarket two days ago to get enough supplies: water, pasta, hot dogs, canned food, soy milk and other non-perishables. Except he’s run of out of face masks, which are essential in preventing him getting the coronavirus. “I never had enough to begin with and the stores ran out immediately,” Kavanagh says. He says stores have been trying to restock, but he won’t be going outside until absolutely necessary. Kavanagh says he doesn’t worry, most of the time. But we are sure that's one of the many lies he has to tell himself. #coronavirus #trending #newsnow #wuhan #wuhanvirus #followtrain #followforfollowback #gaintrick #gaintricks #followme #instafollow
2231671868178787903; 1; False; 1580256039; That’s funny Bill Gates predicting an epidemic disease when he’s a scientist! Makes me want to think he’s the one working in the lab for this bio-weapon . WHAT A MAJOR SELLOUT! I know you’ve guys seen the 5G ad on YouTube of him trying to populate another bio-weapon of Electro Magnetic :magnet: Frequencies ! #corona #coronavirus #virus #coronaviruses #disease #diseases #germ #germs #pathogen #bioweapon #china #canada
2231671864497609071; 1; False; 1580256039; My people better watch out!:face_with_tears_of_joy: #Corona #CoronaVirus #Mexico
2231671773940705962; 1; False; 1580256034; PSA:police_car_light: IF you have a cough, cover your mouth! Theres a virus spreading that has NO cure, you dumb fucks! K thx, bye!:grinning_face_with_big_eyes::middle_finger_medium-light_skin_tone::face_blowing_a_kiss:
2231671748978479666; 0; False; 1580256030; Head over to our website for updates on the novel #coronavirus! Dr. Luis Ostrosky, infectious disease expert, informs us on the current status of the disease. #virus #awareness #coronavirusoutbreak https://www.utphysicians.com/novel-coronavirus-what-you-need-to-know/
2231671756140709650; 0; False; 1580256026; #coronavirus :warning:Coronavirus : un quatrième cas confirmé en France et jugé «sévère».
2231671486983496080; 0; False; 1580256021; #Repost @austin360radio with @get_repost ・・・ @Jb won’t let me redo this video even though my gum looks like an extra tooth. :face_with_symbols_on_mouth: Tune in today to get the scoop on things like the #coronavirus and the #zebramussels , yeah those are coming back. Get the app Austin 360 Radio or turn up the radio at statesman.com @statesman or Austin360.com @austin360 or hookem.com!! #austintexas #austin #keepaustinweird #stayinalive #austinnews #localstories @glamerdoc @whitney_stropp
2231671442843668233; 2; False; 1580256005; #Repost via @tariqelite People are out here eating flying balls of rabies...... And then wonder why diseases like the #Coronavirus is popping up :nauseated_face::face_vomiting: #smh
2231671539102120681; 0; False; 1580256000; Repost • @garyyourofsky Demand for flesh kills animals. . Eating animals kills humans . Stop this madness and go vegan . . #coronavirus
2231671428668187956; 11; False; 1580255987; Fighting #coronavirus! #TRON is on the way! Wuhan, we are with you! Stay strong! @tronfoundation
2231671426996338782; 0; False; 1580255987; You have probably read or seen the news about the new #coronavirus illness that started in Wuhan, China. This new virus has been confirmed in people in many parts of China as well as several other countries, including in the United States. At this time, no cases of the new virus have been confirmed in Santa Clara County. But the situation and spread of this virus is quickly changing. Keep up to date at: www.sccphd.org/coronavirus
2231671411561525007; 0; False; 1580255985; Coronavirus ain’t got shit on me!!! (*Denzel Washington voice*) #coronavirus #travel #airport #asia #Batsoup #damnitChina #IAintGettingSick #hashtag
2231670397899027289; 0; False; 1580255984; Why don’t the emergency nurses quit in Wuhan and walk away from this dangerous job. Listen to the answer from an Emergency Nurse. Listen to the full episode on #podcasts or Spotify Link in Bio. #coronavirus #coronavirusoutbreak #thejamesriceshow #ingles #intercambio #news #breakingnews
2231671396085576473; 1; False; 1580255983; No Corona virus~ 우한폐렴 무셔~. #officedog #coronavirus
2231668349543496676; 1; False; 1580255981; :microbe:#importante Lo que necesitas saber acerca del nuevo #coronavirus (nCoV). ⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀ :stop_sign:¿Qué son? ⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀ Los Coronavirus son una gran familia de virus que causan enfermedades que van desde el resfriado común hasta enfermedades más graves como el síndrome de respiratorio agudo grave #SARS-CoV, síndrome respiratorio de Oriente Medio #MERS-CoV, entre otros. ⠀⠀⠀⠀⠀⠀⠀⠀⠀ :stop_sign: Wuhan Coronavirus (2019-nCoV) También conocido como nuevo Coronavirus 2019/2020, es una nueva cepa que no había sido identificada previamente en humanos. ⠀⠀⠀⠀⠀⠀⠀⠀⠀ :stop_sign:¿Cuales son sus síntomas? Los signos comunes incluyen fiebre, tos, dificultad para respirar; en casos más graves la infección puede causar neumonía, síndrome respiratorio agudo grave, insuficiencia renal e incluso la muerte. ⠀⠀⠀⠀⠀⠀⠀⠀⠀ :globe_showing_Asia-Australia: Hay infecciones confirmadas en Tailandia, Japón y Corea del Sur; se está investigando un caso sospechoso en Australia, otro en Filipinas, y en México, uno se descartó y otro sigue en observación. ⠀⠀⠀⠀⠀⠀⠀⠀⠀ ⠀⠀⠀⠀⠀⠀⠀⠀⠀ :Ecuador:En#ecuador se ha reportado un caso sospecho, sin ningún diagnóstico hasta ahora. ⠀⠀⠀⠀⠀⠀⠀⠀⠀ :microbe:¿Que opinan sobre la rápida acción de los expertos? Están tomando alguna medida de precaución ¿Cuáles son?. No olvides dejarme tus dudas o comentarios aquí :down_arrow: ⠀⠀⠀⠀⠀⠀⠀⠀⠀ ⠀⠀⠀⠀⠀⠀⠀⠀⠀ ⠀⠀⠀⠀⠀⠀⠀⠀⠀ ⠀⠀⠀⠀⠀⠀⠀⠀⠀ ⠀⠀⠀⠀⠀⠀⠀⠀⠀ #wuhan #wuhancoronavirus #coronavirus #ecuador #severeacuterespiratorysyndrome #middleeastrespiratorysyndrome #coronavirusoutbreak #neumonia #divulgacioncientifica #ciencia #cientificoslatinoamericanos #genen_ka #@genen_ka #genetica #genetics #quito
2231665668311175023; 0; False; 1580255977; #coronavirus#virus#china
2231671248271057070; 0; False; 1580255965; Waspadai coronavirus yang sedang melanda beberapa negara di berbagai belahan dunia. Apa itu Coronavirus ? Apa saja gejala yang ditimbulkan? Dan bagaimana cara mencegahnya? Cari tahu infonya di postingan instagram Jimshoney yuk! Dan jangan lupa untuk selalu waspada dan jaga kesehatan kamu ya! . . #staysafe #corona #coronavirus #jimshoney #lasarasshopinfo
2231671186303947577; 0; False; 1580255958; Edited #photography #art #edits #orange #space #photoshop #canada #aesthetic #aestheticedits #coronavirus
2231671145526872865; 2; False; 1580255953; Well I’m not gonna go to school if I can help it now. Good luck to everyone near the college. Hope you don’t get it #coronavirus
2231671145594600428; 0; False; 1580255953; Waspadai coronavirus yang sedang melanda beberapa negara di berbagai belahan dunia. Apa itu Coronavirus ? Apa saja gejala yang ditimbulkan? Dan bagaimana cara mencegahnya? Cari tahu infonya di postingan instagram Jimshoney yuk! Dan jangan lupa untuk selalu waspada dan jaga kesehatan kamu ya! . . #staysafe #corona #coronavirus #jimshoney #lasarasshopinfo
2231671146357787877; 0; False; 1580255953; YouTube w/Burak öztekin - - - - - #keşfet #sondakika #corona #virus #coronavirus #deprem #mizah #aykutelmas #youtube #kendinemüzisyen #tiktok #instagram #cat #doggystyles #miakhalifa #dog #jahrein #alibicim #mesutcantomay #vine #enesbatur
2231671137331667952; 0; False; 1580255952; Siempre es mejor estar preparados ante cualquier situación. Aquí hay algunas cosas importantes que debes saber sobre el #CoronaVirus, comparte esta información a quien creas que la necesite! #TeCuidamosComoANosotrosMismos
2231671111391982863; 4; False; 1580255949; When In Hong Kong! Ain’t no disease ruining my holiday :face_with_tears_of_joy::Hong_Kong_SAR_China: . . . . . #hongkong #asia #china #mask #coronavirus #coronavirusoutbreak #subway #city #quiet #ghosttown #HK #dr
2231671091957640680; 0; False; 1580255947; #coronavirus #virus #gripe #diarrea #nauseas #dolordecabeza #fatiga #tos #fiebre #neumonia #china #argentina #medico #doctor #prevencion #consultorio
2231671063065271242; 0; False; 1580255943; Dunia kesehatan saat ini sedang guncang oleh kejadian yang bersumber utama dari kota Wuhan, Negeri Tiongkok. Corona Virus yang telah menyerang ratusan orang dan membuat kota Wuhan diisolir ini juga membuat penerbangan dari ataupun ke Tiongkok diperketat. ⠀⠀⠀⠀⠀⠀⠀⠀⠀ Tim dokter dan perawat serta seluruh tenaga kesehatan di Wuhan sudah mulai berada di titik kelelahan akibat membanjirnya pasien yang terkena virus ini. ⠀⠀⠀⠀⠀⠀⠀⠀⠀ Namun diantara video-video mengerikan yang beredar mengenai corona virus ini, ada sebuah video menarik yang diunggah oleh salah seorang mahasiswi asal Indonesia @ayulrast dan akun @cctv_asiapacific Video tersebut merekam teriakan para warga Wuhan yang menyemangati seluruh penduduk kotanya agar tetap tegar, agar Wuhan yang banyak diberitakan telah berubah menjadi seperti kota mati itu tetap bertahan. Suara-suara yang tidak mau menyerah walau diselimuti oleh ketakutan, suara-suara yang seharusnya digaungkan oleh seluruh dunia dan tetap optimis bahwa akan segera ada titik terangnya mengenai permasalahan ini. Tanpa mengesampingkan hal-hal yang harus dilakukan agar tidak tertular virus ini. ⠀⠀⠀⠀⠀⠀⠀⠀⠀ Untuk para WNI, mahasiswa-mahasiswi yang sedang di Wuhan, anggota KBRI, dan semua penduduk di sana. Jiayou! Tetap waspada, semoga kalian terhindar dari hal-hal yang tidak diinginkan. ⠀⠀⠀⠀⠀⠀⠀⠀⠀ #武汉加油 #Wuhanjiayou #加油 #加油:flexed_biceps: ‪#nCoV2019 #武漢肺炎 #coronavirus #viruscorona #brandmarketing #digitalmarketingstrategy #smma #marketingagency #influencermarketing #instagrammarketing #RIPmamba #socialmediamarketingtips #pelatihan #seminardokter #pelatihankedokteran
2231671045115820205; 0; False; 1580255941; Waspadai coronavirus yang sedang melanda beberapa negara di berbagai belahan dunia. Apa itu Coronavirus ? Apa saja gejala yang ditimbulkan? Dan bagaimana cara mencegahnya? Cari tahu infonya di postingan instagram Jimshoney yuk! Dan jangan lupa untuk selalu waspada dan jaga kesehatan kamu ya! . . #staysafe #corona #coronavirus #jimshoney #lasarasshopinfo
2231671018043506877; 2; False; 1580255938; :Australia:豪州でも:microbe:新型肺炎の感染が拡大してる。ただこの国の人間は風邪を引いても:face_with_medical_mask:マスクしないし、:soap:手洗いもあまり一般的じゃない:persevering_face: :television:メディアも感染者数は報道するけど:Japan:日本みたく予防策を紹介してる番組は見たことない:thinking_face: 感染者数が今後激増しそうで怖い...:fearful_face: #coronavirus #infectiousdisease #shibainu #shiba #shibastagram #dogstagram #新型肺炎 #コロナウィルス #感染病 #柴犬 #柴犬ひな #柴犬日記 #オーストラリア #オーストラリア生活
2231671020997953936; 4; False; 1580255938; #coronavirus
2231670975404338015; 0; False; 1580255933; Virus Corona tersebar lewat Xiaomi? . Tenang warna +62 punya Smadav yg handal menangkal virus . #corona #virust #virus #coronavirus #toyotacorona #bingung #xiaomi #huwan
2231668197342721740; 0; False; 1580255928; #dolar #coronavirus #economy #economia #evaluecon #igtv #economiamundial #economist
2231669102498198151; 0; False; 1580255926; 바이러스변이 Air sterilizer solution 공기살균솔루션 #우한바이러스 #우한폐렴 #중국폐렴 #coronavirus #폐렴#신종코로나바이러스 #코로나바이러스 #고양#일산#주엽#운정
2231670886041607092; 1; False; 1580255922; Mask and headphones: fighter pilot status unlocked. . . #coronavirus #stayhealthy #washyourhands #donttouchyourface #flying #flight #delays #letsgoalready
2231670829981482382; 0; False; 1580255915; El coronavirus provoca síntomas similares al Síndroma Respiratorio Agudo y Grave (SARS) y ha afectado mayoritariamente a individuos que presentaban buena salud, según dos estudios publicados recientemente por la revista científica The Lancet. Muchos de los casos diagnosticados están ligados al mercado de Huanan, en la ciudad china de Wuhan, donde se vendían animales recién sacrificados, aunque la fuente original de la infección sigue siendo desconocida. #coronavirus #salud #china #health #noticiasinternacionales
2231670448568303036; 0; False; 1580255915; China: Contagiados del Coronavirus en estado de cuarentena pelean entre sí y contra la policía. En las calles hay gente que cae al suelo sin motivos aparente. #coronavirus https://t.co/bwQLSDE18p
2231670817623009873; 0; False; 1580255914; On January 28, Provincial Health Officer Dr Bonnie Henry and Health Minister Adrian Dix announced at the #BCCDC that the first case of novel coronavirus has been identified in BC. Risk to BC-ians remains low, & our public health experts are working diligently to ensure it does not spread among our population. . Key takeaways: - Wash your hands regularly, cover your mouth when you sneeze and cough, and stay home when you're ill. - Access information from reputable sources like us, the BC Centre for Disease Control, and the BC Ministry of Health - Health officials are working hard to monitor, assess, test, and care for our population and ensure we stay safe. . We put up a new blog post about it on our website. Link in bio. . . . . #coronavirus #coronvirusoutbreak #britishcolumbia #bc #yvr #vancouver #diseaseprevention #virus #canada #healthycanada #VancouverCoastalHealth #NorthVancouver #WestVancouver #RichmondBC #SeatoSky #SunshineCoast #centralcoast
2231670757024800622; 0; False; 1580255907; :warning::warning::warning:⁣⁣ ⁣⁣ 𝗝𝗮𝗻𝗴𝗮𝗻 𝗯𝗶𝗮𝗿𝗸𝗮𝗻 𝗸𝗮𝗹𝗮𝘂 𝗮𝗱𝗮 𝘁𝗮𝗻𝗱𝗮𝟮 𝗶𝗻𝗶,𝗺𝘂𝗻𝗴𝗸𝗶𝗻 𝗺𝗲𝗻𝗴𝗮𝗹𝗮𝗺𝗶 𝗯𝘂𝗮𝗵 𝗽𝗶𝗻𝗴𝗴𝗮𝗻𝗴 𝗯𝗼𝗰𝗼𝗿⁣⁣ ⁣⁣ :pushpin: Kencing Berbuih Dan Keruh⁣⁣ :pushpin: Bengkak Kaki dan muka⁣⁣ :pushpin: Cepat lemah dan letih⁣⁣ :pushpin: Kulit gatal dan kering⁣⁣ :pushpin: Sukar Tidur dan kejang otot⁣⁣ :pushpin: Sakit belakang dan Pinggang⁣⁣ ⁣⁣ Penyebab Utama Buah Pinggang Rosak/Bocor :⁣⁣ :ambulance: Kencing Manis⁣⁣ :ambulance: Darah Tinggi⁣⁣ :ambulance: Terlebih Makan Ubat-ubatan⁣⁣ ⁣⁣ Susu C2Joy dapat membantu anda dgn hanya 1 product dapat menyelesaikan pelbagai penyakit dengan izinNya⁣⁣ ⁣⁣ Jika anda sayangkan kesihatan anda cepat BERTINDAK SEKARANG sebelum terlambat:person_tipping_hand:⁣⁣ ⁣⁣⁣ :red_apple: Jom try susu kolostrum C2joy pm tepi Cik. Suzy :face_blowing_a_kiss:⁣⁣⁣ ⁣⁣⁣ #fenomenaC2Joy⁣⁣⁣⁣ #C2Joy⁣⁣⁣⁣ #susukesihatan⁣⁣⁣⁣ #InfuenzaA⁣⁣⁣⁣ #kalsium⁣⁣⁣⁣ #colostrum⁣⁣⁣ #corona⁣⁣⁣ #coronavirus⁣⁣⁣ #coronavirusoutbreak⁣⁣⁣ #diabetes⁣⁣⁣ #kencingmanis⁣⁣⁣ #buahpinggang⁣ #kidneystones⁣ #cancer⁣⁣⁣ #eczema⁣⁣⁣ #resdung⁣⁣⁣ #denguefever⁣⁣⁣ #nochemicals⁣⁣⁣ #nosugar
2231670657492909762; 0; False; 1580255901; Pagi ini, kita telah sampai di Wuhan, mencari fakta diantara tumpukan opini. Benarkah coronavirus senjata biologis? Masih teringat di kepala merpati sampai anjing terlibat dalam perang. Adakah binatang tersebut menggigit tuannya? Nantikan kami di pacitankab.go.id atau pada laman sosmed kami di pemkabpacitan. (Justkidding). #wuhan #corona #coronavirus #china #guyon
2231670680060255211; 2; False; 1580255898; [CORONAVÍRUS: PRINCIPAIS INFORMAÇÕES]:thinking_face: A doença provocada pelo coronavírus é parecida com uma pneumonia e infelizmente pode matar. ⠀⠀⠀⠀⠀⠀⠀⠀⠀ :backhand_index_pointing_right:SINTOMAS: febre, tosse, falta de ar e dificuldade em respirar. ⠀⠀⠀⠀⠀⠀⠀⠀⠀ :backhand_index_pointing_right:TRANSMISSÃO: o coronavírus é contagioso e sua transmissão ocorre por meio de gotículas expelidas quando tossimos ⠀⠀⠀⠀⠀⠀⠀⠀⠀ :backhand_index_pointing_right: PREVENÇÃO: (em áreas de risco) :right_arrow: evitar contato (sem proteção) com animais e pessoas que apresentem sintomas semelhantes aos de resfriado ou de gripe :right_arrow: ovos e carnes só devem ser ingeridos após o cozimento ⠀⠀⠀⠀⠀⠀⠀⠀⠀ :backhand_index_pointing_right:PERÍODO DE INCUBAÇÃO: 1 a 2 semanas ⠀⠀⠀⠀⠀⠀⠀⠀⠀ :backhand_index_pointing_right:AINDA NÃO TEMOS CASOS CONFIRMADOS NO BRASIL, ATÉ ESTE MOMENTO. ⠀⠀⠀⠀⠀⠀⠀⠀⠀ :red_heart: Nós Cuidamos de Você! :red_heart: ⠀⠀⠀⠀⠀⠀⠀⠀⠀ Dra Elaini Olivo Farmacêutica Clínica e Esteta Farmácia Compre Certo Abadia ⠀⠀⠀⠀⠀⠀⠀⠀⠀ Fontes: Ministério da Saúde e Hospital Israelita Albert Einstein ⠀⠀⠀⠀⠀⠀⠀⠀⠀ :rocket:Entrega Grátis #entregarapida ⠀⠀⠀⠀⠀⠀⠀⠀⠀ :telephone:(34) 3317 1122 :mobile_phone:(34)991407475 Whatsapp ⠀⠀⠀⠀⠀⠀⠀⠀⠀ #coronavirus #prevencao #sintomas #pandemia #virus #wuhan #corona #doencas #sars #viruscorona
2231670615869500967; 2; False; 1580255890; :red_circle:Kıyamet alametlerini sizler için derledim topladım. :red_circle:Allah sonumuzu hayır etsin. Yaklaşan yaklaştı. Onu Allah'tan başka açığa çıkaracak yoktur. (NECM/57-58) #corona #coronarvirus #koronavirus #virüs #deprem #çin #Wuhan #türkiye #almanya #istanbul #izmir #adana #gaziantep #salgın #hastalık #coronavirues #CoronaVirus #kıyamet #kıyametalametleri #antalya #trabzon #afad #haber #SonDakika #aztagram #followme #küba #video #mizah #çin . Dünya'da Olan En Güncel Olay ve Gelişmelerden herkesten önce haberdar olmak istemezmisiniz? @reflexhaber Bizi Takip Edebilirsiniz.
2231670512656650242; 1; False; 1580255878; :man_walking_medium-dark_skin_tone: Nah fuck that #coronavirus
2231670481853882854; 0; False; 1580255874; Affiche des villes contaminé ! #corona #virus #coronavirus #followers #likeforfollow #humour #memes #popular #instagood #instagram
2231670479796910381; 0; False; 1580255874; Coronavirus impacts lunar New Year celebrations. #coronavirus #yearoftherat #lunarnewyear #rhetornews
2231670435957709082; 0; False; 1580255868; #Coronavirus finds its way to Africa as a patient from Guangzhou, China was quarantined upon boarding Kenya Airways. The passenger was immediately rushed to the Kenyatta National Hospital in Nairobi. Don't stop trying as much as you can to protect yourself and everyone around you. Also, be very observant. Source: @saharareporters
2231670238339399579; 0; False; 1580255845; :skull_and_crossbones:Corona virus memes:skull_and_crossbones:#memes #meme #dank #dankmemes #dankmeme #dankmemesdaily #coronavirus #coronavirusmemes #coronavirusoutbreak #china #sick #sickmemes #sickmeme #likeforlikes #like4likes #likeforfollow #random #randomshitpost #funny #offensive #offensivememes #lol #share #minecraft #jamescharles #humor
2231670222302236692; 1; False; 1580255843; An Italian friend posted his voice to speak for China against this sad event. I am so touched by his words and faith. People need to listen to voices from who live there before criticizing the country. And I hope that we can combat the virus soon and no more deaths.
2231670169812791038; 4; False; 1580255837; Hit the DM if you want one.
2231643614843504932; 0; False; 1580255833; Самые свежие новости. Число жертв нового короновируса в Китае возросло до 90 Только за последние сутки количество зараженных увеличилось на треть. Сейчас их уже более 3800. Одна из крупнейших сетей питания объявила о закрытии ресторанов по всему Китаю, чтобы сдержать распространение. . . . . #coronavirus #короновирус #китай #европа #болезнь #смерть #опасность #мир #видео #хэштеги #новости #новости_ru #карантин #эпидемия #инстатаграм #весьмир #карантин #страх #top #люди #человек #video #life #жизнь #china #europe #ухань #wuhan #россия #болезнь
2231635753805165231; 0; False; 1580255631; ・・・ COMPELLING EVIDENCE !!! FAKED DEATH SACRIFICE !! Energy Harvesting off the mass public mourning and part of DEEP STATE DISTRACTION !!! #Trump stay winning ! I was hoping I was wrong .... LMAO !!! FUCK NO !!! — I LOVE IT WHEN I’M RIGHT !!!! •SUP FUCKERS ??!!!! EYE :eye: told you :backhand_index_pointing_right: #itsALLconnected PIZZAGATE FACILITY IN -#Mexico :Mexico:• #EpsteinDidntKillHimself or #EpsteinIsntDead • #KobeBryant #LebronJames #Qdrop why they hate #TRUMP2020 he got the drop on them all !!!! All Distractions !!!! #coronaVirus #Impeachment #covington crash head on • :rocket: 5 rockets hit embassy • Bolton’s book leaked • Kill Of #Kobe24 Bryant • ALL DISTRACTIONS !!! Also, all the #Colorado rape case was about was part of his deal with the #illuminati he was part of pizzagate #:pizza:- #JeffreyEpstein always recorded the sex acts of the #elite to black mail them later. What excludes your beloved KOBE ? • NOW DO YOU SEE HOW YOU ARE WORSHIPPING A #LUCIFERIAN #FREEMASON !!! • • THE #GOD FREQUENCY • #TheTruthShallSetYouFree !
2231661440921478325; 3; False; 1580254913; Iykyk :face_with_thermometer: Follow @thurstshake :glass_of_milk: Follow @thurstshake :glass_of_milk:
2231635219903374192; 0; False; 1580251670; :hushed_face: Coronavírus no BRASIL, é isso mesmo? Calma :raised_hand_light_skin_tone:, o primeiro caso suspeito está sob investigação. Trata-se de uma jovem de 22 anos que esteve recentemente Wuhan ( cidade de ponto central onde se deu a contaminação pelo vírus na China). :woman_tipping_hand_light_skin_tone: E quais são os SINAIS e SINTOMAS que os pacientes apresentam? São principalmente sintomas respiratórios, tendo: febre, tosse e dificuldade de respirar. :woman_shrugging_light_skin_tone: O que deve ser feito como PREVENÇÃO E CONTROLE? Não existe vacina para prevenir a infecção por 2019-nCoV. :red_triangle_pointed_up:Lavar as mãos frequentemente é sempre algo primordial e agora mais do que nunca, o ideal com água e sabão por pelo menos 20 segundos; :red_triangle_pointed_up: Se não tiver a água e o sabão?? Utiliza a solução antisséptica à base de álcool 70%; :red_triangle_pointed_up:Cobrir boca e nariz ao tossir ou espirrar com um lenço de papel e descartá-lo em seguida; :red_triangle_pointed_up:Evitar tocar nos olhos,nariz e boca com as mãos não lavadas; :red_triangle_pointed_up:Evitar contato próximo com pessoas doentes. (ESSAS SÃO RECOMENDAÇÕES DO MS, 2020). :woman_gesturing_NO_light_skin_tone:CASO SUSPEITO o que fazer? :red_triangle_pointed_up:pacientes: usar máscara cirúrgica a partir do momento da suspeita e ser mantido em quarto privativo. :SOS_button: O paciente deve ser mantido em isolamento enquanto houver sinais e sintomas clínicos. :red_triangle_pointed_up:profissionais: usar medidas de precaução padrão, gotículas e de contato: máscara cirúrgica, luvas, avental não estéril e óculos de proteção. :SOS_button: Na realização de procedimentos como aspiração de vias áreas ou indução de escarro, podendo ter contaminação por aerossóis, deve fazer uso da máscara N95 (item de precaução por aerossóis). . . . . . . #coronavirus #ministeriodasaude #saudeemacao #atencao #brasil #enfermagempqsim #enfermagem #enfermeira #enfermagemlove #enfermagemminhavida #nurse #emfermeirosemformação #enfermagemhumanizada #cuidar #cuidaréumdom #Prevenir #enfermagem #enfermagempqsim #enfermagemevida #enfermagemhumanizada #saojoao #nursing #estudando #enferlove:red_heart: #enfermagem2020
2231597727481311539; 0; False; 1580247201; #coronavirus ready
2231567397999131849; 3; False; 1580243637; What's your favorite music to listen to??? @zromeo21 @sriracha_james @wilsonlocals @andalebearings @ratcheesegourmetskate @dlxsf @dustysnutsandbolts @socalskateshop @brothersskateboardco @official_weoutheredoe @rastaclat @laxxcbd @eve.farms @dickiesskate @dickies @berrics @vansskate @vans @spitfirewheels @lowellfarms #justhavefun #instadaily #spitfirewheels #iloveskateboarding #orangecounty #anaheim #wheeliedope #fun #skate #berrics #dowhatyoulove #seekthepositive #vans #clatlife #losangeles #instagood #dickiesskate #skateboarding #vans #skateanddestroy #damnitfeelsgoodtobeaskater #skateboardingisfun #420 #cbd #thc #cannabis #tacotuesday #coronavirus
2231337898737448239; 0; False; 1580216227; E neste domingo, dia 26/01/2020, a China informou que o número de mortes pelo Coronavirus subiu para 56 !!! Já são 2051 pessoas infectadas, de acordo com a televisão estatal chinesa. Você sabe como é a transmissão? Resumidamente: - Pelo ar; - Por meio de tosse ou espirro; - Contato pessoal (toque, aperto de mão, saliva); - Contato com objetos ou superfícies contaminadas, seguido de contato com boca, nariz. Qual é a melhor maneira de se prevenir? - Frequente lavagem e higienização das mãos, principalmente antes de consumir algum alimento; - Utilizar lenço descartável para higiene nasal; - Cobrir nariz e boca quando espirrar ou tossir, em seguida lavar as mãos; - Evitar colocar as mãos no nariz e na boca (exceto caso esteja espirrando ou tossindo); - Não compartilhar objetos de uso pessoal, como talheres, pratos, copos ou garrafas; - Manter os ambientes bem ventilados; - Evitar contato próximo a pessoas que apresentem sinais ou sintomas de infecção respiratória. #saude #prevencao #medicina #coronavirus #rioclaro #pneumologia #cuidado #care #health
2230712549652447920; 0; False; 1580141688; Bock auf chicken nuggets . . . . . . #chicken #funnyvideos #memes #haha #witzig #keller @abugullo#funnyvideos #haha #memes #illness #china #blackhumor #haha #witzig #alman #memes #keller #likeforlikes #likeforfollow #wuhan #virus #corona #coronavirus #deutschrap #tiktokmemes #tiktokgirls #tiktok #alman #almanmemes #capitalbra #nimo #mero428 #kmn
2203078065725871398; 0; False; 1576847409; Prototyp Shisha Bar dilara . . . . #dilara #nails #nägel #haha #memes #witzigevideos #witzig #deutschrap @engelgesicht1001#funnyvideos #haha #memes #illness #china #blackhumor #haha #witzig #alman #memes #keller #likeforlikes #likeforfollow #wuhan #virus #corona #coronavirus #deutschrap #tiktokmemes #tiktokgirls #tiktok #alman #almanmemes #capitalbra #nimo #mero428 #kmn
2192454968400249119; 0; False; 1575581056; Zu wild . . . . . #deutschrap #deutschland #witzig #rap #schlecht #memes #mero428 #187strassenbande #funny #followforfollowback #likeforfollow#funnyvideos #haha #memes #illness #china #blackhumor #haha #witzig #alman #memes #keller #likeforlikes #likeforfollow #wuhan #virus #corona #coronavirus #deutschrap #tiktokmemes #tiktokgirls #tiktok #alman #almanmemes #capitalbra #nimo #mero428 #kmn
2175625578255275381; 2; False; 1573574815; Nehmt es mit Humor . ' ' . #kurdistan #haha #schwarzerhumor #witzig #funny #memes #likeforlikes#funnyvideos #haha #memes #illness #china #blackhumor #haha #witzig #alman #memes #keller #likeforlikes #likeforfollow #wuhan #virus #corona #coronavirus #deutschrap #tiktokmemes #tiktokgirls #tiktok #alman #almanmemes #capitalbra #nimo #mero428 #kmn
2171403889811752627; 0; False; 1573071563; Der alti nafri yasin . . . . . . . . . #marokko #nazi #witzig #witzigevideos #memes #asylanten #haha #dumm#funnyvideos #haha #memes #illness #china #blackhumor #haha #witzig #alman #memes #keller #likeforlikes #likeforfollow #wuhan #virus #corona #coronavirus #deutschrap #tiktokmemes #tiktokgirls #tiktok #alman #almanmemes #capitalbra #nimo #mero428 #kmn
2171305231299152878; 0; False; 1573059791; Cringe . . . . . . . . #weiterbildung #witzig #funny #followforfollowback #likeforlikes #memes #dumm #crazy#funnyvideos #haha #memes #illness #china #blackhumor #haha #witzig #alman #memes #keller #likeforlikes #likeforfollow #wuhan #virus #corona #coronavirus #deutschrap #tiktokmemes #tiktokgirls #tiktok #alman #almanmemes #capitalbra #nimo #mero428 #kmn
2170538389911690206; 1; False; 1572968375; Scharmuta . . . . . . . #schlampen #witzig #gürtel #araber #haha #memes #followforfollowback #likeforlikes#funnyvideos #haha #memes #illness #china #blackhumor #haha #witzig #alman #memes #keller #likeforlikes #likeforfollow #wuhan #virus #corona #coronavirus #deutschrap #tiktokmemes #tiktokgirls #tiktok #alman #almanmemes #capitalbra #nimo #mero428 #kmn
2169906186806811305; 0; False; 1572893026; ....... . . . . . . . #haha #funnymemes #funnyvideos #witzig #memes #kids #kind #likeforlikes #followforfollowback#funnyvideos #haha #memes #illness #china #blackhumor #haha #witzig #alman #memes #keller #likeforlikes #likeforfollow #wuhan #virus #corona #coronavirus #deutschrap #tiktokmemes #tiktokgirls #tiktok #alman #almanmemes #capitalbra #nimo #mero428 #kmn
2169815551143801226; 1; False; 1572882207; Mach dei arch zu grehta . . . . . . . #karin #familieritter #howdareyou #grethathunberg #graffiti #witzig #memes #haha#funnyvideos #haha #memes #illness #china #blackhumor #haha #witzig #alman #memes #keller #likeforlikes #likeforfollow #wuhan #virus #corona #coronavirus #deutschrap #tiktokmemes #tiktokgirls #tiktok #alman #almanmemes #capitalbra #nimo #mero428 #kmn
2169725795588271787; 0; False; 1572871505; Titten . . . . . . . . . #memes #witzig #haha #dicketittenkartoffelsalat#funnyvideos #haha #memes #illness #china #blackhumor #haha #witzig #alman #memes #keller #likeforlikes #likeforfollow #wuhan #virus #corona #coronavirus #deutschrap #tiktokmemes #tiktokgirls #tiktok #alman #almanmemes #capitalbra #nimo #mero428 #kmn
2166313199174472061; 1; False; 1572464693; Was!? nix verstanden:face_with_tears_of_joy: . . . . . . . . . . . #newcommer #deutschrap #deutschland #rap #witzig #schlecht #haha @xatar#funnyvideos #haha #memes #illness #china #blackhumor #haha #witzig #alman #memes #keller #likeforlikes #likeforfollow #wuhan #virus #corona #coronavirus #deutschrap #tiktokmemes #tiktokgirls #tiktok #alman #almanmemes #capitalbra #nimo #mero428 #kmn
2231669886260708547; 0; False; 1580255816; I'm booking the next flight to Greenland - - - - - #funny #meme #memes #dankmemes #spicymemes #shitpost #comedy #funnymeme #funny video #funnyimage #coronavirus
2231669990012456909; 0; False; 1580255815; Coronavirus nCoV Update Cases: 5578 Deaths: 131 Jan 28 - 23:33 GMT #coronavirus #coronavirusupdates #coronavirus888
2231669913112554451; 0; False; 1580255806; DON’T PANIC!!!! The coronavirus is a bad cold!!!! Like the flu it is dangerous in those with respiratory issues (asthma, copd,) delicate immune systems (diabetes, steroids, cancer treatments,) geriatric patients and babies. The flu is much more prevalent and deadly! Coronavirus has killed 50 people while influenza killed 5,000 in the first 2 weeks of 2020! Influenza killed over 50,000 in 2019 in the US alone! There is no treatment, just supportive care (fever reducers, fluids, cough medicine, etc). There is not an easy or standard test for it. If you haven’t been to wuhan China, you don’t need a test for it if you have a fever and cough. GET A FLU SHOT!!!!! This disease outbreak in the social media era has been defined by panic and uncertainty. An onslaught of sensational disinformation has spread like wildfire on platforms like Facebook and Instagram. Remember SARS, H1N1, swine flu, MERS, Ebola??!!!! Wash your hands frequently; don’t touch your mouth, eyes, or nose; and avoiding sick people — standard advice during flu season. Masks are not necessary for anyone in the US. #stayingAlive #girlERdoc #emergency #AngeliquesOfInsta #girldoctor #health #coronavirus #flu #influenza
2231668788906267029; 0; False; 1580255801; Follow @meme_daily48 for more #racistmeme #trendingmemes #trending #asian #asianmemes #asianmeme #chinesememes #coranavirus #coronavirus #virus #racistmemesarethebestmemes
2231669852825986584; 2; False; 1580255799; NEWS: Another case in Canada coming from British Columbia :smiling_face_with_horns::beer_mug::test_tube: #corona #coronavirus #ronavirus
2231669818264429128; 2; False; 1580255798; #docmediinfectologia . Ministério da Saúde confirma 3 casos suspeitos de coronavírus no Brasil . O Ministério da Saúde informou nesta terça-feira que o Brasil tem três casos suspeitos de infecção pelo nova coronavírus, localizados em Belo Horizonte, Porto Alegre e Curitiba. . “Os pacientes se enquadraram na atual definição de caso suspeito para NCOV-2019 (o novo coronavirus), estabelecido pela OMS (Organização Mundial de Saúde), ou seja, apresentou febre e pelo menos um sinal ou sintoma respiratório e viajou para área de transmissão local nos últimos 14 dias”, disse o ministério em nota. . “A Organização Mundial da Saúde (OMS) aumentou o nível de alerta para alto em relação ao risco global do novo coronavírus, por isso, o Ministério da Saúde orienta que viagens para a China devem ser realizadas em casos de extrema necessidade. Com quase três mil casos confirmados, segundo o último boletim da OMS, todo o território chinês passa a ser considerado área de transmissão ativa da doença”, acrescenta a nota. . Fonte: Reuters . https://br.reuters.com/article/topNews/idBRKBN1ZR1PZ-OBRTP . #docmedia #coronavirus #infectologia #epidemia #saúde #medicina
2231669069008942745; 0; False; 1580255795; That @corona virus is wild :pensive_face: ✩ ✩ ✩ ✩ follow @coochy.exe ✩ follow @coochy.exe ✩ follow @coochy.exe ✩ code Coochy on the Fortnite itemshop :exclamation_mark: ✩ follow @coochy.exe ✩ follow @coochy.exe ✩ follow @coochy.exe ✗ ✗ ✗ ✗ ✗ ✗ ✗ ✗ ✗ ✗ ✗ ✗ ✗ ✗ ✗ ✗ ✗ ✗ ✗ ✗ #offensivememes #memes #worldstar #explore #explorepage #dankmemes #funny #funnymemes #funnyvideos #memesdaily #dankmemes #funnyshit #memestagram #offensive #dankmemesdaily #dailymemes #offensivememesmatter #offensive #funnyvideos #funnymemes #dankmemes #dankmemesdaily #dankvideos #dank #dankmeme #edgy #edgymemes #corona #coronavirus #virus #china #death #military
2231666863301945635; 2; False; 1580255793; low tide #olitaAF @mikskimbali getting me kurreck . . . . #bsclips #victoriaskimboards #flaskskimboarding #flaskskimboard #skimboardingpage #annoyingposts #coronavirus #i #have #virus #lowtide #boatwaves #oneinchwaves #braboys4life #baliskimboarding
2231668755319479825; 0; False; 1580255793; #Repost @minsaude (@get_repost) ・・・ Atenção para a prevenção: o #NovoCoronavírus causa doença respiratória grave e a contaminação acontece por contato (de pessoa para pessoa). Assim como para evitar outros vírus desse tipo, existem orientações simples que ajudam a evitar sua transmissão. Ouça o que diz o ministro da Saúde, @henriquemandetta, e confira informações ainda mais completas acessando: saude.gov.br/novo-coronavirus #coronavirus
2231669796403867331; 0; False; 1580255792; Symbolisme (Biohazard) GERM-WARFARE 2020 Designer Virus Detected #coronavirus #pneumonicplague #newyorktimes #worldhealthorganization #cdc #news #plague2020 #eschatology #biowar #eugenics #china #globalepidemic #science #epidemiology #aignerauryyel #agenda21 #agenda2030 #world #currentaffairs #exitthematrix #matrix2020 #aliceinwonderland #wuhan #wuhanchina #beijing #germwarfare
2231669773276425244; 0; False; 1580255789; Symbolisme (Biohazard) GERM-WARFARE 2020 Designer Virus Detected #coronavirus #pneumonicplague #newyorktimes #worldhealthorganization #cdc #news #plague2020 #eschatology #biowar #eugenics #china #globalepidemic #science #epidemiology #aignerauryyel #agenda21 #agenda2030 #world #currentaffairs #exitthematrix #matrix2020 #aliceinwonderland #wuhan #wuhanchina #beijing #germwarfare
2231669742397976595; 0; False; 1580255786; Symbolisme (Biohazard) GERM-WARFARE 2020 Designer Virus Detected #coronavirus #pneumonicplague #newyorktimes #worldhealthorganization #cdc #news #plague2020 #eschatology #biowar #eugenics #china #globalepidemic #science #epidemiology #aignerauryyel #agenda21 #agenda2030 #world #currentaffairs #exitthematrix #matrix2020 #aliceinwonderland #wuhan #wuhanchina #beijing #germwarfare
2231669716634683397; 0; False; 1580255783; Symbolisme (Biohazard) GERM-WARFARE 2020 Designer Virus Detected #coronavirus #pneumonicplague #newyorktimes #worldhealthorganization #cdc #news #plague2020 #eschatology #biowar #eugenics #china #globalepidemic #science #epidemiology #aignerauryyel #agenda21 #agenda2030 #world #currentaffairs #exitthematrix #matrix2020 #aliceinwonderland #wuhan #wuhanchina #beijing #germwarfare
2231669712340037935; 0; False; 1580255782; They should post this at the #Wuhan #China airport #CoronaVirus #MaskOn playa s/o @bustarhymes
2231669672686967008; 4; False; 1580255777; DON’T PANIC!!!! The coronavirus is a bad cold!!!! Like the flu it is dangerous in those with respiratory issues (asthma, copd,) delicate immune systems (diabetes, steroids, cancer treatments,) geriatric patients and babies. The flu is much more prevalent and deadly! Coronavirus has killed 50 people while influenza killed 5,000 in the first 2 weeks of 2020! Influenza killed over 50,000 in 2019 in the US alone! There is no treatment, just supportive care (fever reducers, fluids, cough medicine, etc). There is not an easy or standard test for it. If you haven’t been to wuhan China, you don’t need a test for it if you have a fever and cough. GET A FLU SHOT!!!!! This disease outbreak in the social media era has been defined by panic and uncertainty. An onslaught of sensational disinformation has spread like wildfire on platforms like Facebook and Instagram. Remember SARS, H1N1, swine flu, MERS, Ebola??!!!! Wash your hands frequently; don’t touch your mouth, eyes, or nose; and avoiding sick people — standard advice during flu season. Masks are not necessary for anyone in the US. #stayingAlive #girlERdoc #emergency #AngeliquesOfInsta #girldoctor #health #coronavirus #flu #influenza
2231669651272978312; 0; False; 1580255775; Waspada Virus Corona! Belakangan, topik mengenai kasus virus corona yang mewabah di wilayah Cina sedang merebak di berbagai media. Ini berhasil membuat semua orang yang mengetahuinya merasa khawatir. Tetap tenang, Bun. Virus ini bisa dicegah. :two_hearts: Dan ini sedikit tips untuk meminimalisir penyebaran virus tersebut. Punya tips lain Bun. ? Share di kolom komentar yess :face_blowing_a_kiss: . . #corona#coronavirus #viruscorona #health #mamalyfe #parentalk #rumahtangga #tipsparenting #infoparenting #mendidikanak #mengasuhanak #parentingmodern #parentingislami #komunitasparenting #orangtuacerdas #psikologianak #ceritabunda #menumpasi #mpasi6bulan #mpasihomemade #tumbuhkembanganak #pejuangasi #masyaallahtabarakallah #idebermain #idebermainanak #idebermaindirumah #yukhidupsehat #mers #sars #who
2231669650643929257; 1; False; 1580255775; http://3g.dxy.cn/newh5/view/pneumonia 위 주소대로 치면 실시간 우한코로나 바이러스 감염자 / 사망자 현황 사이트 나옴 미세먼지는 걷혔으나... 여행도 못하는 이 신세..:loudly_crying_face:#우한폐렴 #우한바이러스 #우한폐렴예방 #코로나바이러스 #우한코로나바이러스 #wuhan #wuhanvirus #wuhancoronavirus #coronavirus
2231669645004668190; 0; False; 1580255774; :red_circle::red_circle: Brasil entra na classificação nível 2, chamada PERIGO IMINENTE! :red_circle::red_circle: . Na manhã desta terça (28), o Ministério da Saúde informou que uma mulher, de Minas Gerais, estaria com suspeita de infecção pelo novo coronavírus. Outras catorze pessoas que entraram em contato com a paciente também estariam sob monitoramento. Após o caso, o governo elevou a classificação de risco do Brasil para o nível 2, chamada “perigo iminente”. O maior nível da escala é o 3, que ocorre após a confirmação de que o vírus foi detectado em território nacional. . #dicadesaude #coronavirus #prevenção #drogariaelba #drogaelba
2231669623406099978; 0; False; 1580255772; Maneki Neko Keychain $10 #chinese #china #coronavirus #wuhan #lucky #manekineko
2231669612112846061; 1; False; 1580255770; A small drawing to express my emotions for all these recent events. May we overcome all these obstacles, may no more loved ones get hurt. Wars, viruses, incidents, accidents..may we all cherish the time we have with each other, make each other feel loved and cared:two_hearts: #ballpointpen #ballpointpenart #ballpointpendrawing #artoftheday #artofinstagram #art #illustration #love #peace #coronavirus #war #kobebryant #australiafires #prayers
2231669565960788341; 0; True; 1580255765; #coronavirus#HK#NG#新型コロナウイルス肺炎#香港線
2231669464926369953; 1; False; 1580255753; The 1692 Jamaica earthquake struck Port Royal, Jamaica on 7 June Known as the "storehouse and treasury of the West Indies", and as "one of the wickedest places on Earth", it was, at the time, the unofficial capital of Jamaica, one of the busiest and wealthiest ports in the West Indies, and a common home port for many of the privateers and pirates operating within the Caribbean Sea. The earthquake caused most of the city to sink below sea level. About 2,000 people died as a result of the earthquake and the following tsunami; and, about another 3,000 people died in the days following the earthquakes, due to injuries and disease. #coronavirus #corona #earthquake #jamaicanhistory #jamaica #jamaicansbelike #kartel #jamaicaearthquake #jamaicanmemes #shenyeng #aidonia #braff #popcaan #dancehallmusic #876 #jamaicanmusic #vybzkartel #jadakingdom #manhimself
2231668870779129954; 4; False; 1580255752; In #Wuhan, people are collapsing on streets due to the deadly #WuhanPneumonia so helpless. . #coronavirus #china #wuhanvirus #chinavirus
2231669421122130147; 0; False; 1580255747; so this is my first post . . ., #meme #memes #funny #dankmemes #memesdaily #funnymemes #lol #dank #follow #humor #like #dankmeme #lmao #love #anime #edgymemes #comedy #ol #dailymemes #instagram #offensivememes #fun #wuhan #coronavirus #kobebryant #wuhanchina #coronavirusoutbreak #china #chinamemes #outbreak
2231667693010125032; 0; False; 1580255745; Tag someone who should try this - - - - - - #ww3 #corona #coronavirus #relatable #relatablememes #hahaha #noway #lol #memes #memer #memez #memess #dankmemes #memesdaily #memes:face_with_tears_of_joy: #memesquad
2231669323353997979; 11; False; 1580255736; i used to have a friend who sat on public toilets without any seat cover:nauseated_face: the ghetto
2231669281291139020; 0; False; 1580255731; Underneath that mask is a big smile! This city is amazing :smiling_face_with_3_hearts: minus the coronavirus :confounded_face::crying_face: #beijing #coronavirus #qianmen #maskon #virusoff #china
2231669164782633691; 8; False; 1580255717; Sayin the Coronavirus has mans going like this now:rolling_on_the_floor_laughing::rolling_on_the_floor_laughing::rolling_on_the_floor_laughing: #coronavirus #coronavirusmemes #chinese #mask #markham #running #torontomemes #torontomemes416 #tdot @realtorontonewz @memesforyourheadtop @6ixstar @6ixdriptv @kingofrexdale @keep6ixsolid @straightouttathe6ixtv @torontolingo @6ixtalklittalk
2231669091348216291; 0; False; 1580255708; Hice dos memes, para más placer . . . .sígue a @bartsimpson_ok . . . . #elmaradonaaa #lossimpsonenfox #lossimpsons #lossimpsonsmemes #simpsonedits #simpsonsmemes #simpsons #uruguay #argentina:Argentina: #lossimpsonsarg #memesgamers #memesargentina #memesargentos #lossimpsonsmeme #lossimpsonspringfield #simpsonsmemesarg #china #china:China: #coronavirus #virus #corona #elcositodelapizza #cosmefulanito #bartsimpson
2231669035018816886; 0; False; 1580255701; Esempi vari di #xenofobia associati al #coronavirus
2231669010767398368; 0; False; 1580255699; In questi giorni, in merito alla questione del nuovo Coronavirus, sui social-network italiani si sono scatenate aspre critiche contro il popolo e il governo cinese, alcuni media hanno diffuso notizie inesatte che hanno dirottato l’opinione pubblica. Di questo sono sinceramente rammaricato. In una tale crisi, le persone non dovrebbero mostrar loro compassione? Se questo virus è nemico dei cinesi, allora dovrebbe essere nemico di tutti. I cinesi sono persone di grande spessore: lavoratori instancabili e uomini pacifici. Il fatto che esistano cinesi che mangiano strani animali selvatici o compiono azioni deplorevoli non dà il diritto di insultare l’intera nazione cinese. Forse non tutti sanno che a Wuhan molti operatori sanitari stanno rischiando la loro vita pur di trovare un modo per debellare il virus. Medici provenienti da tutta la Cina stanno accorrendo in quella provincia, così come i soldati per combattere la guerra contro questa epidemia. Smettiamo di sprecare la nostra vita nell’ignoranza. Wuhan ha sbarrato le porte. Il Governo locale e quello nazionale stanno combattendo con tutte le loro forze per garantire la sicurezza del popolo cinese e del mondo intero. Riuscite a immaginare il sacrificio dei cittadini di Wuhan? Riuscite a provare empatia per un popolo che soffre? Perciò vi prego, non umiliateli, dimostrate al popolo cinese umanità e comprensione. Prego inoltre i media di non alterare la realtà, arrivando persino a fabbricare fake-news solo per attirare l’attenzione dei lettori. Vi prego di svolgere il vostro lavoro secondo criteri etici. In Italia vivono 300.000 cinesi, così come decine di migliaia di italiani studiano, lavorano e si sono stabiliti in Cina. In un momento come questo, tutto ciò di cui c’è bisogno è umanità e solidarietà. Se tutto il mondo si unisse in un abbraccio di solidarietà, il nuovo temibile Coronavirus non avrebbe scampo. 中国加油！ #wuhan #china #cina #coronavirus #virus #zhongguo #jiayou #加油 #中国 #中国加油 #beijing #shanghai #chengdu #shenzhen #suzhou #hongkong #xiamen #nanjing #hubei #guangzhou #asia #fuzhou #hangzhou #tianjin #macao #corona #viruscinese #contamineuntitre #jenesuispasunvirus #forzawuhan
2231668964715529612; 0; False; 1580255693; #coronavirus #news #corona #wuhanvirus #wuhancoronavirus #wuhan #virus #coronahelp #coronahelps #coronagermany #coronadeutschland #coronaviren
2231668955579637632; 0; False; 1580255692; Hello Covenant Chapel family, this is a PSA in light of the recent outbreak of the 2019 Novel Coronavirus. Coronaviruses are a group of viruses that cause diseases in mammals and birds. In humans, the virus causes respiratory infections which are typically mild including the common cold but rarer forms like SARS and MERS can be lethal. Authorities in Wuhan discovered a new strain in December 2019 which has led to the deaths of at least 106 people around the world. As there have been 3 confirmed cases in the GTA, we are urging everyone to stay safe and protect themselves. Swipe through the pictures to see how you can reduce the risk of infection. God bless. Source: Centers for Disease Control and Prevention and World Health Organization #coronavirus #outbreak #covenantchapel #toronto
2231668898745529634; 0; False; 1580255685; Setelah melihat Data dan Fakta serta Gejalanya virus Corona . Nih mimin kasih tau juga upaya pencegahan yang bisa kita lakukan :flexed_biceps: . . #coronavirus #virus #corona #manusia #hewan #mers #sars #ekipublishing #edukasikaryaid #penerbitbuku #enterpreneur #writer #penulisbuku #kesehatan #health
2231663571081874098; 3; False; 1580255678; Even though in China we battle a public health emergency in the form of the coronavirus, it is Kobe’s death that dominates online chatter. . . . #blackbusinesswomen #blackbusinessmen #blackentrepreneur #coronavirus #consumergoods #blackamerican #chinainsider #tradeshows #kobeforever #reasonableprices #livinginchina #freightforwarder #chinajiayou #developingchina #economicdevelopment #standwithchina #tradeinservices #tourismservices #cultureandeducation #sustainablejobs
2231668735293771599; 0; False; 1580255666; Um novo vírus que ataca o sistema respiratório e se espalhou a partir da região de Wuhan, na China, preocupa o planeta. Ele pertence à família dos coronavírus, um grupo que reúne desde agentes infecciosos que provocam sintomas de resfriado até outros com manifestações mais graves, como os causadores da Sars (sigla em inglês para Síndrome Respiratória Aguda Grave) e da Mers (Síndrome Respiratória do Oriente Médio). . . Algumas medidas básicas de proteção, que inclusive se aplicam a outros agentes infecciosos transmitidos pelo ar e por gotículas de saliva: . * Evite aglomerações e contato próximo com outras pessoas. * Cubra o nariz e a boca com lenço descartável ao tossir ou espirrar (e descarte o material em local adequado). * Lave as mãos a cada duas horas e principalmente após passar por estabelecimentos ou transportes públicos. * Procure não tocar olhos, nariz e boca Não compartilhe copos, toalhas e objetos de uso pessoal. * Dependendo do local, compre e use máscaras que cobrem boca e nariz. . . #coronavirus #anvisa
2231668718619153390; 1; False; 1580255664; “Researchers say as many as 44,000 people could be infected with the coronavirus in Wuhan, far more than official figures suggest.”⁣ ⁣ From SCMP News (SCMPNews) on Twitter.⁣ ⁣ #news #breakingnews⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣ #worldnews⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣ #coronavirus #wuhanvirus #wuhancoronavirusoutbreak #WuhanCoronavirus⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣ #coronavirusoutbreak #corona #ncov2019 #ncov⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣ #武漢肺炎 #武汉疫情⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣ #China #Wuhan⁣⁣⁣⁣⁣ #StandWithWuhan⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣ #LunarNewYear #NewYear #SpringFestival⁣⁣ ⁣
2231668667222277751; 0; False; 1580255658; Shyt is getting real in China. #coronavirus
2231668667640531882; 1; False; 1580255658; With all the craze about the corona virus how about the Flu shot you refuse to receive......... #CDC #facts #coronavirus #influenza #flu #nurse #nursing #fnp
2231668646718202525; 0; False; 1580255655; Gisell maxy Bahan jersey roberta premium Ld 95-115 Pj 138 Lebar ±4m Busui WA 085743324454 / klik link di bio #gamislemonroberta #gamis #gamisdailywear #viruscorona #coronavirus #gamiscantik #gamiskeren
2231668597949168755; 0; False; 1580255649; Bersesak dengan warga asing!!! Silap2 Nissan Corolla pun ada ni sat g!!! :face_with_tears_of_joy::face_with_tears_of_joy: ==============•••================ MEDICAL CARD PALING BERBALOI DENGAN HANYA DARI RM5 SEHARI. :heavy_check_mark: Medical Card (Room rate RM150/hari) :heavy_check_mark: Elaun wad RM100/hari :heavy_check_mark: Elaun ICU RM200/hari :heavy_check_mark:Full coverage. Tiada lagi bayaran 10% daripada anda. :heavy_check_mark:Limit tahunan hebat sebanyak RM90,000. :heavy_check_mark: Limit seumur hidup RM900,000 :heavy_check_mark: Rawatan pesakit luar akibat kemalangan sehingga RM3,000 :heavy_check_mark:Elaun tunai apabila ditahan di wad kerajaan RM150 sehari. :heavy_check_mark:100% patuh Shari'ah :heavy_check_mark: Pampasan penyakit kritikal :heavy_check_mark: Pampasan kematian disebabkan penyakit @ kemalangan :heavy_check_mark: Pampasan lumpuh disebabkan penyakit @ kemalangan :heavy_check_mark: Caruman PERCUMA jika ibu/bapa lumpuh @ kena pentakit kritikal :heavy_check_mark: Pampasan RM500,000 untuk bawa pulang pesakit atau jenazah dari luar negara :heavy_check_mark: Percuma car assist program. Repair dan towing PERCUMA. Like, Comment, atau Share post ni kepada kenalan anda yang masih mencari-cari pelan yang terbaik . :pushpin:Jumlah caruman RM5 sehari hanya sah untuk lelaki, Umur dari 6-10 tahun. :pushpin:Caruman bulanan sebenar mungkin berbeza untuk individu yang mempunyai latarbelakang selain dari yang dinyatakan. :pushpin:Harga takaful akan naik seiring dengan usia dan risiko anda. =============================== Kalau ingin saya kongsikan maklumat ini dengan anda senang je. Ikut cara di bawah: Click link dibawah :backhand_index_pointing_down_light_skin_tone::backhand_index_pointing_down_light_skin_tone::backhand_index_pointing_down_light_skin_tone: www.wasap.my/601111444516/sayanakmedicalcardmurah www.wasap.my/601111444516/sayanakmedicalcardmurah #wuhanvirus #coronavirus #medicalcardmurah #joinnizamagency #greateasterntakaful
2231668561248905776; 0; False; 1580255645; OMS califica coronavirus de Wuhan como “patógeno de alto riesgo mundial” ⠀ Ginebra, 28 Ene (Notimex).- La Organización Mundial de Salud (OMS) calificó el coronavirus de Wuhan como un “patógeno de alto riesgo mundial”, en medio de la preocupación mundial por la propagación de la enfermedad que ha causado la muerte de 106 personas y más de cuatro 500 infectados en China. ⠀ La OMS elevó de “moderado” a “alto” el nivel de amenaza del letal coronavirus. “Muy alta en China, alta a nivel regional y alta a nivel mundial”, señaló la organización en un comunicado. ⠀ @distritonoticias ⠀ #onu #coronavirus #salud #elmundo
2231668523791453473; 0; False; 1580255640; #coronavirus
2231667376047168731; 2; False; 1580255636; #soloenvenezuela #chavistasdemierda#javierhalamadrid #maduro#guaido #venezolanosenespaña#venezolanosenmadrid#venezolanosenbarcelona #coronavirus #enfermedad #venezolanosenusa #venezolanosenrepublicadominicana #venezolanosenflorida #tictactictactictac #voluntariosporvenezuela #venezolanosenelexilio #venezolanosenelmundo #ayudahumanitariaparavenezuela #aidvenezuela #ayudahumanitaria #venezolanosenmadrid #guaira #margarita #ciudadbolivar #sosvenezuela
2231668449688520119; 0; False; 1580255635; #coronavirus #joker #murray
2231668451608163325; 5; False; 1580255632; :warning:WARNING GRAPHIC IMAGES:warning: Please share this URGENT post about the coronavirus epidemic with your followers as the origin of the virus has been traced to the zone of the Wuhan market where live wild animals like snakes, rats, bats and monkeys were traded before China instituted a temporary ban yesterday. But a temporary ban is NOT enough, WE MUST use our social media platforms to spread awareness and BAN WILD ANIMAL TRADING WORLDWIDE as this is EXACTLY what caused the SARS virus that killed nearly 800 people in 2003! SARS was 17 years ago and yet these markets are doing the exact same thing, selling live wild animals in unhygienic conditions that create diseases with devastating consequences for the entire human race! This new virus, which has no vaccine, has killed 82 people with 2,887 confirmed cases in 15 countries, numbers which have increased 50% SINCE YESTERDAY and 60 million more people are on lockdown to prevent further spreading. To stay updated in real-time our US followers can now text us at 323-310-1679 and also follow @karmagawa on Instagram too. Please pray for the world and share this URGENT post with your followers and tag people, celebrities, influencers and news media that need to see this and let’s work together to PERMANENTLY ban the trading of wild animals that create these deadly viruses! #coronavirus #endanimalcruelty #coronavirusoutbreak #karmagawa
2231668355652588497; 0; False; 1580255620; Showing up with that prep work done.... all the feels! . . . . . . . . . . #fuckyou #stopreadingmyhashtags #dontcopyme #hashtag #memes #2020memes #coronavirus
2231668333573707855; 0; False; 1580255618; Ainda bem! GT: AlefGamer95 #Xbox #XboxMemes #XboxDominador #Umbrella #CoronaVirus
2231668271438916359; 0; False; 1580255616; How does the Coronavirus affect the body? Please read and share this with friends and family. #Coronavirus #affect #thebody #affectedbody #sorethroat #virus #protect #protection #mask #flu #symptoms #hospital #care #treatment #unwell #washyourhands #beclean #stayclean #sneeze #cough #sick #notwell #washing #washup #viruses #helppeople #helpothers
2231668302793447413; 0; False; 1580255614; Te mostramos unos cuantos datos acerca del #CoronaVirus que te serán de gran interés! :face_with_medical_mask: ⠀ Como prevenir el contagio?: ⠀ :red_circle: Lava tus manos periódicamente con agua y jabón o limpialas con gel sanitizante para manos. :red_circle: Trata en lo posible de no tocarte el rostro con las manos, es la manera más fácil para que los gérmenes entren en tu cuerpo. :red_circle: Cocina muy bien tus alimentos. :red_circle: Recuerda cubrir tu nariz al toser con un pañuelo o con la parte interior del codo. :red_circle: No te automediques, siempre es mejor visitar al médico para que te recete la medicina adecuada. :red_circle: Si vas a tener contacto con animales de granja o silvestres usa protección. ⠀ Cuales son los síntomas del Coronavirus? ⠀ :police_car_light: Disnea (Dificultad para respirar) :police_car_light: Fatiga :police_car_light: Fiebre :police_car_light: Dolor de cabeza :police_car_light: Secreción nasal :police_car_light: Tos :police_car_light: Dolor de garganta ⠀ SmartLab te Informó :grinning_face: ⠀ #noalaatumedicacion #salud #medico #salud #smartlab #smartlabteloinformo #quevedo #saludybienestar #losrios
2231668297559957839; 0; False; 1580255613; Impossível . . . . . Tags #vingadores #DC #CW #Disney #sony #homem aranha #spiderman #flash #humor #entretenimento #filme #zueira #marvel #teoria #teoriasinsanas #nerd #geek #instagrambrasil #trocadilho #piadas #haha #risada #piaui #zueirasemlimites #piadasbosta #memes #coronavirus #china #bbb20
2231668263904674998; 0; False; 1580255609; Es importante estar informados, y sobre todo para cuidar nuestra salud. . Es por ello y en base a la alerta epidemiológica por los casos de coronavirus reoortados en China desde diciembre de 2019, debemos observar el avance en las noticias en este tema. . Aquí les dejo información importante para la prevención!!! . Información tomada de organización mundial y panamericana de la salud. . #DraZuleikaCastellanos #coronavirus #oms #paho #otorrinoysalud
2231668000434465296; 0; False; 1580255604; Repost @rt by @media.repost: The best medicine? Song, apparently. As China fights the worsening coronavirus outbreak, residents under quarantine in Wuhan have shared videos online of their battle against cabin fever, showing how they are lifting each other’s – and the nation's – spirits. #Wuhan #China #coronavirus #coronavirusoutbreak
2231667137347795837; 4; False; 1580255591; Reposted from @chididdy026 (@get_regrann) - Reposted from @foundconscious This is just my take on the Corona virus as many of you were asking for my opinion or some content regarding it. I’ve seen the fearful posts especially those portrayed by mainstream media. Let’s not get ahead of ourselves and bury our graves before its time. —— How can one protect themselves? I’m going to list some foods you can research that are believed to increase immune system function: - citrus fruits (lemons, limes, oranges, grapefruits) as vitamin C is essential. - Garlic, ginger, broccoli, turmeric, all carry essential anti-oxidants. Getting your organs and glands functioning properly again is essential. One may achieve this by firstly detoxifying the body - ridding the body of parasites, heavy metals, and toxic waste. This is the first step towards wellness - then one should replenish the body with foods that enhance energy, keep the lymph system moving and the immune system strong - fruits are great. They are your friends. To stay updated with non-biased and non-government/big pharma funded news - subscribe to We Are Change on YouTube - World Alternative Media also. These are people funded media channels. I’m sure there are more so comment below some good recommendations :backhand_index_pointing_down_medium_skin_tone: — My good people, lets stay vigilant, stay informed, stay conscious and give fear the “:middle_finger_medium_skin_tone:” — Follow my personal :backhand_index_pointing_right_medium_skin_tone: @itsazeem Follow my other :backhand_index_pointing_right_medium_skin_tone: @foundverity —— #populationcontrol #staywoke #nwo #population #newworldorder #elite #explorepage #pinealgland #wakeuppeople #truthseeker #thirdeye #wakeupsheeple #anonymous #conscious #secretsocieties #mindcontrol #consciousawareness #politics #selfaware #freedomthinker #illuminati #truthseeker #conscious #awareness #peoplepower #depopulation #conspiracy #wakeup #coronavirus #bigpharma
2231668047882429134; 0; False; 1580255584; Esse derruba fácil :face_with_tears_of_joy: . . . . . #coronavirus #corona #virus #cerveja #memes
2231667992575805216; 0; False; 1580255577; Melbourne, Victoria, Australia. In a major global breakthrough, Australian scientists have developed a lab-grown version of coronavirus. :wavy_dash: Scientists at Melbourne's Peter Doherty Institute for Infection and Immunity will now share it with the World Health Organisation in Europe, which will in turn share it with labs worldwide involved in the race to develop a vaccine. :wavy_dash: The team of scientists grew the virus from a patient who had been infected since Friday. The discovery will enable researchers to develop a test to identify people who might be infected with the virus, even before they show any symptoms. :wavy_dash: The ABC was in the lab the moment scientists discovered they had successfully grown the virus. Mike Catton, the co-deputy director of the Doherty Institute, confirming it with three words: "We got it.” :wavy_dash: Doherty Institute lead scientist Julian Druce said the discovery was a significant development in the global understanding of the virus, and for the response to it. "This will be a game-changer for other labs within Australia," Dr Druce said. :wavy_dash: :camera_with_flash: ABC News: Loretta Florance :wavy_dash: #abcnews #news #breakingnews #newsupdate #australia #coronavirus #breakthrough #science #health #Repost @abcnews_au #vividedu #vivideduktm #educationcounselor #careerguide #visaguide #vividedustudents
2231667832328279858; 0; False; 1580255576; #outbreak #coronavirus over 90,000 people infected in #Wuhan #China #pandemic
2231667968037620726; 0; False; 1580255574; Ainda bem! GT: AlefGamer95 #Xbox #XboxMemes #XboxDominador #Umbrella #CoronaVirus
2231667961882818698; 0; False; 1580255573; Protégete contra el #coronavirus! Más de 200 Nutrientes 150 Antioxidantes 100 Alcaloides Todo en un delicioso producto de consumo diario!
2231667799536676340; 39; False; 1580255554; Procede ?????? Sigam @indiretasdageografia . . . . #coronavirus #carnaval2020 #indiretas_da_geografia #saude #meioambiente #humor
2231667697169618742; 0; False; 1580255542; Reposted from @cattuuu2 So they are admitting they want to develop a vaccine (to a disease the CDC and Bill Gates developed in Wuhan) before the disease naturally dies down so they can get more money. Got it. #justasking #questioneverything #stopdrinkingfluoride #coronavirus - #regrann
2231667622437447671; 0; False; 1580255535; #shein #coronavirus
2231667624753120334; 1; False; 1580255533; We growing quick! I guess the masks are a must! :beer_mug::test_tube: #corona #coronavirus #ronavirus
2231667615716085863; 1; False; 1580255532; This man deserves our endless respect :red_heart: Dr. Liang Wudong, who was treating patients of corona virus in wuhan, china,gets infected while treating patients and become the first doctor to die from the new Coronavirus. :crying_face: A reminder that while everyone else is trying to avoid it, frontline medical staff are risking their lives to cure it and save others. This is undoubtedly the beauty of this profession. :red_heart: #Coronavirus #medicalprofessional RIP #Doctor Via alidental
2231667602295776816; 0; False; 1580255531; #mu #musicmemes #guitarmemes #bandmemes #guitar #acousticguitar #memes #dankmemes #recoverymemes #fortnite #callofduty #callofdutymodernwarfare #modernwarfare #pewdiepie #minecraft #coronavirus #coronavirusmemes
2231667565923308952; 0; False; 1580255526; :grinning_face_with_sweat::smiling_face_with_halo::see-no-evil_monkey: #plagueinc #coronavirus
2231667533994527013; 0; False; 1580255523; Conozca más del Coronavirus, ¿qué es?, sus síntomas, tratamiento y prevención #VTV #Venezuela #Coronavirus #Prevención #China
2231666998911554261; 9; False; 1580255522; 2.7k nice :face_blowing_a_kiss: - - - #meme #memes #memer #hood #memepage #hoodclips #hoodfights #corona #coronavirus #dankmemes #lmfao #lmao #lol #dank #lols #:face_with_tears_of_joy:
2231667494880201181; 0; False; 1580255518; With the coronavirus making its way around the world, it’s never a bad idea to have about a weeks worth or so of food supplies in case something happens and you have to shut yourself inside for a while. Ordered these #xmre meals last week and was not disappointed! They’re lighter than normal military #mre meals and are great for hunkering sown or being on the go! No flame less ration heater tho... :frowning_face::frowning_face: #prepper #veteran #alwaysready #selfsufficient #apocalypse #coronavirus #fluseason #texas #sanantonio #usa #instadaily #followtrain #follow4like
2231667456065106828; 0; False; 1580255513; Cara penggunaan penutup mulut dan hidung dengan betul. Ambil langkah berjaga-jaga dan tingkatkan kebersihan diri bagi menangani Coronavirus (2019-n-CoV). Sumber : KEMENTERIAN KESIHATAN MALAYSIA #coronavirus #2019nCoV #sihatmilikku #walkthetalk
2231667424950759203; 0; False; 1580255509; A friendly reminder of what type of masks you should and should not get for the #CoronaVirusOutbreak !#coronavirus #wuhancoronavirus
2231667402295507392; 9; False; 1580255507; Síguenos para mas contenido :blue_heart: - - - - #memesdaily #elgoth #meme #memesgraciosos #memesenespañol #memesespañol #memes:face_with_tears_of_joy: #memes #goth #siguemeytesigo #gothjaidefinichon #chileanmemes #jaidefinichongoth #china #coronavirus #gatitos #kakarot #dylantero #instagram #instamemes #dylanteromeme
2231665677228178341; 0; True; 1580255505; Bro im ova here crying:loudly_crying_face::pleading_face:i did not expect 2020 to start like this bro.... #sad #explore #explorepage #ripkobe #kobe #2020 #coronavirus #virus #australia
2231667385349675835; 0; False; 1580255505; #coronavirus #virus #wuhanvirus #wuhan https://www.shutterstock.com/image-vector/coronavirus-cov-infographics-elements-human-showing-1624097890
2231666007840084805; 0; False; 1580255491; El brote del #Coronavirus convirtió a la ciudad #china de #Wuhan en un pueblo #fantasma. — La propagación del #virus se ha visto en aumento de manera dramática los últimos días, llegándose a duplicar el número de infectados (confirmados) en 24 horas. — Existen casos confirmados en los siguientes países: 1) #USA :United_States:(5) 2) #Francia :France: (3) 3) #Japón :Japan: (6) 4) #Tailandia :Thailand: (14) 5) #Singapur :Singapore: (7) 6) #Austrália :Australia: (5) 7) #CoreadelSur :South_Korea: (4) 8) #Vietnam :Vietnam: (2) 9) #Canada :Canada: (1) 10) #Alemania :Germany: (1) — La #OMS elevó el estado de alerta a “Elevado”. —
2231667260159091743; 0; False; 1580255490; Vaporising the air with #teatreeoil will disinfect the #air in your home and #promote #health. The #coronavirus has spread to countries including #canada and #australia so practice extra care in your own health habits #healthpromotion #instadaily
2231667108473772992; 0; False; 1580255487; نلقنه #run :person_running::cat_face_with_tears_of_joy::face_with_tears_of_joy: .. #coronavirus #libya #china #disease
2231667206438449152; 0; False; 1580255483; #coronavirus #comedias
2231667200255366081; 1; False; 1580255483; This is how I protect myself from CoronaVirus! #coronavirus
2231667145241061404; 0; False; 1580255476; #coronavirus
2231667142927831950; 1; False; 1580255476; O Ministério da Saúde informa que foi notificado de outros dois casos suspeitos do novo coronavírus no Brasil. Assim, no total, três casos suspeitos da doença são monitorados pelas autoridades de saúde brasileiras. Eles estão localizados em Porto Alegre (RS) e Curitiba (PR), além de Belo Horizonte (MG), noticiado nesta manhã. Confira notícia completa no Portal Saúde. Acesse www.saude.gov.br #NovoCoronavírus #coronavirus
2231667131895005659; 0; False; 1580255475; #coronavirus watercolor - épaves #lakeoswego #LakeOswegoOregon #portland #portlandoregon #portlandnw #Portlandartist #portlandart #portlandor #oregon #oregonnw #oregonian #artist #artistic #artistsoninstagram #artists #artistsofinstagram #painting #paintings #instaart #instaartist #instaartwork #trump
2231667081965943446; 0; False; 1580255469; #ULTIMAHORA• Muertes por coronavirus en China continental llegan a 131: hay 25 muertos más en Hubei. #ExperiencialaCalle #coronavirus
2231667059495092199; 1; False; 1580255466; :pushpin: Este es el avance del #Coronavirus hasta el momento, sigue la cobertura en todas nuestras plataformas digitales para conocer las actualizaciones. . . . . #Coronavirus #China #Virus #Instagood #Instadaily #PicOfTheDay #Salud #Internacional #Mundial #adn40
2231667054526848781; 0; False; 1580255465; #coronavirus #china #chinatown #cny #chinesenewyear #chinesenewyear2020
2231666980522363278; 0; False; 1580255456; Reposted from @newscientist The new 2019-nCoV coronavirus which has infected thousands of people after emerging in Wuhan, China in December has been imaged under an electron microscope for the first time. ⁠ ⁠ The China Novel Coronavirus Investigating and Research Team, a group of scientists from across China working together to find out more about the outbreak, managed to isolate a sample of the virus from an infected patient in Wuhan. ⁠ ⁠ The image shows the coronavirus virion (a virus outside its host cell) and its quite distinctive spikes which give it the appearance of a solar corona, hence the name coronavirus.⁠ ⁠ Image credit: Zhu et al/NEJM :copyright: 2020, Massachusetts Medical Society #Coronavirus #Virion #Virus #Virusoutbreak #2019nCoV #Wuhan - #regrann
2231666884624724360; 0; False; 1580255445; 封關刻不容緩! 當各國撤僑禁口罩出口同封關時，香港跟機仲叫極端手法？:face_with_symbols_on_mouth::face_with_symbols_on_mouth::face_with_symbols_on_mouth: #三罷 #武漢肺炎 #coronavirus #strike #supportmedical #醫護的命也是命
2231666141335827065; 0; False; 1580255437; repost#Wuhan #Çin’den bir hastane daha. ⁣ #coronavirus #corona #wuhan #china #
2231666815225044620; 0; False; 1580255437; The #communist #Chinese government is keeping the official tally of “infected” coronavirus patients artificially low by limiting the supply of diagnostic testing kits, warns an independent journalist in #China, who leaked the information to The Epoch Times. “The outbreak of #Wuhancoronavirus is far bigger than the official figures released by Chinese public health authorities who cover up the severity by limiting the number of diagnosis kits to #Wuhan hospitals,” reports the independent news publisher: The insider and the independent journalist both say that diagnosis kits are only provided to certain “qualifying hospitals” and in very limited quantities. Medical personnel at these hospitals have said that the number of kits they are supplied is less than 10 percent of what they need to test patients. The means the official numbers from the Chinese government are likely just one-tenth the actual numbers. The current government figures claim 4,607 infected patients in mainland China, but if diagnostic testing kits are being artificially limited to just ten percent of the demand, the real number of infected patients may be something closer to 46,000. Interestingly, a team of researchers from #HongKongUniversity recently announced that, according to their research, at least 44,000 infected patients already exist in China. Further, they estimate the number of cases is doubling roughly every seven days. By early May, they predict China will be seeing 150,000 new cases each day, obviously overwhelming every laboratory, hospital and health care clinic in the entire country. China has already ordered schools closed until March, underscoring the urgency of the effort to try to bring this outbreak under control. Meanwhile, human-to-human transmission has already been observed in #Canada, and now #Taiwan is reporting the same thing. The official Chinese government figures have now reached 4,682 infected, a jump of nearly 50% from the day before. This means that even according to the Chinese government, #coronavirus infections exploded nearly 50% in one day: :hand_with_fingers_splayed_medium-dark_skin_tone:More in comments:backhand_index_pointing_down_medium-dark_skin_tone:
2231666786334826535; 0; False; 1580255433; The #communist #Chinese government is keeping the official tally of “infected” coronavirus patients artificially low by limiting the supply of diagnostic testing kits, warns an independent journalist in #China, who leaked the information to The Epoch Times. “The outbreak of #Wuhancoronavirus is far bigger than the official figures released by Chinese public health authorities who cover up the severity by limiting the number of diagnosis kits to #Wuhan hospitals,” reports the independent news publisher: The insider and the independent journalist both say that diagnosis kits are only provided to certain “qualifying hospitals” and in very limited quantities. Medical personnel at these hospitals have said that the number of kits they are supplied is less than 10 percent of what they need to test patients. The means the official numbers from the Chinese government are likely just one-tenth the actual numbers. The current government figures claim 4,607 infected patients in mainland China, but if diagnostic testing kits are being artificially limited to just ten percent of the demand, the real number of infected patients may be something closer to 46,000. Interestingly, a team of researchers from #HongKongUniversity recently announced that, according to their research, at least 44,000 infected patients already exist in China. Further, they estimate the number of cases is doubling roughly every seven days. By early May, they predict China will be seeing 150,000 new cases each day, obviously overwhelming every laboratory, hospital and health care clinic in the entire country. China has already ordered schools closed until March, underscoring the urgency of the effort to try to bring this outbreak under control. Meanwhile, human-to-human transmission has already been observed in #Canada, and now #Taiwan is reporting the same thing. The official Chinese government figures have now reached 4,682 infected, a jump of nearly 50% from the day before. This means that even according to the Chinese government, #coronavirus infections exploded nearly 50% in one day: :hand_with_fingers_splayed_medium-dark_skin_tone:More in comments:backhand_index_pointing_down_medium-dark_skin_tone:
2231666637875227311; 0; False; 1580255431; #beach #newday #family #coronavirus #apocalypse #bestday #tommorowland #martingarrix #arminvanbuuren #madonna #eminem#beyonce #rihanna#enriqueiglesias #selenagomez #romantic#lovestory #music #bestvideo #sexonthebech #life #lifestyle #lifeisgood #love#dance#dancemoms #angel #art #beautiful #dubai@garmiani
2231666106003081342; 2; False; 1580255427; :face_screaming_in_fear::fearful_face::anxious_face_with_sweat::nauseated_face::nauseated_face::nauseated_face::face_vomiting::face_vomiting: #asianfood #shanghai #chine #china:China: #chinese #coronavirus #carnivore #foodporn #asian #labouffe #mangersainement #rat #rats #rat #souris #mouse #chauvesouris #morcegos #bat #muercielago #mange5fruitsetlegumesparjour #autantmangédelamerde #asiatique #restaurationasiatique #Jetefiniàlapisse #mdr #ptdr #mortderire #xptdr . . . . #odog_beef
2231666634737005804; 7; False; 1580255423; Follow @coronavirusplague for more :skull: - - - - - - - Z - - Tags- #memes #dank #bruhmoment #wwz #dankmemes #ww3 #coronavirus #lmao #lol #meme #corona #yolo #china #disease #plagues #rofl #dead #explore #bruh #clown #clownmemes #w #haha #lmfao #memed #original #relatablememes #virus #plague #plaguememe
2231666683157027115; 0; False; 1580255421; Hey @ragnarlothbark , your papa person and this Corona Virus thing... don’t you think we should be more concerned with his Corona addiction?!! - - #corona #thirsty #cat #dog #meow #furbabies #catstagram #dogstagram #coronavirus #barkbarkbark #cousins #pets #dogsofinstagram #instadog #catsofinstagram #instacat #instapets #beergeek #cutepuppy #westcoastboy #petlover #cutekitty #hey #petsofinstagram #doglife #catlife #pethumans #catsanddogs #dogsandcats
2231666538712660370; 1; False; 1580255414; Hay sizin o kuş beyninize, salak bunlar ya. Çin'in yeni silahı korona iç savaşa yol açtı millet birbirine sıkıyor(tükürüyor).:man_facepalming: . Gülermisin ağlarmısın:frowning_face::smirking_face:. . .:backhand_index_pointing_right::thumbs_up:@turkiyebirligi_ :grinning_face_with_sweat: . . #türkiye #receptayyiperdoğan #mhp #akparti #ülkücü #etiket #beğeni #deutschland #keşfet #gurbet #azerbaijan #almanya #usa #europe #coronavirus #kesfet #türk #tekbayrak #tekvatan #europa #ayyıldıztim #virus #china #nachrichten #yeni #göktürk #türkei #haberler #turkey #sondakika
2231666607357102570; 0; False; 1580255414; con el #Coronavirus #whoyougonnacall ?
2231666552074166502; 0; False; 1580255405; #puisi #penulis #sajak #rindu #syair #motivasi #gusdur #caknun #sujiwotejo #soehokgie #tanmalaka #marsinah #munir #tamansarimelawan #aristoteles #socrates #karlmarx #motivasi #senja #coronavirus #jiwasraya #sundaempire #plato #nu #muhammadiyah #jokowi #prabowo #uas #ustadadihidayat #ustadabdulsomadlcma #imlek
2231666349776697940; 0; False; 1580255401; #coronavirus :new_moon_face::eyes:
2231666457997432261; 0; False; 1580255394; :sake::sake::sake:⁣ ⁣ 𝑺𝒐𝒂𝒍𝒂𝒏: 𝑩𝑬𝑻𝑼𝑳𝑲𝑨𝑯 𝑪2𝑱𝑶𝒀 𝑺𝑼𝑺𝑼 𝑨𝑱𝑨𝑰𝑩:question_mark:⁣ ⁣ :red_apple: Kita tak jamin mereka yg consume susu C2joy akan sembuh.. Tetapi, Alhamdulillah setakat ni C2joy telah membantu ramai pesakit.., ⁣ ⁣ :red_apple: Apa yg saya nak tekankan..,⁣ C2joy hanyalah salah satu Ikhtiar dalam mencari kesembuhan.⁣ ⁣ :red_apple: Cuma, daripada kita minum air berkarbonat, air teh tarik, kopi susu dll lagi yg seangkatan denganya. ⁣ ⁣ :red_apple: Bukan sahaja kita perlu keluarkan duit, malahan kesihatan kita terancam.⁣ ⁣ :red_apple: Kenapa tidak kita minum susu C2joy? Minum susu C2joy Badan sihat, cergas & bertenaga. Dan Insya Allah dpt mengelak & menghindar tubuh badan kita di serang penyakit⁣ ⁣ :red_apple: Jom try susu kolostrum C2joy pm tepi Cik. Suzy :face_blowing_a_kiss:⁣ ⁣ #fenomenaC2Joy⁣⁣ #C2Joy⁣⁣ #susukesihatan⁣⁣ #InfuenzaA⁣⁣ #kalsium⁣⁣ #colostrum⁣ #corona⁣ #coronavirus⁣ #coronavirusoutbreak⁣ #diabetes⁣ #kencingmanis⁣ #cancer⁣ #eczema⁣ #resdung⁣ #denguefever⁣ #nochemicals⁣ #nosugar
2231666382919271343; 0; False; 1580255385; #imsicktheygettingofflikethis #corona #coronavirus #quittouchingshit :rolling_on_the_floor_laughing::rolling_on_the_floor_laughing::rolling_on_the_floor_laughing:
2231666032729268315; 0; False; 1580255382; The government is helping us ... But food and water are not enough for us. People are dying! I am dying! #coronavirus #wuhan #WUHAN #panic #wuhancoronavirus
2231666100911609166; 0; False; 1580255377; Temperature checking :police_car_light: . #coronavirus #coronavirusoutbreak #virus #wuhan #wuhanvirus #coronaviruschina #wuhanchina #corona #coronovirus
2231665556365595737; 0; False; 1580255370; Advertencia: Investigadores de Hong Kong advierten que el Coronavirus podría convertirse en una epidemia mundial. Alertan a estar preparados, estiman deben haber unas 44 mil personas infectadas. #coronavirus :film_projector: RT https://t.co/rpyomH7yiI
2231666182591742135; 0; False; 1580255361; Whoops #virus #coronavirus #memes #wuhan #china
2231666170895959290; 0; False; 1580255360; Coronavirus, the facts so far: This is an attempt at rising awareness about what is know about the coronavirus. I have gone through plenty of research, including WHO's oficial data release to try and understand what the fact are. I want to make sure as many people are informed with the truth and are aware of what we know and how it is evolving. I will persue to continue updating my story with newly found data and facts so everyone can stop panicking as much. Share with loved ones so they too get informed. #coronavirus #information #WHO #worldhealthorganization #news #truth #facts #help #data
2231663568399131304; 0; False; 1580255360; repost#Coronavirus yüzünden ağır nöbetler geçiren bir hasta.⁣ .⁣ .⁣ .⁣ .⁣ #corona #vuhan #wuhan #çin #china #virus #wuhancoronavirus
2231666147526600542; 0; False; 1580255357; :cyclone:frfr:cyclone: •⁣ Send this to a friend:cyclone: •⁣ •⁣ #meme #memes #ps4 #wshh #hood #coronavirus #funny #xbox #dankmemes #offensivememes #edgymemes #spicymemes #69 #memepage #gaming #dank #memesdaily #shitpost #dankmeme420 #hiphop #witcher #worldstar #grapejuiceboys #playstation #worldwar3 #sexy #corona #weed #reddit #420
2231666072315077339; 0; False; 1580255355; Some simple steps on how to protect yourself and others from Coronavirus. . . . . #Coronavirus #virus #protect #protection #mask #flu #symptoms #hospital #care #treatment #unwell #washyourhands #beclean #stayclean #sneeze #cough #sick #notwell #washing #washup #viruses #helppeople #helpothers
2231666120734015284; 0; False; 1580255354; https://soundcloud.com/mfmusicstyle/mf-crnavrus-podcast-jan-20 #minimal #breakbeat #electro #raw #dub #coronavirus
2231666100819773277; 6; False; 1580255352; WE GOIN CRAZY HAHA :beer_mug::test_tube: #corona #coronavirus #ronaseason
2231666042676873795; 0; False; 1580255349; ESSA DATA MUITAS VEZES PERFEITA...PODE SER MUITO PERIGOSA DEVIDO AOS MILHARES DE TURISTAS. Tanto os do exterior como os do interior que podem pegar o vírus e levar para cada rincão de nossa nação. Medite. . . . #coronavirus #carnaval#folia#salvador#riodejaneiro #festas#happy#travel#turismo#atencao#doenca#contagio#china#eua#brasilia#bolsonaropresidente #direitaconsciente
2231666035564379456; 2; False; 1580255344; Cancelan vuelos de EEUU a China por el riesgo que representa el Coronavirus.:China: :United_States:. - Debido al brote de coronavirus que se originó en Wuhan, China algunas aerolíneas norteamericanas se ha forzado a cancelar vuelos. - Por su parte el gobierno de EEUU considera restringir los viajes hacia el país asiático y aunque no es una medida que se debe cumplir obligatoriamente aún algunas aerolíneas han regresado el dinero a sus clientes. - United ha cancelado 24 vuelos hacia tres ciudades chinas programados para los primeros días de febrero y Finnair suspendió todos sus servicios a China. - :white_heavy_check_mark:¿Qué medidas se deben tomar para no propagar el virus? Comenta aquí :backhand_index_pointing_down_light_skin_tone::backhand_index_pointing_down_light_skin_tone::backhand_index_pointing_down_light_skin_tone:. - #china #coronavirus #28ene
2231664540712638582; 9; False; 1580255342; From the mouth of Mr. Depopulation himself! ••• See previous two posts regarding Bill Gates’s connection with the current Coronavirus. ••• #kungflu #coronavirus #event201 #thegatesfoundation #billandmelindagatesfoundation #billgates #depopulation #wwg1wga #redpill #wakeup #vaccines
2231664806935878957; 0; False; 1580255340; Virus posteo #memes #momos #malario #mango #corona #coronavirus #china #dankmemes #dank #ofensivo #offensivememes #2020 #dorime #chino #pewdiepie #venezuela #katuzzishitposting
2231665992679827674; 0; False; 1580255339; As the @who & China share information on the novel coronavirus 2019 (2019-nCoV) outbreak & reiterate their commitment to bring it under control, Australian scientists have been looking to understand it :microbe: @abcnews_au reported this morning that Australian scientists at the @dohertyinstitute have become the world's first outside of China to recreate the coronavirus. The discovery will enable scientists to develop a test to identify people who might be infected, even before they show any symptoms. It will also help speed up work towards a vaccine for the disease, which has claimed more than 100 lives in China and infected five Australians :microscope::globe_showing_Asia-Australia: • • • [:camera_with_flash:: @cnn c/o Nicolas Asfouri / AFP via Getty Images] • • • #GlobalHANDS2020 #coronavirus #globalhealth #worldhealth #WHO #worldhealthorganisation #virus #medicalstudents #medicine #news #potd #China #Australia #DohertyInstitute
2231665983806080018; 0; False; 1580255338; #Repost @inbecbrasil • • • • • Nos arredores de Wuhan, na China, a construção de um hospital com mil leitos, para tratar pacientes com coronavírus, se assemelha a uma corrida contra o relógio, com centenas de trabalhadores, dezenas de escavadeiras e seus termômetros para detectar a pneumonia viral. "É preciso trabalhar rápido para combater a epidemia", diz um trabalhador, que prefere não dar seu nome. ⠀ Acesse a notícia completa no link da #bio ou nos #stories.⠀ ⠀⠀ www.inbec.com.br/blog ⠀ #INBEC #PósGraduação #Especialização #Educação #Engenharia #Arquitetura #Blog #Hospital #China #Wuhan #CoronaVirus #ConstruçãoCivil #obrasdeengenharia #grandesobras
2231665942616688626; 0; False; 1580255333; What was a very busy street now looks like almost a ghost town .... Coronavirus happened :woman_facepalming_medium-light_skin_tone::confounded_face: #beijing #coronavirus #qianmen #qianmenstreet #whathappened #virus
2231665935363030706; 1; False; 1580255332; Preocupante :double_exclamation_mark::double_exclamation_mark: Casos de Coronavírus chegam a 131 mortos e 5,500 infectados! E tem rumores de que esse numero seja bem maior! Principais sintomas da doença são toses, febres extremamente altas e problemas respiratórios. #coronavirus #doenca #doencarara #china #triste #noticias #brasil #riodejaneiro #minasgerais #saopaulo
2231665887975172869; 0; False; 1580255326; Like :heavy_check_mark: Halal Share :heavy_check_mark: Virus corona? Jangan khawatir Ini lah doanya agar terhindar dari penyakit menular :slightly_smiling_face: . Follow@kalam.aladdin7 #instalike #likephoto #liketolike #likeitup #instaliker #likeforcomment #corona #penyakit #coronavirus #sehat #donaldtrump #doa #katahatimuslimah #anak #anakhits #anaksholehsholeha #hijrahku #hijrahsantun #anakindonesiahebat #anakindonesiapintar #jokowi #kobebryant #nba #america #cinta #love #loveyou #loveyourself #lover #lovequotes
2231665878083377030; 0; False; 1580255325; First day of school! Not a good vibe here in Hurstville... God please protect us :folded_hands_light_skin_tone: #coronavirus
2231665524178082867; 0; False; 1580255323; Repost by @reposta.app_ ——— . . Repost @santrine_bu_nyai • • • • • • ENTAHLAH BERITA MANA YANG BENAR.... BERITA YG RESMI DR PEMERINTAH CHINA ATAUKAH BERITA DARI ORANG2 YG TERISOLASI DI SANA. LEBIH BAIK KITA WASPADA TERHADAP EPIDEMI VIRUS CORONA. #epidemi #wuhancoronavirus #wuhanpneumonia #viruskorona #koronavirus #virus #coronavirus #coronaviruses #penyakit #wabah #who #karantina #jangansombong #wuhanchina #tiongkok #china #wuhanvirus #wuhan #prayforuyghur #prayforuyghurmuslims #saveuyghur #saveuyghurmuslims #nasehat #ambilhikmah #ambilhikmahnya #tadabbur #tadabburalam #tadabburayat
2231665842853487440; 0; False; 1580255321; قالت وزارة الخارجية الأسترالية إن أربعمائة أسترالي طلبوا الإجلاء من منطقة الحجر الصحي في الصين، والتي تم منع الدخول والخروج منها بسبب انتشار فيروس كورونا القاتل بها. وأدلى وزير الصحة غريغ هانت بتصريحات للصحفيين في ملبورن قال فيها إن أستراليا أحرزت "تقدمًا كبيرًا" في إيجاد طريقة لعودة الأستراليين العالقين في الصين لوطنهم. تعرف على المزيد من التفاصيل على موقع أس بي أس عربي 24. #australia #photography #photooftheday #sydney #melbourne #aussie #seeaustralia #australiagram #australia #china #virus #coronavirus #صباح_الخير #العراق #السعودية #ليبيا #تونس #مصر #السودان #سوريا #المغرب #أستراليا #سيدني
2231665405326575362; 3; False; 1580255269; The world is gripped by a new coronavirus that started in China and has since moved into nearly 15 other countries, including the United States. The coronavirus outbreak has killed at least 100 people and infected more than 4,600. The outbreak's timing is especially worrisome, since hundreds of millions of people travel to and within China for the Lunar New Year celebration. Therefore, we advise travelers to steer clear of heavily impacted areas and practice enhanced precautions by avoiding contact with sick people, animals and animal markets and frequently and thoroughly washing hands.
2231654422751293374; 2; False; 1580253959; Link to the Petition: http://chng.it/R4q4YGwz
2231512472087250327; 1; False; 1580237038; Cuantas vidas... y mandatarios a nivel mundial llenando sus bolsillos...no deben existir las fronteras. #coronavirus #virus #coronavirusoutbreak #wuhan #wuhanchina #corona #viruscorona #epidemia
2231398206301521010; 0; False; 1580223425; Zu viel vodka . . . . . . . #vodka #memes #haha #witzig #keller #likeforlikes #russia#illness #china #blackhumor #haha #witzig #alman #memes #keller #likeforlikes #likeforfollow #wuhan #virus #corona #coronavirus #deutschrap #tiktokmemes #tiktokgirls #tiktok #alman #almanmemes #capitalbra #nimo #mero428 #kmn
2231392968740651344; 3; False; 1580222800; Kita just post one video jer for tonight sbb video nih I rasa paling cutee!!!!:smiling_face_with_heart-eyes::smiling_face_with_heart-eyes::smiling_face_with_heart-eyes: . . Meletop setiap hari selasa, 9.00 malam, Astro RIA dan RIA HD . . . #MiraFilzah:red_heart:#Meletop #nabilahmad #cute #astroria #astro #goodnight:sparkles: #sweetdreams #jujurlahnikahiaku #tolongsempurnakanceritamami #coronavirus #sakit
2230856130712739743; 0; False; 1580158796; Ben insanları hak ettiği yerde bırakırım. Yarı yolda değil. • • • #lifestyle #liketime #live #likesforlike #like4follow #likelike #beğeni #begenkazan #beğenin #begen #cool #adidas #nike #puma #followforfollowback #follow4followback #istanbul #asian #acunilicali #coronavirus #türkiye
2230770296863498449; 0; False; 1580148579; Warum halt der sich nicht einfach bedeckt . . . . . . #deutschrap #samra #cringe #kind #dumm #haha #funny #funnyvideos #followforfollowback #likeforlikes#illness #china #blackhumor #haha #witzig #alman #memes #keller #likeforlikes #likeforfollow #wuhan #virus #corona #coronavirus #deutschrap #tiktokmemes #tiktokgirls #tiktok #alman #almanmemes #capitalbra #nimo #mero428 #kmn
2230768680311617083; 0; False; 1580148385; .................. . . . . . . . #funny #funnyvideos #followforfollowback #likeforlikes #haha #cringe #memes #tiktokmemes #tiktokgirls ##illness #china #blackhumor #haha #witzig #alman #memes #keller #likeforlikes #likeforfollow #wuhan #virus #corona #coronavirus #deutschrap #tiktokmemes #tiktokgirls #tiktok #alman #almanmemes #capitalbra #nimo #mero428 #kmn
2230767661682821166; 1; False; 1580148258; Lass ihn doch ruhig zocken . . . . . . . #haha #followforfollowback #likeforlikes #funnyvideos #funny #memes #haha#illness #china #blackhumor #haha #witzig #alman #memes #keller #likeforlikes #likeforfollow #wuhan #virus #corona #coronavirus #deutschrap #tiktokmemes #tiktokgirls #tiktok #alman #almanmemes #capitalbra #nimo #mero428 #kmn
2230766274257468981; 0; False; 1580148100; Zingel app . . . . . #single #tiktok #tiktokmemes #haha #witzig #winter #funnyvideos #funn#illness #china #blackhumor #haha #witzig #alman #memes #keller #likeforlikes #likeforfollow #wuhan #virus #corona #coronavirus #deutschrap #tiktokmemes #tiktokgirls #tiktok #alman #almanmemes #capitalbra #nimo #mero428 #kmn
2230764765398651631; 0; False; 1580147914; Cringe . . . . . . #cringe #haha #funnyvideos #memes #witzig #winter#illness #china #blackhumor #haha #witzig #alman #memes #keller #likeforlikes #likeforfollow #wuhan #virus #corona #coronavirus #deutschrap #tiktokmemes #tiktokgirls #tiktok #alman #almanmemes #capitalbra #nimo #mero428 #kmn
2230716887409915495; 0; False; 1580142210; Ach @loredana . . . . . . . #deutschrap #hässlich #schmincke #loredana #mozzik #moiga #cringe#illness #china #blackhumor #haha #witzig #alman #memes #keller #likeforlikes #likeforfollow #wuhan #virus #corona #coronavirus #deutschrap #tiktokmemes #tiktokgirls #tiktok #alman #almanmemes #capitalbra #nimo #mero428 #kmn
2230715120869760180; 0; False; 1580141995; Avatar . . . . . . #avatarthelastairbender #avatar #luft #haha #memes#illness #china #blackhumor #haha #witzig #alman #memes #keller #likeforlikes #likeforfollow #wuhan #virus #corona #coronavirus #deutschrap #tiktokmemes #tiktokgirls #tiktok #alman #almanmemes #capitalbra #nimo #mero428 #kmn
2230714601740890724; 0; False; 1580141956; ....... . . . . . . . #haha #witzig #alman #memes #unterstellung #almanmemes#illness #china #blackhumor #haha #witzig #alman #memes #keller #likeforlikes #likeforfollow #wuhan #virus #corona #coronavirus #deutschrap #tiktokmemes #tiktokgirls #tiktok #alman #almanmemes #capitalbra #nimo #mero428 #kmn
2230713897215324340; 0; False; 1580141848; ....... . . . . . . . #funnyvideos #haha #memes #illness #china #blackhumor #haha #witzig #alman #memes #keller #likeforlikes #likeforfollow #wuhan #virus #corona #coronavirus #deutschrap #tiktokmemes #tiktokgirls #tiktok #alman #almanmemes #capitalbra #nimo #mero428 #kmn
2230704709811926373; 0; False; 1580140745; :megaphone: Arrivage :double_exclamation_mark:Boîte de 100 #masques d'hygiène #jetable en papier filtrant #protection #pollution #maladie #ecommerce #livraisonadomicile #clickandcollect #paschere #distribution #coronavirus
1903870207066076079; 2; False; 1541179348; "Tire essa culpa de dentro de você " #seumoleque. #moro #bolsonaro.... #sergiomoro #paciencia #bolsonaro2018 #fake #ministériodaesplanada #brasilia #equipe #bolsonaroescolhemiistros #chapolincolorado #tapanacara @wagnermourafc @wagnermouraoficial1 #bofedeelite #culpa #work #coronavirus
2231665826661227665; 2; False; 1580255319; First it was WW3 and now another Virus. Last decade it was Ebola. If you aren't catching on that the Media is nothing but a fear monger than idk what else to tell you. Thanks for sending me this @thisisthetime :hundred_points: #currentevents #coronavirus #mainstreammedia
2231665825077750443; 0; False; 1580255319; #coronavirus#histoire sans parole
2231665828883889451; 0; False; 1580255319; *tanya-tanya boleh wa 081320574107 Sprei set TENCEL / SUTRA ORGANIK Ukuran 100 x 200 x 30 Rp 520.000 Ukuran 120 x 200 x 30 Rp 540.000 Ukuran 160 x 200 x 30 Rp 620.000 Ukuran 180 x 200 x 30 Rp 640.000 Ukuran 200 x 200 x 30 Rp 660.000 . . . Sprei + Bedcover TENCEL Ukuran 100 x 200 x 30 Rp 1.120.000 Ukuran 120 x 200 x 30 Rp 1.140.000 Ukuran 160 x 200 x 30 Rp 1.320.000 Ukuran 180 x 200 x 30 Rp 1.350.000 Ukuran 200 x 200 x 30 Rp 1.370.000 . . . Bedcovernya saja Bedcover Single rp. 690 ribu Bedcover Double rp. 820 ribu . . penambahan lainnya: Penambahan tinggi per 10 cm dikenakan biaya 70 ribu Penambahan 2 sarban/2 sargul/1 sarban+1sargul/1 SBC = rp. 120 ribu Penambahan 2 bantal kuping rp. 160 ribu #Spreitencel #tencel #spreisutraorganik #spreielegant #spreicipadu #spreitangerang #kingkoiltencel #spreitencelmurah #spreitencelcantik #spreitencelmotif #spreitencelpolos #homedecor #kadopengantin #kadovalentine #seserahan #coronavirus #sundaempire #uyghur
2231665804943301672; 0; False; 1580255316; Il CoronaVirus sembra non conoscere ostacoli. Sbarca in Europa. Germania :Germany: #coronavirus #germany:Germany: #virus #emergenzaglobale :microbe::globe_showing_Europe-Africa:
2231665804441291093; 0; False; 1580255316; Apple – Apple stock rose 2.5% after it reported strong fourth-quarter results that beat analysts' estimates on the top and bottom line. The results were powered by iPhone revenue and Apple's service businesses like Apple TV+ and iCloud. The company reported earnings of $4.99 per share on revenue of $91.82 billion, while analysts expected earnings of $4.55 per share on revenue of $88.50 billion, according to Refinitiv. #Apple #aapl #earningsweek #china #coronavirus #america #mrna #google #amazon #netflix #lifestyle #keepgoing #bear #bull
2231664989337603662; 2; False; 1580255310; forgot what it’s like to post :pouting_face: . . . #dankmemes #deepfriedmemes #autisticmemes #wholesomememes #offensivememes #offensivememesdaily #llj #gekyume #ynwmelly #coronavirus #sadniggahours #cursedimage
2231665744997782321; 0; False; 1580255309; #coronavirus #15andfairness #onpoli . . . . . . . [Id: a tweet that says: Ontario Conservative government: “If you are sick stay home” Same government: “we are reducing amount of legal sick days, cutting paid sick leave, and repealing rule prohibiting employers from requiring doctor’s notes whenever employee takes a sick day”]
2231665745653471720; 0; False; 1580255309; Brb going to subtweet my girlfriend’s child’s father and ask if it’s allowed stay up past 9⁣ ⁣ ⁣ ⁣ ⁣ ⁣ ⁣ ⁣ ⁣ ⁣ ⁣ ⁣ ⁣ ⁣ ⁣ ⁣ ⁣ ⁣ ⁣ ⁣ ⁣ #funnymemes #cancerousmemes #wholesomememes #surrealmemes #cringememes #cursedimage #funnyedits #shitposts #deepfriedmemes #surreal #wholesomememe #dankmemes #darkmemes #smashultimate #ww3 #aliens #nicememe #nicememes #spicymemes #memes:face_with_tears_of_joy: #tumblr #comedy #trending #frontpage #explore #meme #memes #coronavirus ⁣ ⁣
2231665698122372390; 1; False; 1580255304; The flight is evacuating US Citizens from Wuhan. #WuhanOutbreak #coronavirus #evacuation
2231665687930580793; 0; False; 1580255302; Maraknya virus Corona membuat kita harus lebih berhati-hati dalam menerima informasi yang didapatkan, yuk simak berita mengenai virus corona @herminahospitals ___________________________________________________________ Call center : 1500 488 Moblie Apps : PT Medikaloka Hermina Tbk (tersedia ios dan Android) www.herminahospitals.com ___________________________________________________________ #herminahospitalgroup #herminalebihdekat #rsherminakemayoran #coronavirus
2231665654143287790; 0; False; 1580255298; #coronavirus #corona #voronao #viral
2231665457504012335; 0; False; 1580255285; Ach du scheise. . . . . . . . . . #illness #china #blackhumor #haha #witzig #alman #memes #keller #likeforlikes #likeforfollow #wuhan #virus #corona #coronavirus #deutschrap #tiktokmemes #tiktokgirls #tiktok #alman #almanmemes #capitalbra #nimo #mero428 #kmn
2231665524665216909; 8; False; 1580255283; this some bullshit
2231665421306579070; 0; False; 1580255271; *tanya-tanya boleh wa 081320574107 Sprei set TENCEL / SUTRA ORGANIK Ukuran 100 x 200 x 30 Rp 520.000 Ukuran 120 x 200 x 30 Rp 540.000 Ukuran 160 x 200 x 30 Rp 620.000 Ukuran 180 x 200 x 30 Rp 640.000 Ukuran 200 x 200 x 30 Rp 660.000 . . . Sprei + Bedcover TENCEL Ukuran 100 x 200 x 30 Rp 1.120.000 Ukuran 120 x 200 x 30 Rp 1.140.000 Ukuran 160 x 200 x 30 Rp 1.320.000 Ukuran 180 x 200 x 30 Rp 1.350.000 Ukuran 200 x 200 x 30 Rp 1.370.000 . . . Bedcovernya saja Bedcover Single rp. 690 ribu Bedcover Double rp. 820 ribu . . penambahan lainnya: Penambahan tinggi per 10 cm dikenakan biaya 70 ribu Penambahan 2 sarban/2 sargul/1 sarban+1sargul/1 SBC = rp. 120 ribu Penambahan 2 bantal kuping rp. 160 ribu #Spreitencel #tencel #spreisutraorganik #spreielegant #spreicipadu #spreitangerang #kingkoiltencel #spreitencelmurah #spreitencelcantik #spreitencelmotif #spreitencelpolos #homedecor #kadopengantin #kadovalentine #seserahan #spreitencelmotifkucing #coronavirus #sundaempire #uyghur
2231665361867281287; 0; False; 1580255264; How to protect yourself and others ! :microbe: #coronavirus
2231665348729119279; 0; False; 1580255262; Parece que o jogo virou, não é mesmo? #correios #privatiza #coronavirus
2231607685665309808; 1; False; 1580255257; Cerrahi Zımba Dikiş(Surcigal Staples) Çıkarma:right_arrow::right_arrow::right_arrow_curving_down: . . BEĞEN:heavy_check_mark:YORUM YAP:heavy_check_mark:TAKİP ET:heavy_check_mark: . . #staples #cerrahi #anestezist #surgery #vaka #hastane #doktor #hemşire #aciltıpteknisyeni #112aci̇l #fizyoterapist #diyetisyen #tıbbisekreter #sağlıkyönetimi #tıpdünyası #tıpfakültesi #tus #eğitim #nurse #paramedik #doctor #medstudent #healtymanagement #mizah #medicine #video #mucizedoktor #coronavirus #instagood #followme
2231665294607102497; 2; False; 1580255256; Coronavirus attack :sneezing_face: #c4d #cinema4d #cgi #vray #vrayrender #mograph #model #modeling #graphic #graphicdesign #illustration #render #digitalart #3dmodel #character #characterdesign #artoy #artconcept #coronavirus
2231663636699458024; 2; False; 1580255255; Allez vous abonnez à son compte il fait vraiment des vidéo drôle @deede_video ! Comment avoir une place assise dans les lieux publics (technique infaillible) v2 corona virus #frenchhumour #marrant #drole #fourire #delire #videodrole #blague #rigoler #sourire #mdr #humour #commente #aime #delire #ptdr #paris #metro #coronavirus #ebola #maladie #chine
2231665224830530111; 0; False; 1580255247; The Buddha advocated the importance of looking after the sick and often set an example by himself by taking care of those who were so ill that they were repulsive to others. It is easy to find people who are angry, selfish, hatred and in fear but harder to find people who have compassion and kindness. Someone who has compassion, kindness, turning from wicked to good, living a noble life etc, will be respected by everyone and even the gods. This post dedicted to the brave people who put their life at risk but still fought for the benefit of others due to compassion. Adpated from : kucchivikara-vatthu: the monk with dysentery Metta sutta #coronavirus #outbreak #vaccine #brave #doctorslife #nursesofinstagram #catsick #chronicillness #disease #spiritualawareness #awareness #animalabuse #mettameditation #animalactivist #武汉肺炎 #doctortobe #tributetothetroops #respect #武汉加油 #compassionforanimals #epidemic #infection #salutetoservice #doctorsday #frontlinedoctors #wuhanvirus #coronavirusoutbreak #medicalteam #firefighterheros #infectiousdisease
2231665189706818265; 1; False; 1580255246; Follow @coronavirusplague for more :skull: - - - - - - - Z - - Tags- #memes #dank #bruhmoment #wwz #dankmemes #ww3 #coronavirus #lmao #lol #meme #corona #yolo #china #disease #plagues #rofl #dead #explore #bruh #clown #clownmemes #w #haha #lmfao #memed #original #relatablememes #virus #plague #plaguememe
2231665192717689267; 0; False; 1580255243; Follow @bananasmamas2k - - - #corona #coronavirus #kungfupanda #mytimehascome #minecraftmemes #filthyfrank #cancerousmemes
2231665182139047125; 0; False; 1580255242; *tanya-tanya boleh wa 081320574107 Sprei set TENCEL / SUTRA ORGANIK Ukuran 100 x 200 x 30 Rp 520.000 Ukuran 120 x 200 x 30 Rp 540.000 Ukuran 160 x 200 x 30 Rp 620.000 Ukuran 180 x 200 x 30 Rp 640.000 Ukuran 200 x 200 x 30 Rp 660.000 . . . Sprei + Bedcover TENCEL Ukuran 100 x 200 x 30 Rp 1.120.000 Ukuran 120 x 200 x 30 Rp 1.140.000 Ukuran 160 x 200 x 30 Rp 1.320.000 Ukuran 180 x 200 x 30 Rp 1.350.000 Ukuran 200 x 200 x 30 Rp 1.370.000 . . . Bedcovernya saja Bedcover Single rp. 690 ribu Bedcover Double rp. 820 ribu . . penambahan lainnya: Penambahan tinggi per 10 cm dikenakan biaya 70 ribu Penambahan 2 sarban/2 sargul/1 sarban+1sargul/1 SBC = rp. 120 ribu Penambahan 2 bantal kuping rp. 160 ribu #Spreitencel #tencel #spreisutraorganik #spreicipadu #spreitangerang #kingkoiltencel #spreitencelmurah #spreitencelmotif #spreitencelpolos #homedecor #kadopengantin #kadovalentine #seserahan #spreitencelmotifkucing #coronavirus #sundaempire #uyghur #spreikatunjepang #duvetcover
2231665176730448055; 0; False; 1580255241; Poor kid :skull_and_crossbones: #virus #coronavirus #memes #wuhan
2231665141129586731; 1; False; 1580255237; O gráfico apresentado mostra o Índice Global do Morgan Stanley Capital International e sua reação após epidemiais ao longo dos anos. ⠀ Na tabela podemos conferir exatamente qual foi o desempenho das bolsas internacionais, representada pelo índice, com o passar de 1, 3 e 6 meses das epidemias. ⠀ Esse infográfico bem elaborado foi feito pelo Jeffrey Kleintop, estrategista-chefe da Charles Schwab. A publicação vem logo no período que o mercado está em alerta com o surto de coronavírus.
2231665103068046416; 0; False; 1580255233; #tomatumomo #coronavirus #epidemia #memeenespañol #memes
2231665087727105517; 2; False; 1580255231; Ne diyorsunuz ben de düşünmüştüm bunu garip geliyor açıkçası sizce? . . . . . #turkey #türkiye #corona #korona #virüs #coronavirüs #sondakika #istanbul #bursa #izmir #ankara #hasta #hastalık #virus #coronavirus #haber #haberler #sondakikahaberler #çin #china #wuhan #güncel #güncelhaber #güncelhaberler #coronaviruses #coronaviruese #new #news #sondakikahaberleri
2231665079974112731; 0; False; 1580255230; Informations à prendre en compte. Pas de panique. Suivez le fil d’actualité concernant ce virus. Comme indiquer, seules les personnes ayant les symptômes sont tenus de porter des masques. :relieved_face::face_with_medical_mask: #coronavirus #pharmaciedemilenis #masque #alerte #infos #pasdepanique #misengarde #recommandations
2231664983078125473; 11; False; 1580255218; I’m the whole damn cake and the cherry on top:cherries::kiss_mark: • • • • • #art #artistcouture #makeuplife #makeupartist #makeupoftheday #bayarea #gayboy #gaylife #sfmua #single #bayareamakeupartist #badbitch #coronavirus #eyelook #fashion #lifequotes #life
2231664844977626744; 0; False; 1580255202; Paano maiiwasan ang pagkalat ng CORONA VIRUS? Maiiwasan po ito lalong higit kapag malakas ang panlaban mo sa anumang sakit o ang immune system. Uminom lang ng FIRST VITA PLUS DALANDAN with Five power herbs na mayaman sa vitamins,minerals, phytochemical,anti-oxidant, micronutrients at fiber na kailangan ng ating katawan sa araw- araw para makatulong ma boost ang iyong immune system para malabanan at makaiwas sa anumang sakit:thumbs_up: PREVENTION IS BETTER THAN CURE:revolving_hearts: #coronavirus
2231664840934858309; 2; False; 1580255201; Always wear protection... and a gas mask #coronavirus
2231664814871391594; 4; False; 1580255198; Yo tambien me queria subir al mame del coronavirus. Sigueme en @drawstaka para mas contenido. . #meme #memesespañol #memes #memesenespañol #dibujo #dibujos #dibujodigital #ilustracion #ilustrador #tiracomica #viñeta #viñetas #caricatura #caricaturas #historieta #historietas #pelaeldiente #momentos_ilustrados #comicespañol #webcomic #gracioso #chistes #comicenespañol #humor #coronavirus #coronavirusmemes #humorgrafico #latinoamerica #colombia #argentina
2231662770030277310; 2; False; 1580255192; @chocleboy :collision::bomb:
2231664713477170925; 0; False; 1580255186; :red_triangle_pointed_up:ALERTA:red_triangle_pointed_up: O ministro da saúde fez o pronunciamento hoje e admitiu que o risco de ocorrer um surto de coronavirus no Brasil aumentou. Alguns especialistas são mais pessimistas e afirmam que isso é quase uma certeza. Vocês vão me pedir: E daí? E daí, que realizamos buscas, leituras e orientações em diferentes grupos que cuida da saúde integral e todos são unânimes em afirmar que devemos aumentar a imunidade do nosso metabolismo. Como? Doses significativas de :white_heavy_check_mark:ForeverC (vitamina c) ( 5 a 6 pastilhas por dia) :white_heavy_check_mark:Garlic Thime (antibiótico natural de alho) :white_heavy_check_mark:Aloe Bits(suco de aloe vera + pêssego chinês)pulmão. :white_heavy_check_mark:Sol (vitamina D) :white_heavy_check_mark:Vforce (vitamina complexo B) ☞PREVINA-SE☜ Entre em contato: Distribuidora Independente Forever Living FLP: 550001967133 Cristina Pereverzieff Bueno Santa Rosa-RS Fone/whatsapp: (55)98112 4375 @foreverlivingproductscruzeirosantarosa #comprecomigo Ou quer comprar direto com desconto? Quer ser consultor Forever Living? #falecomigo #prevencao #coronavirus #aloevera #vitaminac #alho #antibiotico #saude #prevencao #complexob
2231664623208498708; 2; False; 1580255175; Maaari nang makipag-ugnayan sa konsulado ng Pilipinas sa Shanghai ang mga Pilipino sa Hubei province na nais umuwi ng Pilipinas. Ito ay sa gitna ng pagkalat sa China ng 2019-novel #coronavirus. Narito ang buong detalye: http://bit.ly/30ZspeP
2231662692175769608; 13; False; 1580255168; #soloenvenezuela #chavistasdemierda#javierhalamadrid #maduro#guaido #venezolanosenespaña#venezolanosenmadrid#venezolanosenbarcelona #coronavirus #enfermedad
2231664450400770472; 0; False; 1580255155; The new death toll rises to 106 deaths when yesterday it was 81. Cases have increased 4,515 from 2,835 in a span of one night. Fortunately, no deaths have been reported outside China. The good news is that China agreed for international assistance for the virus, so now other countries can work together to find a cure. #coronavirus #corona #china
2231664442014580622; 0; False; 1580255154; O mais importante é obter informação correta. Se tiver dúvida, busque seu médico de confiança! Trata-se de uma doença viral. Controle muito difícil nessa era de globalização. Vôos de um continente para outro num intervalo de horas. Avaliação precoce e cuidados básicos. :round_pushpin:Febre, Tosse, Falta de ar; :round_pushpin:Os cuidados são os mesmos para evitar resfriado ou gripe: * Lavar as mãos; * Álcool gel; * Evitar locais fechados e mal ventilados * Evitar contato com pessoas com esses sintomas e que tenham estado na China nos últimos 14 dias, com esses sintomas #drmárcioferraz #espaçosaúdegranjardim #urologistanagranjaviana #urologianagranjaviana #granjardim #coronavirus
2231664411932066335; 0; False; 1580255150; Sí mon límon #coronavirus #weallgonnadie #comics #illustration #lowbrow #sketchbook #art #drawing #dibujo #lowbrowart #comicpanel
2231664407133650916; 0; False; 1580255150; #Repost @inbecbrasil • • • • • Nos arredores de Wuhan, na China, a construção de um hospital com mil leitos, para tratar pacientes com coronavírus, se assemelha a uma corrida contra o relógio, com centenas de trabalhadores, dezenas de escavadeiras e seus termômetros para detectar a pneumonia viral. "É preciso trabalhar rápido para combater a epidemia", diz um trabalhador, que prefere não dar seu nome. ⠀ Acesse a notícia completa no link da #bio ou nos #stories.⠀ ⠀⠀ www.inbec.com.br/blog ⠀ #INBEC #PósGraduação #Especialização #Educação #Engenharia #Arquitetura #Blog #Hospital #China #Wuhan #CoronaVirus
2231664404114885355; 0; False; 1580255149; #quote #meme #fun #instagram #dankmemes #memesdaily #memed #memer #memestagram #memed #stolenmemes #memesespañol #offensivememes #memesrlife #funnymemes #memelife #anxiety #overthinkingquotes #coronavirus #ww3 #cobe
2231664348975492634; 2; False; 1580255143; Aumentan a 106 los muertos y 4.275 casos confirmados por coronavirus en China. La información completa en www.noticiassin.com #NoticiasSIN #SIN #SINDigital #SIN24Horas #Coronavirus #China
2231664312561124298; 22; False; 1580255138; Nós que somos fãs de Resident Evil sabemos que erraram ali no nome "Racoon" pensando que não iríamos descobrir.. MAS TUDO É MUITO CLARO! ESTAMOS EM PERIGO! ESTÁ TUDO CONECTADO HAHA! Pessoal como sempre muito criativo nos memes, este é do pessoal do @geek_culture :face_with_tears_of_joy::face_with_tears_of_joy: :collision:Sigam: @evilhazardbr Parceria: :collision:@gamesmilgrau_ :collision:@games_bit :collision:@4kgame :collision:@videos_de_jogos :collision:@apexdazoeira :collision:@prou96xbox :collision:@academiadosgamersoficial :collision:@devgameroficial :collision:@colossogamingtavern :collision:@loading_time . :collision:@w.paulo_gamer :collision:@erickmoretti #capcom #residentevil #survivalhorror #biohazard #oldschool #gamer #games #gamers #umbrella #coronavirus #corona #playstation #sony #jogos #videogame #game #picoftheday #photooftheday #evilhazard #umbrellacorporation #memesbrasileiros #memesbr #memes:face_with_tears_of_joy: #virus
2231662448796491311; 2; False; 1580255131; People are not just barricading themselves inside #Wuhan, they are also trying to escape the quarantine zone, in this video they are repelled by police. . How many have made it out? . #coronavirus #china #wuhanvirus #chinavirus
2231664233431475168; 0; False; 1580255129; Ahahahahahahahahahahah . . . . . . . . . . . . . . . . . . . #meme #memes #funny #dankmemes #memesdaily #funnymemes #italia #dank #follow #humor #like #dankmeme #corona #love #anime #edgymemes #comedy #lol #dailymemes #instagram #coronavirus #fun #ridere #risate #funnymeme #memer #memestagram #memeita #haha #memesita
2231664205587730168; 0; False; 1580255126; :warning: CORONAVÍRUS :warning: Ministério da Saúde eleva nível de segurança para dois (2), que significa “Perigo Iminente”. . . . >> BRASIL: No Brasil, três casos estão sob investigação. (Belo Horizonte, Porto Alegre e Curitiba). . . . >> CHINA: Na China, 106 pessoas já morreram em decorrência do vírus e outras 4 mil estão infectadas. Ao longo do planeta, 18 países já confirmaram casos do novo vírus. . . . >> SINTOMAS: . - Febre; - Tosse; - Falta de ar; - Problemas Gástricos; - Diarreia; . . . - CASOS GRAVES: - Pneumonia; - Síndrome respiratória agudo severo; - Insuficiência renal; #CoronaVirus #Virus #infeccao #doençarespiratoria #mundo #world #Informação #News #TamoJuntoJM
2231640791709951134; 1; False; 1580255125; Todo lo que tienes que saber del Corona Virus. ¿cómo se transmite, cómo evito el contagio, tiene cura?. ⠀ #coronavirus #noticias #lima #drparedes #cirujanoplasticoenlima #cirugiaplasticaparedes #informate #noticiasinternacionales
2231664173419755555; 0; False; 1580255122; You can never tell now with the plague out there. We gonna die with our 2020 vision - Follow { @ssealwood } for more - - #meme #memes #memez #dankmemes #funnyaf #funnymemes #spongebob #hillariousmemes #cutememes #dirtymemes #whorememes #hoememes #gaymemes #cleanmemes #asianmemes #lonelymemes #schoolmemes #relatablememes #kpop #highschoolmemes #anime #universitymemes #grammys #nonutnovember #arianagrande #collegememes #lovememes #lonelymemes #ssealwood #coronavirus #ladygaga
2231664107525121485; 14; False; 1580255114; :microphone:Yas Aussie this is a Good news Well-done to our fabulously hard-working scientists. :red_heart::clapping_hands::Australia: 'We got it': The game-changing moment when this Australian lab recreated coronavirus :smiling_face_with_3_hearts: Australian researchers have replicated the #coronavirus in laboratory conditions in a medical breakthrough that could help speed up the development of a vaccine to combat the deadly virus #indonesiavoice_ #infoindonesiavoice_
2231664092418682798; 0; False; 1580255112; Premier post / RIP Kobe #kobe #coronavirus :frowning_face:
2231664002205809491; 0; False; 1580255101; #mekke #suudiarabistan #filistin #israil #ortadoğu #amerika #türkiyem #:Turkey::Turkey::Turkey: #chpkk #chp #abdülhamidhan #fatihsultanmehmet #kanunisultansüleyman #sultanvahdeddin #sultanhamid #tahsinpaşa #imamoğlu #rterdoğan #rte #erdoğan #reisicumhur #cumhurureis #emineerdoğan #binaliyıldırım #kanalistanbul #doğutürkistan #coronavirus #australia #süleymansoylu #beratalbayrak
2231663989455335408; 3; False; 1580255100; Malangavirus in Hialeah :face_screaming_in_fear: Swip left and say your Final goodbye :crying_face::loudly_crying_face: #Coronavirus #Hialeah
2231663983602382385; 0; False; 1580255099; Ozzys just immortal. #chinese #people #getting #sick #from #eating #bats #ozzyosbourne #ozzymemes #coronavirus #he #is #immortal
2231663895997738736; 0; False; 1580255089; Wow herb ( stay safe guys and wash ur hands! ) #cookierunovenbreak #cookierunmemes #herbcookie #cookierun #plagueinc #plagueincmemes #coronavirus
2231663757586565117; 0; False; 1580255072; El #planeta se enfrenta a una situación bastante compleja, no por la gravedad inmediata del asunto sino por la potencial relevancia que pueda generar esto en la población mundial. El #Coronavirus es un #virus que se deriva de un grupo bastante común de microorganismos que no se han presentado como agente infeccioso agresivo. En este caso la comunidad mundial activo sus alarmas pues, pese a que no tiene una alta tasa de mortalidad, tiene un nivel de contagio que es elevado y que preocupa a las potencias. Aunque solamente se ha registrado un número cercano a los 50 casos fuera de #Asia, ha llegado a presentarse en zonas muy lejanas al epicentro de la enfermedad lo que aumenta la posibilidad de que se salga de control. Este fenómeno ha logrado impactar diferentes sectores que pueden llegar a demostrar de qué manera está funcionando el sistema de inversiones que a su vez afecta la perspectiva que se puede tener sobre la economía de un país. Este es el mejor ejemplo para llegar a pensar que el sistema financiero y el comercio #mundial son demasiado susceptibles ante cualquier situación que se pueda generar para el futuro de una empresa o en este caso nación y deja en evidencia que lo más importante para una #economía es lograr generar la confianza para seguir imponiéndose en el mundo de las potencias. A priori se pensaría que esto afectará a #China en su desarrollo y la forma en que es percibido. Sin embargo, haría una a apuesta a que esto a largo plazo será más beneficioso económicamente para este #país de lo que se espera, pues la manera como se comporta una #nación ante los momentos difíciles puede llegar a aumentar demasiado la confianza en ella y China lo ha hecho todo bien hasta el momento como por ejemplo la construcción de dos hospitales en menos de un mes que es una muestra de poder tecnológico abrumante. En conclusión, China saldrá de esto y el coronavirus no es más que una forma incendiaria de llamar la atención.
2231663442039990824; 1; False; 1580255071; Reposted from @daleelliottjr January is never ending... like it want to take all the news for itself! - #regrann #jamaica #cuba #caymanislands #earthquake #coronavirus #entertainment
2231663693917018892; 2; False; 1580255065; #coronavirus symptoms
2231663680588896230; 0; False; 1580255063; Due to the recent coronavirus outbreak in Wuhan City, any student traveling from China will be asked for a medical release from a health provider before returning to class. This also applies to any student who has been in contact with someone carrying the virus. There will be no makeup fees charged upon return to class for those affected. According to the LA County director of public health, there are steps that everyone can take to reduce the risk of getting sick from circulating viruses, including coronavirus. This includes remaining home when ill, washing hands with soap and water frequently, and getting vaccinated against flu. The health and safety of our students is our number one priority; we thank you in advance for your understanding and cooperation. We wish everyone health and prosperity! :warning::biohazard::microbe: #coronavirus #health #baronbrownstudio #students
2231663662142383699; 11; False; 1580255061; Hide yo kids #coronavirus
2231663642655597194; 0; False; 1580255059; #URGENTE #ULTIMAHORA Las autoridades de la provincia #china de #hubei han confirmado este martes 25 nuevas muertes de #pacientes infectados por el #coronavirus y a su vez reportó 840 nuevos casos, Las autoridades de salud pública de China informaron hoy martes que se habían reportado un total de 125 muertes y 4.515 casos confirmados de infección se habrían registrado hasta la fecha. La Comisión Nacional de Salud precisó en su informe diario que 976 pacientes se encontraban en condiciones críticas y 6.973 casos se mantenían bajo sospecha de haber contraído el virus hasta el final de la jornada de ayer. Un total de 60 personas han sido dadas de alta del hospital tras su recuperación. La delegación indicó que se han rastreado un total de 47.833 personas. De ellos, 44.132 están bajo observación médica y otros 914 fueron dados de alta este lunes. Además, se reportaron ocho casos en la Región Administrativa Especial de #Hongkong, siete en #macao y cinco en #taiwan. Créditos fotografías. News.cn
2231663634919210387; 0; False; 1580255058; Pra finalizar nossa sequência, separei 5 pontos que também podem colaborar com o fortalecimento da imunidade: . :sun_with_face:Vitamina D: você costuma levar sol sem protetor solar, cerca de 20min por dia? Se sim, parabéns! Se não, fique atento! A deficiência de vitamina D pode comprometer não apenas a imunidade, mas também o funcionamento intestinal (que também interfere na imunidade), caso você não queira/possa levar sol de jeito nenhum, procure um profissional para lhe orientar na suplementação de vitamina D; :sleeping_face:Você dorme direito? Suficiente, regular e dentro do horário (23h-05h pelo menos)? A privação de sono colabora com o aumento da inflamação, estresse oxidativo, é isso favorece o aparecimento de doenças. Quem dorme melhor, tem um sistema imunológico mais eficaz! :man_running_light_skin_tone:O exercício físico por sua vez, além de melhorar o sistema cardiovascular e metabolismo dos carboidratos, também colabora com a melhor adaptação do corpo ao estresse oxidativo (de uma forma bem simples de explicar, o corpo passaria a ter menos estresse oxidativo), essa adaptação tem participação do nosso querido sistema imunológico! :maple_leaf:A aromaterapia tem sido bastante explorada no tratamento de doenças e melhora do quadro de saúde, e não é diferente na imunidade, óleos como o de canela, cravo e eucalipto podem colaborar com o fortalecimento deste sistema - vale lembrar que deve ser realizado sob orientação profissional; :honeybee:O própolis é o bombril da Nutrição - Mil é uma utilidades! E quando falamos no fortalecimento imunológico, o própolis bate sua presença! Pode ser utilizado pela manhã e à noite. . Gostou das dicas? Conta pra mim qual você gostou mais! . Alexandra Menezes Nutricionista Emagrecimento e Saúde da Mulher :hibiscus: #coronavirus #imunidade #sistemaimunologico #nutricaoeimunidade
2231663547561300023; 25; False; 1580255047; Cancelan vuelos de EEUU a China por el riesgo que representa el Coronavirus.:China: :United_States:. - Debido al brote de coronavirus que se originó en Wuhan, China algunas aerolíneas norteamericanas se ha forzado a cancelar vuelos. - Por su parte el gobierno de EEUU considera restringir los viajes hacia el país asiático y aunque no es una medida que se debe cumplir obligatoriamente aún algunas aerolíneas han regresado el dinero a sus clientes. - United ha cancelado 24 vuelos hacia tres ciudades chinas programados para los primeros días de febrero y Finnair suspendió todos sus servicios a China. - :white_heavy_check_mark:¿Qué medidas se deben tomar para no propagar el virus? Comenta aquí :backhand_index_pointing_down_light_skin_tone::backhand_index_pointing_down_light_skin_tone::backhand_index_pointing_down_light_skin_tone:. - #evtv #china #coronavirus #28ene
2231663511632042967; 2; False; 1580255043; Yes it’s from animals ! .... no it’s not sheeple this is one of many bio - weaponized diseases to depopulate humanity . Wake up this is reality. Seriously dm me .
2231662012950073829; 0; False; 1580255027; . . Waspada... :no_entry::warning::exclamation_mark: . Turis Tiongkok Liburan di Raja Ampat Diduga Kena Virus Corona. . 2 hari setibanya di Sorong, turis tersebut memeriksakan diri ke RSUD Sele Be Solu dengan keluhan demam disertai batuk. . Pasien berinisial YP tersebut dirawat di ruang isolasi didampingi 2 rekannya Twitter t.co/9daSI5D3NG #CoronaVirus #greenflotilla
2231663371720299778; 0; False; 1580255026; Ironie du sort... le plastique pour sauver des vies#coronavirus#avec vous la Chine
2231663257525376606; 2; False; 1580255013; La situación del ciudadano chino, de 49 años, quien es sospechoso de #coronavirus es «crítica», hasta las 11:00 de este martes 28 de enero, informó el Ministerio de #SaludPública (#MSP) en un comunicado difundido por la Secretaría de Comunicación. Lee el comunicado en nuestro perfil.
2231661659823144935; 0; False; 1580255000; Com três casos suspeitos no Brasil, temos que redobrar as medidas para prevenir a contaminação pelo Coronavírus. Os cuidados servem para todos, em qualquer idade e o mais importante é manter as mãos sempre limpas :raised_back_of_hand: #coronavirus #prevencao #informacao
2231662989910954360; 0; False; 1580254981; Why tf he levitate like that :skull_and_crossbones::skull_and_crossbones: Go check out my gaming channel link in bio or search harlepin go check it out and yes there is commentary - ° ° ° ° #dankmemes #memes #meme #memesdaily #dank #funnymemes #funny #edgymemes #lol #offensivememes #dankmeme #lmao #edgy #dailymemes #fortnite #follow #memestagram #minecraft #comedy #anime #dankmemesdaily #like #tiktok #spicymemes #cringe #funnyvideos #memer #humor #offensive #coronavirus
2231662977420306176; 0; False; 1580254979; Secretaria de Saúde confirma primeiro caso suspeito de coronavírus no Paraná. http://destaquedoivai.com.br/2020/01/28/secretaria-de-saude-confirma-primeiro-caso-suspeito-de-coronavirus-no-parana/ #coronavirus #curitiba @betopretoparana
2231662877075707400; 0; False; 1580254978; Reposted from @iseoulu The state of novel coronavirus has been raised from a state of caution to a state of alert. 1. Wear a mask 2. Wash your hands thoroughly especially the palms and under your fingernails 3. Observe cough etiquette If you have any symptoms such as fever or difficulty in breathing after visiting China, please contact any institutions before going to the hospital. #seoul#iseoulu#precautions#preventions#coronavirus#coronaviruses#novelcoronavirus - #regrann Ini Nomor Layanan Informasi Kemenkes Terkait Virus Corona - Kompas.com - https://nasional.kompas.com/read/2020/01/28/06160061/ini-nomor-layanan-informasi-kemenkes-terkait-virus-corona
2231662957096765117; 0; False; 1580254977; Robado de whatsapp #meme #memerancio #momazo #shitposting #shitpost #coronavirus #anime #coronavirusmeme #waifu #amazon
2231662956399927176; 0; False; 1580254977; HABERLER İÇİN TAKİP EDİN :backhand_index_pointing_right: @darkvebhaber #darkvebhaber #turkey:Turkey: #turkiye #elazighersey #haber #deprem #trump #abd #sondakika #haberler #coronavirus #corona #virus
2231662947086983877; 0; False; 1580254976; Reposted from @krisbowid Meski belum diketahui secara jelas bagaimana penularan Novel Coronavirus, sebaiknya Krisbowers tetap memperhatikan hal-hal berikut guna menghindari penularan penyakit pneumonia. Stay safe, Krisbowers! . . . . #corona #coronavirus #coronavirusoutbreak #virus #homesweethome #homedecor #promomurah #tipsandtricks #lifestyle #technology #DIY #krisbowindonesia #like #krisbow #likeforlike #bestproduct #follow #followforfollow #instamoment #dailypict #jualperkakas #perkakasterlengkap #industrial #kawanlamagroup #tools #industrialtools #jualperkakasmurah #bestquality #madiun
2231662889853143397; 0; False; 1580254969; #Repost @cienciausp with @make_repost ・・・ Coronavirus: conversamos com um virologista da USP especialista neste grupo. Acesse as stories do @cienciausp para ter respostas sobre as principais dúvidas: de onde ele veio, o que causa, quão mortal ele é de verdade, se há tratamento, quanto falta para uma vacina. ⠀ Fique de olho :eyes: que vamos continuar a trazer informações atualizadas. E confiáveis! ⠀ Na imagem, Paulo Brandão/FMVZ, primeiro entrevistado da série. ⠀ Foto e reportagem: Luiza Caires ⠀ #usp #pesquisa #ciência #ciências #ciencia #ciencias #coronavirus #epidemia #virose #saúde #doenca #virus #china #FMVZ #vacina #genetica #genética #genoma #morcego #biologia
2231662814078206310; 1; False; 1580254960; New documentary idea? #netflix #coronavirus
2231662773914694005; 0; False; 1580254955; Recién robado. Ahora quiero jugar re 4 :v . . . . . . . #coronavirus #residentevil #idk
2231662764257245075; 0; False; 1580254954; Reposted from @oposisi_ideologis Indonesia memang hebat gaes... . . #corona #coronavirus #OposisiIdeologis - #regrann
2231662699255105183; 1; False; 1580254946; that virus in china hm well Asians always be hypebeasts . . #meme #memes #memevideos #memepage #memesdaily #dankmemes #coronavirus
2231662668761479403; 6; False; 1580254942; Coño en vida :rolling_on_the_floor_laughing::rolling_on_the_floor_laughing: ya ni eso dan en el seguro :rolling_on_the_floor_laughing::rolling_on_the_floor_laughing: #memerospty #coronavirus #virus #panama #quexopa #elpanameño #envida #memes #memesespañol #memesmundial #memesdaily #memesderisa #memesgraciosos #memeschistosos #dailymemes #memestagram #humor #chistes #risas #panama #panamacitypanama #argentina #chile #venezuela #colombia #costarica #mexico #paraguay
2231662642806684341; 0; False; 1580254939; :gloves: Cuida a los tuyos y previene contagios a su salud:gloves: Realiza tus pedidos al WhatsApp :telephone_receiver:+51947172260 #peru #lima #prevencion #cuidado #coronavirus
2231662625016480166; 3; False; 1580254937; Should I be worried about the coronavirus? This is a question that's sure to be front of mind for some time - the coronavirus in question came to light in December 2019 in China, and there are now confirmed cases in many countries, including Australia. A coronavirus is a class of virus that causes respiratory illness, ranging from the common cold to more serious respiratory distress. This latest viral strain is officially called 2019-nCoV and it originated in Wuhan City, China. SARS and MERS are examples of coronaviruses from recent years, but the type of illness and mortality of the new virus is not yet known or comparable to either previous virus. Importantly, there is no evidence at this point that this coronavirus can directly affect a fetus. The virus is spread from human-to-human, most likely through direct contact with a person while they are infectious or through exposure to droplets from an affected individual. This includes droplets from a sneeze or cough, and also touching contaminated objects or surfaces such as a door handle. It is believed the incubation period is 14 days from contact - it can take this long for symptoms to first present. These symptoms can include: fever, runny nose, fatigue, sore throat, cough and shortness of breath. Remember, these can also be symptoms of the common cold! Your risk of acquiring infection can be reduced by avoiding people who are sick. If you are concerned you may have been exposed, avoid touching your eyes, nose and mouth, and wash your hands afterwards with soap and water for at least 20 seconds. If you are at high risk of coronavirus (have recently travelled to Wuhan City, taken a flight from Beijing or live with someone who has done this travel) and you experience symptoms, please call the dedicated hotline on 1800 675 398. Please DO NOT attend your GPs office or your Obstetrician's consulting rooms without calling ahead for advice. There is no specific treatment for the 2019-nCoV infection, however most of the symptoms can be treated with supportive medical care. #coronavirus #pregnancy #obstetricianmelbourne #melbourneobstetrician #francesperryhouse #drscottshemer #askdrscottnotdrgoogle
2231662577998870780; 0; False; 1580254932; Tome en cuenta estás recomendaciones :police_car_light: Ya que hay siete casos sospechosos de #coronavirus (nCoV) en Sudamérica :face_screaming_in_fear: • En el caso de Ecuador, el paciente, de nacionalidad china, está aislado en el Hospital 'Eugenio Espejo' en Quito :round_pushpin: 'Sus muestras fueron enviadas para el Control y Prevención de Enfermedades de Atlanta, Estados Unidos' :face_with_medical_mask:
2231662493029402606; 0; False; 1580254922; Di tengah cuaca yang ekstrem seperti sekarang, dunia heboh sama virus satu ini. Tentunya virus tidak hanya ini saja, tapi tetap mesti waspada dan gunakan etika saat bersin ya sahabat MDI. #mdi #mditack #viruscorona #corona #coronavirus
2231662496385014075; 6; False; 1580254922; Em tempos de uma pandemia do Coronavírus, vale a pena assistir este documentário que está no Netflix, chamado: “Pandemic, how to prevent an outbreak” {Pandemia, como prevenir um surto}, vale a pena assistir essa série e entender o que acontece. A pandemia surge, quando uma epidemia se espalha por diversas regiões do planeta. #coronavirus #netflix #agendablackofficial :microbe::stethoscope::grimacing_face::eyes:
2231662480915402059; 0; False; 1580254920; :cherry_blossom: Wardah Lightening TWC Light Feel:cherry_blossom: Kode: P029 . . Compact Powder Shade nomor 02 GOLDEN BEIGE Kondisi 90% Alasan jual Jarang banget dipakai Spons masih bersih (bisa minta dibersihkan lagi) . Harga beli 45rb Harga jual 25rb . :round_pushpin:Kawalu, Tasikmalaya :delivery_truck:JNE / J&T :heavy_check_mark:Shopee / Tokped / Bukalapak :ATM_sign:BRI/BNI/Mandiri/Mandiri Syariah _________________ #preloved #prelovedbranded #prelovedsby #prelovedmurah #tasikmalayahitz #rokmurah #wardahbeauty #wardahmurah #wardahinstaperfect #wardahmakeup #wardahlipcreammatte #bedakwardah #compactpowder #coronavirus #prelovedtasikmalaya #prelovedtasik #tasiksociety #maybelline #lipmatte #prelovedkosmetik #prelovedmakeup #prelovedmakeupmurah #lipcream
2231662455491053206; 1; False; 1580254917; Com o primeiro caso confirmado no Brasil. Vamos conversar ao vivo com uma Paraense que está morando na China e falaremos como está sendo o dia a dia após as pessoas diagnósticas com o vírus :microbe: #china #brasil #coronavirus #belem
2231662293540432839; 0; False; 1580254898; With Wang Haoran and Ai Weihao, two Chinese studying Albanian in #Tirana we spoke about the situation in #China regarding the #coronavirus - Top Show program
2231662299076416647; 1; False; 1580254898; Ok I’m scared :face_screaming_in_fear: :woman_running_medium_skin_tone::woman_running_medium_skin_tone::woman_running_medium_skin_tone::woman_running_medium_skin_tone::woman_running_medium_skin_tone:. #letsbesafeoutthere #coronavirus @funny_videos @tundeednut @drlucasofficial
2231662244056052274; 2; False; 1580254892; マスクがなーーーい。 怖いぜコロナウイルス！ All masks sold out due to coronavirus!! Scary pandemic! #coronavirus #コロナウイルス #マスクない #タイミング悪い #春節 #scary #飛行機飛ばない #pandemic
2231662232470836921; 0; False; 1580254890; repostÇin #Hubei Eyaletine bağlanan yollar kapatılıyor.⁣ ⁣ #virus #wuhan #coronavirus
2231662179103266166; 0; False; 1580254888; #coronavirus #prevencion #ojosylentesdeproteccion #transmisiondevirus #cubrebocas #dramoralesoftalmologiaculiacan #saludvisual
2231662205576668111; 0; False; 1580254887; Pray for China :China: #Coronavirus taking lives and crossing borders
2231662152025249853; 0; False; 1580254881; CORONAVÍRUS . Tudo que você precisa saber sobre essa nova doença. . ARRASTA PRO LADO . Curta, Compartilhe, Comente . #coronavirus #viagem #doencadomorcego #anvisa #cuidados #guiadoviajanteCSP
2231662147528952385; 1; False; 1580254880; Lol. #jokes #budweiser #corona #coronavirus #beer
2231662138964045492; 1; False; 1580254879; 131 Deaths:loudly_crying_face:The virus is spreading There are already over 5000 infected people in 13 different countries around the world all from #coronavirus :exclamation_mark::microbe: • • • #virus #malware #windows #coronavirus #hiv #cybersecurity #bacteria #china #microbiology #hospital #science #wuhan #pediatr #cerrahginekoloq #program #ginekoloq #psixoloq #canli #sunimayalanma #ortoped #ginekoloqcerrah #qadinxestelikleri #erroziya #azerbaijan #urek #baku #travmatolo #xestexana #coronavirusoutbreak
2231662124491577364; 0; False; 1580254878; URGENTE! #coronavirus
2231661714447838749; 0; False; 1580254875; Not all people are bad. So stop judging, stop cursing, stop badmouthing, stop all the irrespectful rubbish. Lets start praying and give each others encouragement. Especially to all Indonesian citizens who are still isolated, be safe. To Wuhan and other countries in the world who are fighting the epidemic. JIA YOU! 加油!! . . . Cr to Owner #加油 #武汉 #武汉加油 #coronavirus #semangat #dontgiveup #besafe #staysafe
2231662090913625152; 0; False; 1580254874; #alerta con el #coronavirus en #carnavales
2231662089058301406; 0; False; 1580254873; Un grupo de expertos del Comité Estatal para la Salud de China ha advertido este martes que las personas pueden infectarse con el coronavirus 2019-nCoV, que causa un nuevo tipo de neumonía mortal, desde una distancia de hasta dos metros. "Todos deben llevar puestas mascarillas protectoras y minimizar el número de contactos físicos cercanos", ha declarado Li Xingwang, uno de los citados expertos. "Al decir 'cercano' nos referimos a una distancia de entre uno y dos metros: la infección puede ocurrir desde esa distancia", ha precisado el funcionario. #QueOpinasPanama #ComentaPanama #Panama:Panama: #PTY #panama #panamá #panamacity #panamastyle #panamanian #panameños #panamalife #panama507 #pty507 #ptylife #ptypanama #507panama #507pty #panamalifestyle #Voto19 #TúEliges #ElQueNoVaNoCobra #Coronavirus #China:China:
2231662083085965833; 14; False; 1580254873; :globe_showing_Americas:A província de Hubei, na China confirmou nesta terça-feira (28) mais 25 mortes, elevando para 131 o número de mortes pelo novo coronavírus, sendo 125 apenas na província, que tem a cidade de Wuhan, considerada o epicentro da doença. Com o novo balanço, mais 840 casos foram confirmados, elevando para 5.436 infectados somente na China. Há ainda 59 casos confirmados em todo o mundo. (Foto: Reprodução/China) (Fonte: G1/Mundo) @exclusivo24hs
2231662069892314908; 0; False; 1580254871; #charliehebdo #caricaturiste #caricaturista #caricature #caricatures #caricatured #caricaturist #satire @charliehebdo #Chidi Ledragondor #coronavirus #coronaviruses #coronavirusoutbreak #coronavirusmemes #coronavirusfrance #coronavirusnews ...
2231662066745722404; 0; False; 1580254871; #Coronavirus: actualización en Paraguay :right_arrow:1 caso sospechoso identificado y otro descartado. :right_arrow:Para autorreportes, llamar al (0983) 87 92 75
2231662064263072501; 0; False; 1580254870; KENYATAAN MEDIA SEBAR BERITA PALSU WABAK NOVEL CORONAVIRUS (2019-nCov): SEORANG INDIVIDU DITAHAN UNTUK MEMBANTU SIASATAN #AKM1998 #beritapalsu #Coronavirus #KKM #KKMM #MCMC #PDRM #seksyen233 #tidakpastijangankongsi Sumber : @skmm_mcmc
2231662041773703943; 0; False; 1580254868; Según la imagen (fuente de Organización mundial de la salud y BBC) @bbcmundo @who :backhand_index_pointing_down_light_skin_tone::yellow_heart:es importante tomar en cuenta los síntomas y si lo presentan dirigirse inmediatamente a un centro hospitalario:hospital: * Usar mascarillas :face_with_medical_mask:, lavarse las manos con agua y jabón:shower:, evitar consumir alimentos contaminados que estén en mal estado y ni posean una higiene adecuada:cross_mark::SOS_button:. Esto último es un consejo que les doy porque así no sea este virus afecta tu organismo y como dije anteriormente puede traer serias consecuencias * #MauraVilela #nutricionclinica #dietetica #coronavirus #salud #saludable #alimentacion #recomendaciones #caracas #sanantoniodelosaltos
2231661633533334244; 0; False; 1580254858; Stay safe. Stay alive. :folded_hands_light_skin_tone: . #coronavirus #coronavirusoutbreak #virus #wuhan #wuhanvirus #coronaviruschina #wuhanchina #corona #coronovirus
2231659710350947572; 6; False; 1580254854; People are going around eating shit like this and then wonder why there is shit like the #coronavirus :confused_face::confused_face::confused_face::confused_face:
2231661797386366318; 0; False; 1580254839; Yo ya no piso el chino de la esquina ni en joda . . . . . . . . . #CoronaVirus #China #Trump #Merkel #Trudeau #Macron #Putin #Derecha #ExtremaDerecha #UltraDerecha #Conservador #Conservadurismo #Meme #Memes
2231661778563974633; 0; False; 1580254836; #coronavirus #corona #virus #coronavirüsü #coronavirüs #haber #hasta #ölü #türkiye #turkey #çin #女子会#女子力#大人女子#女子旅#コー #likeforlikes #like4likes #likeforfollow
2231661716966828842; 0; False; 1580254829; El buen dark souls Robado de @xanderale.jpg #darksouls #darksoulsmemes #coronavirus #coronavirusmeme #meme #momazo #bloodborne #fromsoftware #playstation #weeb #china #shitposting #shitpost
2231661717662056015; 0; False; 1580254829; #viruscorona #hdipropoelix #propoelix:trade_mark: #propolis #coronavirus Kunjungi Toko ini di Shopee ! ainulmujib92: https://feeds.shopee.co.id/universal-link/share/AMJWqQWXAgBJ_S0GAAAAAA==?smtt=0.0.9
2231661672271268711; 0; False; 1580254824; Stupid noobs . . . . . . . . . . . #dankmemes #dankmemesdaily #dailydankmemes #dailymemes #dankmemes #meme #memes #vibin #funnyshit #relatablememes #relatablegoodmemes #funnymemes #funnyvideos #memesdaily #memes:face_with_tears_of_joy: #spongebobmemes #plaugeinc #coronavirus #coronavirusmemes
2231661647743032690; 1; False; 1580254821; Tratamento e prevenção da epidemia atual da CORONAVIRUS, segundo Dr.Farokh Master, o medicamento homeopático mais indicado é Justicia adhatoda. . . . . . . . . . . . #homeopatia #terapeuta #hahnemann #homeopathy #tratamentohomeopatico #homeopatiaclassica #saudeintegrativa #homeopatiapodeajudar #terapeutahomeopata #동종의빛 #homeopathic #CORONAVIRUS #동종요법 #동종요법치료 #동종의학 #정통동종요법 #동종요법약물 #사무엘하네만 #epidemiaatual #terapeutayoon #우한폐렴 #예방법 #코로나바이러스
2231661619195592396; 0; False; 1580254817; Be safe out there!!! #besafe #coronavirus #protection #meme #lol #lmao #jaja
2231661608030233923; 0; False; 1580254816; ‪Queen Allia International Airport will now be screening passengers arriving to Jordan for coronavirus symptoms. Two screeners were installed at the airport. ‬ @qaiairport #qaiairport #jordan #coronavirus #virus #amman #ammanjordan
2231661561600357195; 0; False; 1580254810; “We made the Wuhan epidemic. The Coronavirus May have started with a bat in a cave, but human activity set it loose.” - NY Times in Korea this morning. . . “It’s time we wake up and start respecting nature and not interfere in its business. The biggest misconception humans live with is the assumption that they can control the forces of nature. Let’s use science to mimic nature instead of destroying it. I’m in the middle of witnessing the frenzy in Asia with the fast spreading corona virus and can’t wait to get back to NYC. A lot of businesses are being affected right now due to the crisis in China. Even organizations like the @accessoriescouncil are urging designers to seek manufacturing alternatives to China due to the volatility and instability of the country. Thankfully we shifted production for GUNAS out of China a long time ago. The reality of their unfair domination and desire to rule the world by controlling supplies and natural resources even outside of their own country is sickening. Please support fashion and goods #notmadeinchina .The world needs to seize back their power by supporting local products and services more now than ever before. Love, Sugandh” #gunasgirlboss . . . #climatechange #coronavirus #ethicalfashion #shoplocal #smallbusiness #thinkglobalactlocal #fashiondiaries #ecofashion #greenfashion #baglovers #fashioneithconscience #consciousfashion #veganblog #highfashionzerocruelty @nytimes
2231661513802724600; 1; False; 1580254805; ☨ . . . . #thisfuneralsucks #funeral #cemetery #grave #religion #love #coronavirus #poetry #poem #guns #drugs #music #producer #artist #flstudio #ableton #russia #losangeles #newyork #punk #grunge #goth #life #death #heaven #hell #christian #catholic #vsco #photography
2231661492107788985; 0; False; 1580254802; Semangat Pagi Millionaires! Serangan virus corona saat ini telah mencapai beberapa negara di dunia. Usaha pencegahan terhadap Virus Corona misalnya dengan mencuci tangan pakai air dan sabun serta menggunakan masker. Upaya lain juga dilakukan supaya korban infeksi virus corona bisa segera pulih, sehingga tak perlu menambah korban jiwa. Maka dari itu, Jangan lupa untuk menjaga kesehatan dan kebersihan tubuh ya Millionaires,,, Better life with MCI More info & order: IndahLie WA: 082273059777 / http://bit.ly/indahlieMCI IG: @nanospray_indahlie / #nanosprayindahlie LINE: indahliemci / @ihf5061u ( pakai @ ) TELEGRAM: @indahliemci WECHAT: indahliemci #nuvit #bpom #halal #imunebooster #sugarbalance #wholefoodnutrient #guladarah #produkmci #distributormci #productknowledge #kesehatan #betterlifewithmci #produkmci #produkkesehatan #sistemimun #kekebalantubuh #batuk #flu #pilek #demam #virus #corona #VirusCorona #PencegahanVirusCorona #coronavirus #MLMmarketing #mlm2020 #MCI #bisnismci
2231661474091077004; 1; False; 1580254800; Atenção! Divulgada a primeira foto oficial do coronavírus! Isso sim é publicação viral! :P . #coronavirus #coronavirusoutbreak #coronavirusmemes #coronavírus #china #chinacoronavirus #coronaviruschina #virus #vírus #virusmeme #memes #memeviral #viral #viralpost #corona #viruses #virose #viroses
2231661469695421648; 0; False; 1580254800; Nova atualização do Ministério da Saúde sobre o coronavírus no país: três casos suspeitos estão sendo monitorados pelas autoridades de saúde. Eles estão localizados no Rio Grande do Sul, Minas Gerais e Paraná. Os pacientes se enquadraram na atual definição de caso suspeito para nCoV-2019 (o novo coronavírus), estabelecida pela Organização Mundial da Saúde (OMS), ou seja, apresentaram febre e, pelo menos um sinal ou sintoma respiratório, e viajaram para área de transmissão local nos últimos 14 dias. O governo não tem planos para a retirada de brasileiros na China e não recomenda viagens para o país. Para mais informações, continue nos seguindo nas redes sociais e visite o nosso portal (link na bio). #coronavirus #atualização #casossupeitos #noticiasdesaude #portalcontexto
2231661356289723795; 8; False; 1580254786; I'm home! . . Im so excited to be back home in Shanghai. I know that sounds crazy but there's nothing like sleeping in your own bed surrounded by your own stuff. . . Let's discuss what it means for me to be home. Last night on the plane quarantine officials come on and check temperatures. Slight fever = quarantine. Any flu like symptoms = quarantine. Visited Wuhan recently = quarantine. . . Let's discuss what happens when you get off the plane. Without even realizing it, on your way to immigration, for both entering and exiting the country, you have a complete body scan done. If anything is not up to standards then some will come and escort you away. Where you go, I don't know. Yesterday was my first time actually seeing people being escorted away. Please keep in mind that I've left and re-entered the country eight times now. . . Let's discuss what actually happens when you leave the airport. You go into a 7 - 14 day isolation. This is to ensure that you are not infected and that you don't infect others. People who don't do their isolation are not allowed back at work when everything opens. Example: my school won't open until the 17th of February now due to the virus. I have to be back in Shanghai by the 10 or I'm not allowed to teach. Everyday a health update is sent to the head nurse at my school who then sends it to the government. . . Why isolation? Well, with everyone expected to travel back to their residences this week from vacation the rate of infection is suppose to increase at a rapid rate. This is just one measure to help slow down that increase. . . I say all of this to request Disney+ and Netflix recommendations. After all, I'm stuck inside for the unseeable future. . . #Sequence8 #Disney #ShanghaiDisneyland #China #Shanghai #Asia #HongKongDisneyland #HongKong #DisneyStyle #DisneyStyleAroundTheWorld #ChineseNewYear #CNY #LunarNewYear #CoronaVirus #POCDisney #BlackGirlDisney #ChipandDale #CharacterSnapshot #ShanghaiDisneyResort #Disneyland #YearoftheRat #YearoftheMouse #DisneyPlus #Netflix #Isolation #TravelingtoChina
2231661360147956875; 1; False; 1580254786; Right or left . . #follow #followforfollowback #racistmeme #offensivememes:sweat_droplets::eyes::hundred_points::face_with_tears_of_joy::face_with_tears_of_joy::gem_stone::fire::face_with_steam_from_nose::sweat_droplets::OK_hand::hundred_points::face_with_tears_of_joy::folded_hands::face_with_tears_of_joy::face_with_tears_of_joy::gem_stone::gem_stone::fire::face_with_steam_from_nose::sweat_droplets::eyes::eyes: #coronavirus #coronavirusmemes #meme #memes #edgymemes #dankmemes #offensivememes
2231661347222101063; 0; False; 1580254785; Se liguem nessas informações bem legais e resumidas galera para entendermos um pouquinho sobre o coronavírus!!! #biomedicina #estudos #pesquisa #coronavirus #tratamento #cura #prevenção #sintomas #science #saude #descobertas #mulheresbiomédicas
2231661271020091242; 0; False; 1580254785; Nothing on earth is safe. Ppl truly eating anything. #coronavirus #outbreak #epidemic #food #eatbetter #nasty #bats #diet #hungry #lionbydabeach #huemongrind #explorepage
2231661316425477144; 0; False; 1580254781; Waspadai coronavirus yang sedang melanda beberapa negara di berbagai belahan dunia. Apa itu Coronavirus ? Apa saja gejala yang ditimbulkan? Dan bagaimana cara mencegahnya? Cari tahu infonya di postingan instagram Jimshoney yuk! Dan jangan lupa untuk selalu waspada dan jaga kesehatan kamu ya! . . #staysafe #corona #coronavirus #jimshoney
2231661276497910229; 0; False; 1580254777; Coronavirus - cách phòng ngừa tốt nhất https://youtu.be/vNXdkc24C_A #coronavirus #mckyduyen
2231661263501831129; 0; False; 1580254775; Gotta get this hip ex-ray'd up... that #CoronaVirus ain't no joke but it's still #BlackOut Bitchez! "Corona Sir?... no thanks I'll have a #Bud
2231661243295298425; 0; False; 1580254773; ช่วงนี้ ทั่วโลกต่างวิตกในข่าวการแพร่ระบาดของไวรัสโคโรนา:microbe::dna: ทราบมั้ยว่า #การล้างมือด้วยสบู่:soap: สามารถยับยั้งการระบาดได้ ด้วย ?!? หนึ่งในวิธีที่สามารถยับยั้ง-ป้องกันคุณจากไวรัสร้ายนี้ :microbe:คือ #การรักษาสุขลักษณะของร่างกายและมือของคุณให้สะอาดอยู่เสมอ:sweat_droplets::soap::palms_up_together_light_skin_tone::sparkles:#ล้างมือด้วยสบู่และน้ำสะอาดหลังหยิบจับสิ่งต่างๆ สามารถช่วยป้องกันและยับยั้งไม่ให้เชื้อไวรัสโคโรน่าหรือเชื้อโรคแพร่เข้าสู่ตัวคุณเวลาสัมผัสสิ่งต่างๆซึ่งอาจมีเชื้อโรคปนเปื้อนอยู่ ขอบพระคุณข้อมูลดีๆจาก: กรมควบคุมโรค และ World Health Organization :herb::herb::herb::herb::herb::herb::herb::herb::herb::herb::herb::herb::herb::herb::herb: @oataepremiumnaturalsoap : พรีเมี่ยมมัทฉะกรีนที&โกทมิลค์ :soap:สบู่Homemadeหนึ่งเดียว ที่รวมเอา 3 อาหารผิวเพื่อการบำรุง รักษาปัญหาผิว ช่วยล้างสิ่งสกปรกและเชื้อโรคต่างๆให้หลุดจากผิวพรรณของคุณอย่างอ่อนโยนต่อทุกสภาพผิว แม้ผิวแพ้ง่าย:woman_getting_massage_light_skin_tone::man_getting_massage_light_skin_tone::woman_in_steamy_room_light_skin_tone::man_in_steamy_room_light_skin_tone:ทั้งผิวหน้า-ผิวกาย :glowing_star:Matcha Greentea:seedling::teacup_without_handle: มัทฉะชาเขียวแท้จากญี่ปุ่น :glowing_star:Goat Milk:glass_of_milk::goat: น้ำนมแพะเกรดพรีเมี่ยมจากนิวซีแลนด์ :glowing_star:Oroma Oil:alembic: น้ำมันบำรุง ชุ่มชื้นผิวมีสุขภาพดีจากฝรั่งเศส #Oatae #PremiumNaturalSoap #NaturalSoap #MatchaGreentea #GoatMilk #clense #Hygiene #coronavirus เลขที่จดแจ้ง:10-1-6100055668 ขนาด 100g. :woman_raising_hand_light_skin_tone::woman_tipping_hand_light_skin_tone:สอบถามข้อมูลผลิตภัณฑ์เพิ่มเติมที่ :mobile_phone:line id : @Oatae หรือคลิ้ก https://line.me/R/ti/p/%40oatae
2231661235393204812; 0; False; 1580254772; Huehuehuehue... Os caras não perdem tempo mesmo. #gamersmemes #gamesmemes #gamermeme #gamememe #gamersbrasil #gamerbr #nerdice #nerdismo #nerdgamer #geekbrasil #geeksbr #culturageek #geekgamerbrasil #geekgamer #corona #coronavirus #racooncity #residentevil #residentevilmemes #comunidadegamer #pitodipaiagames #brasilgames #brasilgamers #ps4brasil #ps4br #pcgamerbrasil #xboxonebrasil #xboxonebr
2231661166009326467; 0; False; 1580254763; Waspadai coronavirus yang sedang melanda beberapa negara di berbagai belahan dunia. Apa itu Coronavirus ? Apa saja gejala yang ditimbulkan? Dan bagaimana cara mencegahnya? Cari tahu infonya di postingan instagram Jimshoney yuk! Dan jangan lupa untuk selalu waspada dan jaga kesehatan kamu ya! . . #staysafe #corona #coronavirus #jimshoney
2231661162871925087; 0; False; 1580254763; #update #coronavirus 131 orang mati 1000an orang dlm kondisi kritis 5000 lebih terinfeksi
2231661111165773772; 0; False; 1580254757; It rly be like that sometimes :eyes: :tired_face: :worried_face: #corona #corona:beer_mug: #coronavirus #china #chinaglaze #chinesenewyear #coronavirusoutbreak #outbreak #ambulance #dankmemes #ripjuicewrld #ripkobebryant #meme #90saesthetic #edgymemesforedgyteens #teenmodel #teenstyle #teachersofinstagram #hollywood #vapecommunity #420community #memeaccounts #ww3memes #worldwar3 #ww3 #2020 #influencers #influencerstyle #tiktok #tiktokdance
2231660888356359580; 2; False; 1580254730; When you and the coronavirus happen to be traveling through Asia at the same time #bettersafethansorry
2231659739025229870; 1; False; 1580254695; Строительство больницы в Ухане для заражённых коронавирусом идёт полных ходом. Подписывайтесь на наш instagram и узнавайте новости первыми! Новости без Цензуры 18+ в нашем Telegram канале (ссылка в шапке профиля)
2231660439237293036; 0; False; 1580254677; Datos más recientes sobre el coronavirus. #QueOpinasPanama #ComentaPanama #Panama:Panama: #PTY #panama #panamá #panamacity #panamastyle #panamanian #panameños #panamalife #panama507 #pty507 #ptylife #ptypanama #507panama #507pty #panamalifestyle #Voto19 #TúEliges #ElQueNoVaNoCobra #Coronavirus #China:China:
2231660258908806332; 8; False; 1580254655; Hasta cuándo :face_with_tears_of_joy::face_with_tears_of_joy:Sígueme @memezolanisiimo #fastandfurious9 #memezolanisiimo #rapidosyfuriosos #auronplay #auron #fastandfurious #memesespañol #memesauronplay #momos4k #momossad #memesenespañol #memes #memer #memez #videosgraciosos #video #videos #lol #jajaja #genial #cmamo #chicassexys #instagood #instagram #insta #nm #nomames #momos_4k
2231659926938468562; 1; False; 1580254616; Les recordamos que para reducir la exposición a una serie de infecciones la OMS recomienda buena higiene de manos y respiratoria, el manejo higiénico de los alimentos y, siempre que sea posible, evitar el contacto estrecho con cualquier persona que muestre signos de afección respiratoria, como tos o estornudos.
2231659152812373947; 0; False; 1580254612; :man_facepalming::man_shrugging: comparte que se sepa Nos quieren matar a todos #wuhan #coronavirus #coronavirusespaña
2231659167264212686; 0; False; 1580254525; :police_car_light::police_car_light::police_car_light: Alerta :police_car_light: :police_car_light::police_car_light: :SOS_button::SOS_button::police_car_light::police_car_light::police_car_light::police_car_light::SOS_button::SOS_button::SOS_button: :Brazil::airplane::China: Brasileiros fiquem alerta :police_car_light: #coronavirus #china #brazil #brasil #wuhan #pequim #guangdong #virus #viruschina2020 #globo #g1 #g1globo #Sars #jornaldobrasil
2231651054835902729; 0; False; 1580253829; Reposted from @juragan_sableng72 . Sebuah rekaman video memperlihatkan seorang turis asal China meradang lantaran harus menjalani serangkaian tes untuk mencegah masuknya virus Corona dari Wuhan di Bandara Senai, Malaysia. Dilansir dari World of Buzz, Senin (27/1/2020), turis tersebut tampak ditempatkan di sebuah ruang. Kemungkinan besar untuk menjalani screening dari otoritas bandara. Terlihat di video itu, dia menggedor dinding kaca yang 'mengurungnya'. . Bukan cuma itu, dia bahkan mencoba untuk memanjat dinding kaca tersebut guna menarik perhatian otoritas Bandara Senai, Distrik Kulai, Johor, Malaysia. Tak pelak, polah turis tersebut membuat geger bandara. Sekadar informasi, Malaysia kini berada di tengah kekhawatiran besar masuknya wabah virus Corona dari Wuhan, China. Alhasil, sejumlah alat screening ditempatkan untuk menyasar turis-turis yang datang dari negara tersebut. . . https://www.gelora.co/2020/01/turis-china-ngamuk-ogah-screening-virus.html?m=1 - #corona #coronavirus #viruscoronachina #saveughyursos #savemuslimuyghur #IndonesiaStandsWithUyghur #opposite6890 #regrann
2231652175283997108; 0; False; 1580253692; #bushfires #coronavirus #australia #canberra
2231544210904466464; 0; False; 1580240848; Yo pedo lügt bestimmt nicht . . . . . . . . @abugullo#illness #china #blackhumor #haha #witzig #alman #memes #keller #likeforlikes #likeforfollow #wuhan #virus #corona #coronavirus #deutschrap #tiktokmemes #tiktokgirls #tiktok #alman #almanmemes #capitalbra #nimo #mero428 #kmn
2231480299181780501; 26; False; 1580233899; :musical_score: : @wizkidayo & @iam_slimcase - GUCCI SNAKE :snake::black_heart::green_heart: @wizkidnews @slimcaseupdates @odadans @naijaworldofdance @chopdaily @naijatunez #naija #nigeria #lagos #dance #dancer #instadance #instagram #odadans #istanbul #turkey #chopdaily #music #slimcase #wizkid #guccisnake #afrobeats #afro #african #china #wuhan #coronavirus #kobebryant #kampala #uganda #ghana #afrobeat #musicvideo
2231017180199410924; 0; False; 1580177994; #instanascidodenovo #agostinho #boanoite #compartilhe #jesus #esperança #fé #versos #instaadrielsilva #centroteologiconascer #teologia #versos #memes #brazil #amazonia #coronavirus #humildade #natureza #noite #madrugada #segue #curtidas #facebook #online #web #fotografia #tbt #alagoas #iran #evangelho #bomdia
2231661089312420471; 0; False; 1580254754; :China::China::China: #coronavirus #corona #china #lojadochinês #balato #ferramentas #tools #blackanddecker #parafuso #prego #lanterna #semtalão
2231661067000315925; 0; False; 1580254752; Semangat Pagi Millionaires! Serangan virus corona saat ini telah mencapai beberapa negara di dunia. Usaha pencegahan terhadap Virus Corona misalnya dengan mencuci tangan pakai air dan sabun serta menggunakan masker. Upaya lain juga dilakukan supaya korban infeksi virus corona bisa segera pulih, sehingga tak perlu menambah korban jiwa. Maka dari itu, Jangan lupa untuk menjaga kesehatan dan kebersihan tubuh ya Millionaires,,, Better life with MCI More info & order: IndahLie WA: 082273059777 / http://bit.ly/indahlieMCI IG: @nanospray_indahlie / #nanosprayindahlie LINE: indahliemci / @ihf5061u ( pakai @ ) TELEGRAM: @indahliemci WECHAT: indahliemci #nuvit #bpom #halal #imunebooster #sugarbalance #wholefoodnutrient #guladarah #produkmci #distributormci #productknowledge #kesehatan #betterlifewithmci #produkmci #produkkesehatan #sistemimun #kekebalantubuh #batuk #flu #pilek #demam #virus #corona #VirusCorona #PencegahanVirusCorona #coronavirus #MLMmarketing #mlm2020 #MCI #bisnismci
2231645917711007573; 0; False; 1580254751; :thinking_face: wAi ArE u RUnNinG? FOLLOW @dottedmuffin . . . . . . . #humor #memesdaily #memes #meme #fun #comedy #funnymemes #funnymemesdaily #country #countries #china #coronavirus #dailymeme #dailymemes #video
2231651814474678061; 0; False; 1580254750; Even though in China we battle a public health emergency in the form of a coronavirus, it is Kobe’s death that dominates online chatter. . . . #quesinchina #chinajiayou #standwithchina #chinaques #divinenine #chimunu #dawgteam #nphcgreeks #quepsiphi #kobeforever #lunarnewyear2020 #ratyear2020 #omegaman #lifeinchina #omegapsiphifraternityinc #divine9 #shanghailife #beowt #coronavirus #thebruhz #kobeforever #chinainsider #livinginchina #friendshipisessentialtothesoul
2231660511976451719; 3; False; 1580254746; :cherry_blossom::cherry_blossom::cherry_blossom: . . . ما رأيكم ؟:loudly_crying_face::broken_heart: الله يسمح لينا من الوالدين . . . . . . . . • • • ‎ . . #جلابيه #المغرب #marocains #مكناس #الحسيمة #casablanca #caftan #المغرب_مغربنا #قفطان_مغربيه #المغربية #djellabamarocaine #maroc #الطبخ_المغربي #tiktokmaroc #tiktok #marrakech #العرس_المغربي #salmarachid #قفاطين #مراكش #الخليج . . #coronavirus #كورونا #الصبن #سرطان
2231660994042634689; 0; False; 1580254743; Waspada Virus Corona! . Belakangan ini, topik mengenai kasus virus corona yang mewabah di wilayah Cina sedang merebak di berbagai media. . Topik tersebut berhasil membuat semua orang yang mengetahuinya merasa khawatir. . Tetap tenang, Sahabat. Virus ini bisa dicegah. . https://mandiribersama.org . #mandiribersama #semuabisamandiri #virus #corona #coronavirus #respiratorysystem #mers #sars #who
2231660964156428107; 0; False; 1580254739; . . . . #gamermemes #singaporememes #cyberpunk2077 #marvelmemes #retrowave #newretrowave #blizzard #sgig #vaporwaveaesthetic #filmmaking #starwarsart #colorpalette #vaporwaveart #memesdaily #warcraft #coronavirus #aesthetic #cinematography #vaporwaveaesthetics #synthwavemusic #bladerunner #hearthstone #nbamemes #synthwaveart #jokermovie #starwarsmemes #riseofskywalker #dailymemes #wuhan #kobebryant
2231660914921657786; 4; False; 1580254733; A NOVA PESTE NEGRA:question_mark: Sabemos que os números ainda são incomparáveis, porém a doença vem se espalhando muito rapidamente e a casos suspeitos aqui já no Brasil! A china hoje lançou uma nota confirmando 131 mortes e mais 5,500 pessoas infectadas! Que Deus nos proteja. :folded_hands_light_skin_tone: • • • #coronavirus #china #brasil #doenca #partidonovo #saude #populacao #doencarara #riodejaneiro #zonanorte #sulacap #valqueire #bentoribeiro #madureira #iraja #oswaldocruz #ativista #deusnocomando #milagre #triste
2231660827285523207; 0; False; 1580254723; Repost @amberlyn.id CORONA VIRUS DAN WABAH DI ZAMAN NABI Dunia digegerkan dengan menyebarnya virus mematikan di daratan Cina. Virus dengan sebutan Corona, yang mengakibatkan puluhan orang meninggal dunia. Wabah penyakit juga pernah terjadi di zaman Nabi, meski berbeda dengan Corona, tetapi sama-sama belum ditemukan obatnya saat itu. Wabah tersebut adalah Thaun, sejenis kusta yang menular. Rasulullah memerintahkan untuk melakukan isolali kepada korban yang terkena wabah tersebut. Sebagaimana tersebut dalam hadits berikut Amr bin Saad bin Abi Waqash mendengar bapaknya bertanya pada Usamah bin Zaid: “Apa yang pernah kamu dengar dari Rasulullah Saw tentang masalah tha’un?” Maka Usamah berkata, Rasulullah Saw bersabda: “Tha’un adalah sejenis kotoran (siksa) yang ditimpakan kepada satu golongan dari Bani Israil atau kepada umat sebelum kalian. Maka itu jika kalian mendengar ada wabah tersebut di suatu wilayah janganlah kalian memasuki wilayah tersebut dan jika kalian sedang berada di wilayah yang terkena wabah tersebut janganlah kalian mengungsi darinya”. (Shahih Al-Bukhari No. 3214) Bagi mereka yang mampu bersabar menghadapinya, Rasulullah memberi kabar surga. Beliau bersabda Kematian karena wabah adalah surga bagi tiap muslim (yang meninggal karenanya). (HR. Bukhari) Namun demikian, Rasulullah mengajarkan umatnya untuk memohon kepada Allah agar dijauhkan dari wabah mematikan semisal Corona dan sebagainya. Beliau mengajari dengan doa اللَّهُمَّ إِنِّي أَعُوذُ بِكَ مِنَ الْبَرَصِ وَالْجُنُونِ وَالْجُذَامِ وَمِنْ سَيِّئِ الأَسْقَامِ Ya Allah, aku mencari perlindungan kepadamu dari kusta, kegilaan, kaki gajah, dan penyakit jahat. (HR Abu Daud) Selain berdoa, hendaknya kita juga meningkatkan kewaspadaan dengan menjaga kesehatan, sering cuci tangan, menghindari makanan yang haram dan menjijikan dan menghindari sebab yang menimbulkan keburukan. Sumber : majalah arrisalah Follow @amberlyn.id @amberlyn.gift #amberlyndakwah #hadistshahih #hadistoftheday #dakwahtauhid #dakwahsunnah #ayatoftheday #quotesoftheday #hrmuslim #hadistrasul #hadistrasulullah #corona #coronavirus #viruscorona #wuhan #wuhanchina #wuhanvirus #cinamuslim #cina #tiongkok #doaterhindardarivirus
2231659565154078077; 0; False; 1580254722; Reposted from @cordova.media Seorang pejabat Kemenlu China, bernama Lijian Zhao memposting di akun twitternya, video pembangunan rumah sakit yang dibangun untuk pasien yang terjangkit virus Corona. Rumah sakit yang dibangun selama 16 jam ini, berbentuk box dilengkapi dengan teralis besi di jendelanya dan dan kunci yang diletakkan di pintu bagian luar.⁣ ⁣ Di postingan tersebut, ia juga menuliskan, "Let's pray for Wuhan & China", mari berdo'a untuk Wuhan dan China. Sudah jamak diketahui bahwasanya pemerintah China dari Partai Komunis China menganut paham atheisme. Namun dalam kondisi darurat seperti ini, salah satu anggotanya mengajak berdo'a untuk Wuhan dan China yang saat ini dilanda wabah virus Corona. Sudah menjadi fitrahnya, manusia bahkan ateis sekalipun, ketika dalam kesulitan, membutuhkan pertolongan dari Tuhan Yang Maha Kuasa.⁣ ⁣ "Dan dia dibantah oleh kaumnya. Dia berkata: 'Apakah kamu hendak membantah tentang Allah, padahal sesungguhnya Allah telah memberi petunjuk kepadaku'. Dan aku tidak takut kepada [malapetaka dari] sembahan-sembahan yang kamu persekutukan dengan Allah, kecuali di kala Tuhanku menghendaki sesuatu [dari malapetaka] itu. Pengetahuan Tuhanku meliputi segala sesuatu. Maka apakah kamu tidak dapat mengambil pelajaran [daripadanya]?" [QS. Al-An'am: 151].⁣ ⁣ "Dan sesungguhnya Kami jadikan untuk [isi neraka Jahannam] kebanyakan dari jin dan manusia, mereka mempunyai hati, tetapi tidak dipergunakannya untuk memahami [ayat-ayat Allah] dan mereka mempunyai mata [tetapi] tidak dipergunakannya untuk melihat [tanda-tanda kekuasaan Allah], dan mereka mempunyai telinga [tetapi] tidak dipergunakannya untuk mendengar [ayat-ayat Allah]. Mereka itu sebagai binatang ternak, bahkan mereka lebih sesat lagi. Mereka itulah orang-orang yang lalai" [QS. Al-A'raf: 179] . Revisi: di video tertulis 16 hari, yang benar adalah 16 jam sebagaimana yang tertulis di postingan Twitter tersebut. ⁣ #coronavirus #viruscorona #wuhan #china #ccp #xijinping - #regrann
2231660762811877028; 0; False; 1580254715; @ap_airports Wabah Virus Corona sudah merebak di negara-negara Asia, tak terkecuali Asia Tenggara, termasuk negara-negara tetangga Indonesia. Selain mencegah masuknya virus melalui perketatan pengawasan terhadap kesehatan wisatawan di bandara, ada baiknya kita mencegahnya dari diri masing-masing. Kenali gejala dan cara pencegahannya yuk, #SahabatAP1! Kalian juga bisa bagikan tips pencegahan lain di kolom komentar. Meluncurrr! #AngkasaPura1 #AP1GoBeyond #CoronaVirus #VirusCorona #faastpenerbangan #sekolahpenerbangan #sekolahpramugari
2231660687942563275; 0; False; 1580254706; Waspadai coronavirus yang sedang melanda beberapa negara di berbagai belahan dunia. Apa itu Coronavirus ? Apa saja gejala yang ditimbulkan? Dan bagaimana cara mencegahnya? Cari tahu infonya di postingan instagram Jimshoney yuk! Dan jangan lupa untuk selalu waspada dan jaga kesehatan kamu ya! . . #staysafe #corona #coronavirus #jimshoney
2231660040971151387; 0; False; 1580254701; 6 días han pasado desde que la Ciudad a sido cerrada por el #coronavirus #radiomirafloreslaautentica #noticiasenespañol
2231660588245033155; 0; False; 1580254694; #coronavirus #residentevil #cvirus #umbrellacorporation #racooncity
2231660542636787121; 1; False; 1580254689; Çin, Wuhan'da savaşmak için iki yeni hastane inşa etme sözü verdi. . . . . . #turkey #türkiye #corona #korona #virüs #coronavirüs #sondakika #istanbul #bursa #izmir #ankara #hasta #hastalık #virus #coronavirus #haber #haberler #sondakikahaberler #çin #china #wuhan #güncel #güncelhaber #güncelhaberler #coronaviruses #coronaviruese #new #news #sondakikahaberleri
2231660540632335152; 0; False; 1580254689; Paranoia . . . #coronavirus #coronavirusmemes #virusspread #realitycheck #haha #paranoia #crazymind #crazymindcrazythoughts #crazythoughts
2231660543375011763; 0; False; 1580254689; Oh no... #memes #dankmemes #memesdaily #dankmemesdaily #coronavirus #catmemes
2231660519290230447; 1; False; 1580254686; 而家連酒精搓手都炒 我又搵最好既俾你地 美國No.1醫院品牌 我隻兔兔去開間獸醫診所都係用佢 所有搓手啫喱都含70%酒精 唔貴 （但運費貴:grinning_face_with_sweat:又重） 以下係每枝計，包左美國寄黎香港既價錢 順豐到付/就我面交（$150以上） Travel size 30ml $20 Travel size 30ml 連套可掛袋 $25 Travel size 59ml $30 236ml 吱吱裝（原味/蘆薈）$60 354ml 吱吱裝（含精油，比普通更護手）$80 請whatsapp:kissing_face_with_smiling_eyes: link in bio 陸續覆，店主會覆等左最耐既先 DM同留言唔知要輪幾多個鐘先覆到你:folded_hands_medium-light_skin_tone:
2231660487959127094; 0; False; 1580254683; 코로나바이러스 안걸리게 꼭 마스크쓰고 손소독제만 많이많이 처뿌리지만말고 손도 씻어라 ㅡ.ㅡ #코로나바이러스 #coronavirus #뒤지고싶지않으면손씻어
2231660381356798026; 0; False; 1580254670; Non è uno scherzo! Io penso che minimo tra una settimana consiglieranno di mettere le mascherine anche in tutto il resto del mondo!! Previsione del 29/01/20 00:34 condividi la notizia, tagga chi vuoi bene o chi non ci crede sotto questi post!!! #coronavirus #virus #viruscina #viruscinese #viruscorona #wuhan #cina #china #chinatown #italia #italy #italy:Italy: #instagram #viruswuhan
2231660094290768211; 0; False; 1580254670; It has corona . . . .#memes #coronavirus #memesdaily #batsoup
2231660376408613486; 2; False; 1580254669; No hay evidencia que relacione conclusivamente el consumo de murciélagos con el brote de #coronavirus de 2019 Aunque los murciélagos vendidos en el mercado de carne fresca de Wuhan, donde comenzó el brote, pueden haber sido la fuente de la infección de coronavirus, muchos otros tipos de carne animal vendida en el mercado también pueden ser una posible fuente. No hay suficiente evidencia científica que sugiera que los murciélagos, y no las jinetas, las serpientes, u otras carnes de animales portadores de coronavirus, causaron el brote. La afirmación de que el brote de coronavirus de 2019 fue causado por personas que comían murciélagos fue publicada en varios medios, incluyendo el Daily Star, The Sun e Infowars, y muchos artículos se volvieron virales en Facebook en menos de un día de la publicación de esta información. :backhand_index_pointing_right_medium-dark_skin_tone: Visite colombiacheck.com donde encontrará este y muchos más chequeos . . . . #NoComaCuento #Desinformación #Colombiacheck #NoticiasFalsas #NoticiasColombia #FakeNews #KobeBryrant
2231660370142295233; 1; False; 1580254668; Posted @withregram • @infectovita Medicação do HIV para Coronavírus? Isso mesmo! O Coronavírus é um vírus de RNA, o HIV também é. Então, o pessoal tá fazendo um estudo chamado MIRACLE trial para ver se a combinação do interferon com uma antiga medicação do HIV dá certo para curar o Coronavírus. . Para os mais antigos do HIV, lembram do Lopinavir/Ritonavir (vulgo Kaletra)? . Pois bem, ele está sendo testado nesse estudo. . Nós, da Infectovita, claro, estamos na maior torcida para que dê tudo certo! #kaletra #hiv #coronavirus #tratamento #mers
2231657305691015397; 0; False; 1580254667; Non è uno scherzo! Io penso che minimo tra una settimana consiglieranno di mettere le mascherine anche in tutto il resto del mondo!! Previsione del 29/01/20 00:34 condividi la notizia, tagga chi vuoi bene o chi non ci crede sotto questi post!!! #coronavirus #virus #viruscina #viruscinese #viruscorona #wuhan #cina #china #chinatown #italia #italy #italy:Italy: #instagram #viruswuhan
2231660348598151401; 0; False; 1580254666; Demasiada casualidad. #Venezuela #China #Coronavirus #N3328ene20
2231660329650005877; 1; False; 1580254664; No momento, a OMS classifica como alto o risco global do novo coronavírus. Até 28/01/20, os relatórios indicam 4593 casos confirmados, sendo 4537 na China, com 106 mortes. No Brasil, existem 3 casos notificados como suspeitos (Belo Horizonte, Porto Alegre e Curitiba) que estão em investigação. É importante lembrar as definições de caso suspeito: presença de sintomas como febre, tosse, dificuldade para respirar, além de histórico de viagem para a China, nos últimos 14 dias, ou contato com pacientes com suspeita ou doença confirmada. A maioria dos pacientes tem sintomas leves e, aproximadamente, 20% apresenta evolução grave, com pneumonia, insuficiência respiratória e possibilidade de morte. Ainda não está clara a epidemiologia completa da doença, ou a fonte inicial deste surto, mas a transmissão entre pessoas está documentada e, no momento, responsável pela disseminação da doença para outras localidades. Por isso, são tão importantes as medidas de prevenção como lavagem e higiene das mãos, cobrir a boca e o nariz ao espirrar e falar alto, higienizar as mãos após tossir ou espirrar e evitar contato com pessoas apresentando sintomas respiratórios. #coronavírus #coronavirus #infectodicas #dracamilamartini #who #minsaude
2231660264074339247; 0; False; 1580254656; :musical_notes:Cerveza #Corona Gratis!!! :star-struck:Prepárate porque el próximo #Viernes 31 Enero se prende la caprichosa con el antídoto del #Coronavirus 2x1 en todas las #CervezasCorona:fire::fire::fire:. No te quedes sin tu mesa, adquiere tu entrada ya!! llamando al 313 895 0657 - 318 793 4759
2231660251417868960; 0; False; 1580254654; #coronavirus #ultimas #b3 #aereas
2231660220814648993; 0; False; 1580254651; #coronavirus #ultimas #b3 #aereas
2231660193536282252; 0; False; 1580254647; #coronavirus #ultimas #b3 #aereas
2231660182278867760; 0; False; 1580254646; ช่วงนี้ ทั่วโลกต่างวิตกในข่าวการแพร่ระบาดของไวรัสโคโรนา:microbe::dna: ทราบมั้ยว่า #การล้างมือด้วยสบู่:soap: สามารถยับยั้งการระบาดได้ ด้วย ?!? หนึ่งในวิธีที่สามารถยับยั้ง-ป้องกันคุณจากไวรัสร้ายนี้ :microbe:คือ #การรักษาสุขลักษณะของร่างกายและมือของคุณให้สะอาดอยู่เสมอ:sweat_droplets::soap::palms_up_together_light_skin_tone::sparkles:#ล้างมือด้วยสบู่และน้ำสะอาดหลังหยิบจับสิ่งต่างๆ สามารถช่วยป้องกันและยับยั้งไม่ให้เชื้อไวรัสโคโรน่าหรือเชื้อโรคแพร่เข้าสู่ตัวคุณเวลาสัมผัสสิ่งต่างๆซึ่งอาจมีเชื้อโรคปนเปื้อนอยู่ ขอบพระคุณข้อมูลดีๆจาก: กรมควบคุมโรค และ World Health Organization :herb::herb::herb::herb::herb::herb::herb::herb::herb::herb::herb::herb::herb::herb::herb: :soap:สบู่ Oatae: พรีเมี่ยมมัทฉะกรีนที&โกทมิลค์ สบู่Homemadeหนึ่งเดียว ที่รวมเอา 3 อาหารผิวเพื่อการบำรุง รักษาปัญหาผิว ช่วยล้างสิ่งสกปรกและเชื้อโรคต่างๆให้หลุดจากผิวพรรณของคุณอย่างอ่อนโยนต่อทุกสภาพผิว แม้ผิวแพ้ง่าย:woman_getting_massage_light_skin_tone::man_getting_massage_light_skin_tone::woman_in_steamy_room_light_skin_tone::man_in_steamy_room_light_skin_tone:ทั้งผิวหน้า-ผิวกาย :glowing_star:Matcha Greentea:seedling::teacup_without_handle: มัทฉะชาเขียวแท้จากญี่ปุ่น :glowing_star:Goat Milk:glass_of_milk::goat: น้ำนมแพะเกรดพรีเมี่ยมจากนิวซีแลนด์ :glowing_star:Oroma Oil:alembic: น้ำมันบำรุง ชุ่มชื้นผิวมีสุขภาพดีจากฝรั่งเศส #Oatae #PremiumNaturalSoap #NaturalSoap #MatchaGreentea #GoatMilk #clense #Hygiene #coronavirus เลขที่จดแจ้ง:10-1-6100055668 ขนาด 100g. :woman_raising_hand_light_skin_tone::woman_tipping_hand_light_skin_tone:สอบถามข้อมูลผลิตภัณฑ์เพิ่มเติมที่ :mobile_phone:line id : @Oatae หรือคลิ้ก https://line.me/R/ti/p/%40oatae
2231660160241393065; 0; False; 1580254643; Ching chong your religion is wrong . . #follow #followforfollowback #racistmeme #racistmemesarethebestmemes #meme #memes #edgymemes #dankmemes #offensivememes #offensivememes:sweat_droplets::eyes::hundred_points::face_with_tears_of_joy::face_with_tears_of_joy::gem_stone::fire::face_with_steam_from_nose::sweat_droplets::OK_hand::hundred_points::face_with_tears_of_joy::folded_hands::face_with_tears_of_joy::face_with_tears_of_joy::gem_stone::gem_stone::fire::face_with_steam_from_nose::sweat_droplets::eyes::eyes: #nukedmemes #coronavirus #coronavirusmemes
2231660138272337517; 0; False; 1580254641; A photo from #gettyimages on the bbc news site earlier. “Wuhan jiayou! Stay strong Wuhan!!” People from apartment blocks all across the city and beyond are shouting out to each other and singing through their windows in solidarity whilst in quarantine. I just can’t imagine how upsetting it must be in that situation. Life on hold. Ticking time bomb. #addoil #staystrongwuhan #gunghayfatchoy #gongxifacai #wuhanjiayou #wuhan #coronavirus #china #happychinesenewyear #yearoftherat
2231660122265276551; 0; False; 1580254639; :rolling_on_the_floor_laughing::rolling_on_the_floor_laughing::face_with_tears_of_joy::rolling_on_the_floor_laughing::face_with_tears_of_joy::face_with_tears_of_joy:this #coronavirus thing got everybody on edge @thom_aj this funny tho #instafunny #funnymemes #comedy
2231660096419880800; 0; False; 1580254636; Dari Anas radhiyallahu ‘anhu bahwa Nabi shallallahu ‘alaihi wa sallam mengucapkan, “ALLOOHUMMA INNII ‘AUUDZU BIKA MINAL BAROSHI WAL JUNUUNI WAL JUDZAAMI WA SAYYI-IL ASQOOM (artinya: Ya Allah, aku berlindung kepada-Mu dari penyakit kulit, gila, lepra, dan dari penyakit yang jelek lainnya).” (HR. Abu Daud, no. 1554; Ahmad, 3: 192. Syaikh Al-Albani mengatakan bahwa hadits ini sahih. Syaikh Salim bin ‘Ied Al-Hilaliy dalam Bahjah An-Nazhirin juga menyatakan bahwa sanad hadits ini sahih). . -Keterangan hadits- Al-barash adalah penyakit yang sudah makruf, yaitu ada warna putih pada jasad yang akhirnya merubah bentuk dan penampilan. Al-junun adalah hilangnya akal. Al-judzam adalah penyakit kusta atau lepra. . -Faedah hadits- :sparkles:Rasulullah shallallahu ‘alaihi wa sallam meminta perlindungan dari penyakit yang jelek untuk mengajarkan kita bersabar, supaya tidak banyak mengeluh, yang akhirnya membuat kita luput dari pahala:sparkles: . :sparkles:Penyakit-penyakit yang disebutkan di sini punya dampak jelek pada penampilan dan fisik, sehingga bisa membuat orang lain menjauh:sparkles: . :sparkles:Rasulullah shallallahu ‘alaihi wa sallam tidak meminta perlindungan dari semua penyakit karena sakit sendiri dapat membersihkan dosa asalkan mau bersabar. Setiap orang bisa saja tertimpa sakit. Namun ujian yang paling berat adalah yang dihadapi oleh para nabi lalu orang di bawahnya lagi:sparkles: . Referensi: Bahjah An-Nazhirin Syarh Riyadh Ash-Shalihin. Cetakan pertama, Tahun 1430 H. Syaikh Salim bin ‘Ied Al-Hilali. Penerbit Dar Ibnul Jauzi. . Dukung dakwah kami : :camera: instagram : @ikrar_media :desktop_computer: facebook : ikrarmedia :mobile_phone_with_arrow: whatsapp : Keluarga Besar Ikrar #ikrarmedia #arraudhah #kajianislam #dakwahsunah #corona #virus #coronavirus #doa
2231660092236091004; 0; False; 1580254635; Stay smart . . . #corona #coronavirus #memes #darkmemes #darkhumor #dankmemes #dankmemesdaily #meme #jokes #kobe
2231660012653379969; 3; False; 1580254626; I called it! :backhand_index_pointing_right:Follow @mctuckyy for more • • • • • • • • • • • • • • Ignore these fam #meme #memes #memesdaily #dankmemes #nicememes #edgymemes #memesagram #memelord #memepage #cursedimages #memeaccount #memer #memegod #memestar #memeoftheday #memevideo #funny #minecraft #memelife #memes:face_with_tears_of_joy: #deepfriedmemes #goodcontent #depressionmemes #coronavirus #coronavirusmemes #coronaoutbreak #wuhan #batsoup
2231660004943071661; 0; False; 1580254625; STONIC BRUSH BW Harga :Rp. 155.000,- Size : 22-31 Untuk order : WA: 082144350409 #sepatuanak #sepatuanakperempuan #sepatuanakcowok #sepatuanaklaki #sepatuanakmurah #sepatuanakimport #sepatuanakcewek #sepatuanaksport #sepatuanakolahraga #sepatusandalanakimport #sepatusandalanakled #sepatuanakbandung #coronavirus #maiaestianty
2231659993130864633; 0; False; 1580254624; Demasiada casualidad. #Venezuela #China #Coronavirus #N3328ene20
2231659952523735571; 0; False; 1580254619; Sist juga pernah overweight suatu ketika dulu:beaming_face_with_smiling_eyes: . Alhamdulillah ..sist telah lost 19kg selepas joined kurus online coaching program..#MasyaAllah #tabarakaAllah . Sist seorg #kakimakan dan #jalan2carimakan:face_with_tears_of_joy: satu ketika dulu..#mylifestyle yg suka masak dan makan tanpa ambil kisah kalori, jenis makanan memberi kesan -ve kpd sist selepas 5 tahun..tabiat sist yg suka makan #fastfood dan #badhabits makan dan tido sedar tak sedar #gainweight dan kolestrol borderline..:grinning_face_with_sweat: . Mcm2 cara sist cuba utk kurangkan berat badan & kolestrol..antaranya kurangkan makan nasi, makan skip, jogging, ambil product kurus..tapi hasilnya tiada..sist lost 3kg naik balik 10kg :rolling_on_the_floor_laughing: . #alhamdulillah selepas joined #kurusonlinecoaching semua masalah yg dihadapi telah hilang..#syukur dalam KOC :heavy_check_mark:coach guide cara loseweight cara yg betul :heavy_check_mark:healthymenu for 30days and enjoy makan 5 to 6 times / day :heavy_check_mark:comboworkout by prof trainer :heavy_check_mark:coach guide teknik lock weight selepas ideal weight :heavy_check_mark:100% online . Jom..lets join us..sebab and juga boleh jd seperti sist :hugging_face::hugging_face: . PM:right_arrow:0126654980 coach zarina . Pendaftaran musim 42 feb’20intake masih dibuka . #dietmudah#kuruslepasebersalin#kurustanpasenam#kurustanpalapar#kuruscarabetul#jommsihat#jomkurus#azamtahunbaru2019#azamkurussebelumraya2019#ipoh#pj#kl#kepong#coronavirus#tv3#teamhudarizal#coachzarina
2231659932751325339; 0; False; 1580254616; #corona:beer_mug: #coronavirus #beingmexican #limewedge #itsfine
2231659133585748703; 0; False; 1580254615; Coronavirus: Roberto Burioni dà semplici consigli per limitare i rischi d’infezione #MedicalFacts #Coronavirus #Salute #Medicina #Virus #Wuhan
2231659850692114840; 0; False; 1580254613; Coronavirus aler‪t in Birmingham as medics in hazmat suits quarantine suspected victim. ‬⁣ ⁣ ‪Medics in hazmat suits were sent to Drew Bennett’s, 39, home in Harborne on Monday and he was taken to the QE, where he remains in isolation awaiting results. ‬⁣ ⁣ ‪ #WuhanSARS #WuhanOutbreak #CCPChina #chinazi #SARS2020 #武漢肺炎 #武汉疫情 #ChinaVirus #CoronavirusOutbreak at #Wuhan #china #武漢疫情 #冠狀病毒 #武漢肺炎 #新型肺炎 #新型コロナウィルス #武漢 #武漢市新型冠狀病毒肺炎 #武漢市 #chinanews #becausechina #faceofchina #massmigration #springfestival #coronavirus #WuhanCoronavirus #WuhanPneumonia #wuhanvirus
2231659647841233042; 2; False; 1580254613; ...pare por um momento...e se conseguir, imagine como estão se sentindo os inúmeros moradores de. Wuhan... Que Deus os proteja, grandemente!!! ......................... EMOCIONANTE: Vídeos mostram moradores de Wuhan (epicentro do surto do Coronavirus :microbe:) na varanda de seus apartamentos gritando pelas janelas e cantando canções patrióticas e o hino da China para se animarem. Os vídeos estão se propagando nas redes sociais. . Wuhan, com 11 milhões de habitantes está em quarentena. A cidade está isolada pelo Governo chinês desde quinta-feira (23). Ruas e aeroportos vazios, mas hospitais continuam lotados. . #pandemia #Wuhan #oms #saude #virus #alerta #noticias #noticia #notícia #notícias #news #MinhaCapital #Brasília #Brasilia #BSB #MinasGerais #Coronavirus Vídeo: reprodução
2231659884338965990; 0; False; 1580254611; Great :face_with_rolling_eyes: (luckily they were caught and detained) #CoronaVirus Credit - abc.net.au
2231659867109915141; 0; False; 1580254608; Coronavirus|| más textura • • • • • • • • #alert #alerta #coronavirus #SRAS #mers #handletters #handlettering #sakura #sakuramicron #tombow #tombowdualbrushpens #tombowbrushpen #ending2019 #crayolasupertips #crayola #paper #papermate #stabilomexico #stabiloswingcool #stabilopoint88 #stabiloboss #crayolamarkers #crayolaalternative #pink #pastels #lettering #apuntesbonitos #enjoy #enjoythelittlethings #colors
2231659730416547976; 0; False; 1580254607; People are not just barricading themselves inside #Wuhan, they are also trying to escape the quarantine zone, in this video they are repelled by police. How many have made it out? #coronavirus مردم نه تنها خود را در داخل # ووهان سد نمی کنند بلکه سعی می کنند از منطقه قرنطینه فرار کنند ، ؟ # کوروناویروس
2231659763838293654; 1; False; 1580254596; El coronavirus viendo cómo me entra la paranoia de contagiarme abriendo un paquetito de aliexpress, en cambio tirarme a medio tinder a pelo no me asustaba tanto baia #tindernightmares #coronavirus #ponteloponselo #extrafortedía
2231656345623128068; 0; False; 1580254595; Repost from @muslimate_ Semua kejadian di dunia ini pasti ada sebab akibatnya. Virus Corona yang muncul di Wuhan Cina diduga oleh pola makan yang salah. Karena banyak orang di sana memakan yang tak lazim seperti daging kelawar, ular dan lainnya.⁣ ⁣ Beruntung umat Islam yang sudah diajarkan untuk konsumsi makanan yang halal dan baik seperti firman Allah Subhanahu Wa Ta’alaa:⁣ ⁣ Hai sekalian manusia, makanlah yang halal lagi baik dari apa yang terdapat di bumi, dan janganlah kamu mengikuti langkah-langkah setan; karena sesungguhnya setan itu adalah musuh yang nyata bagimu (QS. Al Baqarah ayat 168)⁣ ⁣ Yuk doakan bagi WNI yang berada di Wuhan agar selalu berada dalam lindungan Allah begitu juga saudara Muslim Cina yang tinggal di sana.⁣ Video lengkapnya klik link di bio yaa biar Gak penasaran ⁣ Teruslah bersyukur⁣ Salam @faisal20hanafi . . :warning:follow @kabarakhirzaman :warning:follow @muslimate_ . . #tandaakhirzaman #fitnahdajjal #kiamat #akhirzaman #tandakiamat #fitnahakhirzaman #wuhan #coronavirus #china #corona #wabah
2231659746390578656; 0; False; 1580254594; Watch Dr. Steven Demetropoulos give a #coronavirus update on @wxxv.25 tonight! #improvehealth #savelives #drsteve
2231659581789027745; 1; False; 1580254589; Así lucen las calles en #Wuhan, #China, luego de entrar en cuarentena y haber dispuesto el bloqueo de toda la ciudad. Para más, visita www.metroecuador.com.ec #Coronavirus
2231659684707456320; 1; False; 1580254587; 而家連酒精搓手都炒 我又搵最好既俾你地 美國No.1醫院品牌 我隻兔兔去開間獸醫診所都係用佢 所有搓手啫喱都含70%酒精 唔貴 （但運費貴:grinning_face_with_sweat:又重） 以下係每枝計，包左美國寄黎香港既價錢 順豐到付/就我面交（$150以上） Travel size 30ml $20 Travel size 30ml 連套可掛袋 $25 Travel size 59ml $30 236ml 吱吱裝（原味/蘆薈）$60 354ml 吱吱裝（含精油，比普通更護手）$80 請whatsapp:kissing_face_with_smiling_eyes: link in bio 陸續覆，店主會覆等左最耐既先 DM同留言唔知要輪幾多個鐘先覆到你:folded_hands_medium-light_skin_tone:
2231659493496758823; 0; False; 1580254584; anlık tr kara mizahtan anlayanları içeri alak :backhand_index_pointing_up_light_skin_tone: #mizahtürkiye #mizahkepcesi #mizahbilimi #mizahkar1adam #mizahkar #mizahci #mizahsayfasi #mizah #mizahkomedi #mizahın50tonu #karami̇zah #karamizahşör #karamizahtürkiye #komikvideolar #koronavirüsü #virus #coronavirus
2231659611676741502; 0; False; 1580254578; :eyes::face_with_monocle::thinking_face: :China::United_States: | URGENTE - CORONAVIRUS: La Casa Blanca le comunica a las aerolíneas estadounidenses que vean la probabilidad de suspender sus vuelos entre EEUU y China debido al aumento de pacientes con el virus. ⠀⠀⠀⠀⠀⠀ ⠀⠀⠀ ⠀⠀⠀⠀⠀⠀ ⠀⠀⠀⠀⠀⠀ ⠀⠀⠀⠀⠀⠀ ⠀⠀⠀ ⠀⠀⠀⠀⠀⠀ ⠀⠀⠀⠀⠀⠀ ⠀⠀⠀ ••••••••••••••••••••••••••••••••••••••••••••••••••••••••••••••• ⠀ @doblemoralrd noticias #actualidad #internacional #republicadominicana #view #alerta #novedad #viral #rd #dominicannetflix #doblemoralrd #dominicana #faride #licey #peru #lebron #trump #hanson #Cristiano #toros #pastol #valde #increible #cualquiera #estadosunidos #china #coronavirus #wuhan #wuhanvirus #epidemia
2231659379052882873; 0; False; 1580254570; Dear/ Dei. #coronavirus
2231659465312960614; 1; False; 1580254561; :round_pushpin:Pessoal Dados atualizados sobre o Coronavírus :microbe: no mundo e no Brasil ( isso mesmo, nosso País está com três casos suspeitos), inclusive o ministério da saúde declarou nosso país Como PERIGO IMINENTE. Os pacientes estão isolados e realizaram exames, os resultados saem em média até 72h. Estamos em Nível 2 de Perigo iminente, se confirmar algum caso nosso país passará a Nível 3. Vamos aguardar os resultados e acompanhar as notícias. #coronavirus #saude #atencao #virus #biosseguranca
2231659395033179616; 0; False; 1580254552; Çinli 10 kişilik kafile ve 2 Türk vatandaşının, korona virüsüne karşı tedbir amacıyla kaldırıldığı Aksaray Eğitim ve Araştırma Hastanesindeki kontrollerinin tamamlandığı ve taburcu edildiği öğrenildi. Hastaneden çıkartılan turist kafilesinin İstanbul'a gittiği belirtildi. Öte yandan Bakan Koca, Fethi Sekin Şehir Hastanesinde yaptığı açıklamada, hastalardan alınan ve bugün çıkan örnek numune çalışmasında bir kişiye H1N1 virüsü tanısı konduğunu söylemişti. . . . . . . #turkey #türkiye #corona #korona #virüs #coronavirüs #sondakika #istanbul #bursa #izmir #ankara #hasta #hastalık #virus #coronavirus #haber #haberler #sondakikahaberler #çin #china #wuhan #güncel #güncelhaber #güncelhaberler #coronaviruses #coronaviruese #new #news #sondakikahaberleri
2231659241169679050; 0; False; 1580254541; چین لە کارەکانی بەردەوامە بۆ تەواوکردنی نەخۆشخانەیەکی 1000 قەرەوێڵەیی لە شاری وهان بۆ چارەسەرکردنی تووشبوانی جۆرە نوێـیەکەی ڤایرۆسی کۆرۆنا. #ڤایرۆسی_كۆرۆنا #کۆرۆناڤایرەس #نەخۆشی #چین #ووهان_چین #coronavirus #wuhanvirus #wuhanchina #china:China:
2231659285603932644; 0; False; 1580254539; #confesioneshot #relatossexuales #relatos #confesiones #secret #secretos #incesto #coronavirus #tusa #humornegro #momazos
2231659261629814490; 2; False; 1580254536; Corona viris been in Dago for years. #working #coronavirus #:winking_face:
2231658813056266940; 2; False; 1580254536; Countries with reported #coronavirus infections. . :United_States:United States :France:France :Japan:Japan :South_Korea:South Korea :Taiwan:Taiwan :Singapore:Singapore :Thailand:Thailand :Australia:Australia :Vietnam:Vietnam :Hong_Kong_SAR_China:Hong Kong :Macau_SAR_China:Macau :Malaysia:Malaysia :Canada:Canada :Cambodia:Cambodia :Sri_Lanka:Sri Lanka :Germany:Germany :China:China . Quickly spreading event.
2231659255177727515; 1; False; 1580254536; #coronavirus
2231659218560932824; 0; False; 1580254531; #wuhan #wuhanvirus #wuhancoronavirus #wuhanchina #wuhanpneumonia #wuhan2019 #wuhancity #coronavirus #coronaviruses #coronavirusmemes #coronaviruschina #coronavirusnews #bustarhymes #bustarhymeswooohaaamoment #bustarhymesvoice #woohah
2231659215246881199; 1; False; 1580254531; Santa Catarina NÃO tem casos do novo coronavírus, mas o estado já está preparado para atender e identificar casos suspeitos. ⠀ ATENÇÃO para as medidas de prevenção: :heavy_check_mark: lavar as mãos com água e sabão com frequência :heavy_check_mark: evitar tocar os olhos, nariz e boca com as mãos não lavadas :heavy_check_mark: evitar contato próximo com pessoas doentes :heavy_check_mark: ficar em casa quando estiver doente :heavy_check_mark: cobrir a boca e o nariz ao tossir ou espirrar com um lenço de papel e jogar no lixo :heavy_check_mark: limpar e desinfetar objetos e superfícies tocados com frequência ⠀ RECOMENDAÇÕES: :heavy_check_mark: Evitar viagens à China :heavy_check_mark: Pessoas que viajaram nos últimos 14 dias para China devem ficar atentas a sintomas como febre, tosse e dificuldade para respirar. ⠀ ⠀ Saiba mais: www.dive.sc.gov.br ⠀ #CoronaVirus #Prevencao #SaudeSC #DiveSC #governosc #repostandroid #repostw10
2231659153961356787; 5; False; 1580254523; I am just gonna leave this right here and let you guys think about it. #residentevil #itsclose #getyourskillsready #coronavirusoutbreak #coronavirus
2231658938884873554; 0; False; 1580254518; По сообщениям СМИ, так сейчас выглядят больницы в городе Ухань, где началась вспышка коронавируса. Как же легко люди могут заболеть, стоя в этих очередях.у врачей сдают нервы. #вирускитай#коронавирус#коронавирускитай#симптомыкоронавируса#эпидемиякитай#вводвойсккитай#блокировкагородов#эпидемиякоронавирусакитай#коронавирусшанхай#коронавирусухань#коронавирус2020#вирус2020китай#coronavirus#viruschina#coronaviruschina#coronavirus2020#viruschina#нетуедывкитае#сдаютнервыиззавируса#едынетувухани#пустойгородвирускитай#стройкабольницыухань#вкитаенельзябезмасок#сдаютнервв#уврачейкитаянетусил
2231659106314658359; 0; False; 1580254518; Comerciante de ‘El Hueco’ no está internado en hospital de Medellín ‘con síntomas del #coronavirus’ En un post de Facebook compartido en varias páginas se asegura que un comerciante se encuentra en “estado crítico en el Hospital General de Medellín con los síntomas del coronavirus”, el virus que se originó en Wuhan, China, y que tienen a varias ciudades del mundo en alerta. Sin embargo, en Colombiacheck confirmamos con @alcaldiademed y la Secretaría de Salud de Medellín, quienes nos ratificaron que se trataba de una información falsa. :backhand_index_pointing_right_medium-dark_skin_tone: Visite colombiacheck.com donde encontrará este y muchos más chequeos . . . . #NoComaCuento #Desinformación #Colombiacheck #NoticiasFalsas #NoticiasColombia #FakeNews
2231659104896293280; 1; False; 1580254518; #coronavirus
2231659092380961887; 0; False; 1580254516; :eyes: >> Atentos con el #Coronavirus de Wuhan (#China) :face_with_medical_mask::globe_showing_Europe-Africa: - Si no has estado "al tanto" de lo ocurrido en la última semana, estos son los datos más recientes, cortesía de @pictoline :right_arrow_curving_down:
2231659086381199720; 0; False; 1580254515; Have any friends or family members who need heath attention ? I am here to help the innocent life’s front this Bio-Weapon. And I am not against any government or tend to cure anyone myself, just for health wellness I will help people get the help they need. #coronavirus #coronaviruses #virus #disease #germ #pathogen #parasites #rabies #corona #viruses #help #china #usa #bioweapon #electric #cure
2231658995702363954; 0; False; 1580254505; Keep your immune system strong :flexed_biceps: is the main goal for this winter!!! Tue flu rate is high and multiple viruses attacking our body 24/7. It's time to ask nature to share her tricks and try out some powerful disease fighters like Grapefruit Seed Extract (GSE) and propolis. Stop by @forcesofnaturebrooklyn and talk to our consultants if they can help you boost your immune system. _______________________________________________________ #brooklyn #forcesofnature #healthstore #vegan #glutenfree #community #health #healthy #crueltyfree #natural #nyc #organic #propolis #gse #immunesupport #immunesystem #coronavirus
2231658977851038021; 1; False; 1580254502; What we know.. Follow the link in our bio to see our recommendations!! Coronavirus group contains many different individual viruses. Some of these strains can be quite mild, But others cause much more intense symptoms like the ones we have seen all over the news. These diseases affect the human respiratory system, causing fever & Pneumonia-like symptoms that make it very difficult to breathe. These strains can also affect the gut causing diarrhea. Because this virus has a 2-weekish long incubation period it can spread quite easily without detection. Developing a vaccine for the coronavirus would not be useful because the virus mutates quickly and responds to changing environments. For this reason herbal and plant-based remedies may have an edge over pharmaceuticals due to the plant’s synergistic complex nature. Herbs that have traditionally been used as comfort measures against influenza (the flu) will be most effective against the coronavirus, because they are both viral and take the same pathways in the bodies. To strengthen the immune system and fight viruses take at the very start or onset of symptoms to work most efficiently. Another important reminder is that up to 90% of your immune system is located within your gut lining so making digestive health a priority including gut nourishing foods like bone both and a broad spectrum probiotic is a MUST for antiviral benefits. #antiviral #immune #flu #coronavirus #supplements #healthylifestyle #wellness
2231567319205999913; 2; False; 1580254497; Repost from @Austin360Radio: @Jb won’t let me redo this video even though my gum looks like an extra tooth. :face_with_symbols_on_mouth: Tune in today to get the scoop on things like the #coronavirus and the #zebramussels , yeah those are coming back. Get the app Austin 360 Radio or turn up the radio at statesman.com @statesman or Austin360.com @austin360 or hookem.com!! #austintexas #austin #keepaustinweird #stayinalive #austinnews #localstories @glamerdoc @whitney_stropp
2231658569694961366; 0; False; 1580254494; Reposted from @cordova.media Seorang pejabat Kemenlu China, bernama Lijian Zhao memposting di akun twitternya, video pembangunan rumah sakit yang dibangun untuk pasien yang terjangkit virus Corona. Rumah sakit yang dibangun selama 16 jam ini, berbentuk box dilengkapi dengan teralis besi di jendelanya dan dan kunci yang diletakkan di pintu bagian luar.⁣ ⁣ Di postingan tersebut, ia juga menuliskan, "Let's pray for Wuhan & China", mari berdo'a untuk Wuhan dan China. Sudah jamak diketahui bahwasanya pemerintah China dari Partai Komunis China menganut paham atheisme. Namun dalam kondisi darurat seperti ini, salah satu anggotanya mengajak berdo'a untuk Wuhan dan China yang saat ini dilanda wabah virus Corona. Sudah menjadi fitrahnya, manusia bahkan ateis sekalipun, ketika dalam kesulitan, membutuhkan pertolongan dari Tuhan Yang Maha Kuasa.⁣ ⁣ "Dan dia dibantah oleh kaumnya. Dia berkata: 'Apakah kamu hendak membantah tentang Allah, padahal sesungguhnya Allah telah memberi petunjuk kepadaku'. Dan aku tidak takut kepada [malapetaka dari] sembahan-sembahan yang kamu persekutukan dengan Allah, kecuali di kala Tuhanku menghendaki sesuatu [dari malapetaka] itu. Pengetahuan Tuhanku meliputi segala sesuatu. Maka apakah kamu tidak dapat mengambil pelajaran [daripadanya]?" [QS. Al-An'am: 151].⁣ ⁣ "Dan sesungguhnya Kami jadikan untuk [isi neraka Jahannam] kebanyakan dari jin dan manusia, mereka mempunyai hati, tetapi tidak dipergunakannya untuk memahami [ayat-ayat Allah] dan mereka mempunyai mata [tetapi] tidak dipergunakannya untuk melihat [tanda-tanda kekuasaan Allah], dan mereka mempunyai telinga [tetapi] tidak dipergunakannya untuk mendengar [ayat-ayat Allah]. Mereka itu sebagai binatang ternak, bahkan mereka lebih sesat lagi. Mereka itulah orang-orang yang lalai" [QS. Al-A'raf: 179] . Revisi: di video tertulis 16 hari, yang benar adalah 16 jam sebagaimana yang tertulis di postingan Twitter tersebut. ⁣ #coronavirus #viruscorona #wuhan #china #ccp #xijinping - #regrann
2231658836678623213; 0; False; 1580254486; One more summer here. Have to leave the state before the rest of my friends do. #beerrucks #coronavirus
2231658827711096027; 1; False; 1580254485; :nerd_face:Síguenos @don_tesla para más humor científico de ingeniero o intelectual:smiling_face_with_sunglasses: . . . . . . . . . #meme #memes #tesla #engeneering #engineering #instahumor #física #fisica #quimica #química #biologia #estudiantes #estudiante #universidad #ingeniero #ingenieros #math #mathmemes #sciencememes #science #science #university #momo #momos #physics #biología #coronavirus
2231658717332844646; 0; False; 1580254482; - Chinese president Xi Jinping tells the @who General Director that he “personally directed and personally deployed” the country’s battle against ‪the coronavirus.‬⁣ ⁣ ‪ #WuhanSARS #WuhanOutbreak #CCPChina #chinazi #SARS2020 #武漢肺炎 #武汉疫情 #ChinaVirus #CoronavirusOutbreak at #Wuhan #china #武漢疫情 #冠狀病毒 #武漢肺炎 #新型肺炎 #新型コロナウィルス #武漢 #武漢市新型冠狀病毒肺炎 #武漢市 #chinanews #becausechina #faceofchina #massmigration #springfestival #coronavirus #WuhanCoronavirus #WuhanPneumonia #wuhanvirus
2231658690532693549; 1; False; 1580254468; I want pizza
2231658380413712065; 0; False; 1580254467; Sígueme para mas memes:face_with_tears_of_joy: : : : : #memesgraciosos #idioteces #tonterias #coronavirus #estupideces #alv #memesenespañol #memesrandom #random #re100hornea2 #jajajaja #momasos #momasosprro #momasosespañol #tiktok #momasos4people #memes
2231658082054983437; 0; False; 1580254467; Oh wow ok let’s hope this isn’t offensive to Asians :face_with_hand_over_mouth: But not all Asians have it so #coronavirus
2231658008746793628; 0; False; 1580254465; #corona #virus #coronavirus #foryou
2231658640711136239; 0; False; 1580254462; May Contain Traces of #coronavirus ᴅᴏᴜʙʟᴇ ᴛᴀᴘ :heart_suit: [HASHTAGS] #meme #memes #memez #dank #dankmemes #superdank #spicymemes #darkmemes #litmemes #memesupreme #edgymemes #offensivememes #dankdank #dankmemesmakedankdreams #dankmemesmeltsteelbeams #dankmemescanmeltsteelbeams #dankmemescantmeltsteelbeams #jetfuelcanmeltsteelbeams #jetfuelcantmeltsteelbeams #rocketfuelcantmeltdankmemes #coronavirusmemes #coronavirusoutbreak
2231658636912657333; 0; False; 1580254462; #Transparência | Reunimos aqui as principais dúvidas sobre o novo #coronavírus, para você entender o cenário atual. Até o momento, não há casos suspeitos no Brasil. Mas estamos estamos vigilantes e preparados! :Brazil: O Ministério da Saúde instalou o Comitê de Operações de Emergência (COE) e está monitorando a situação, junto à Organização Mundial da Saúde. Além disso, a rede de saúde está sendo preparada para responder com segurança e agilidade diante de um caso suspeito. Acompanhe as atualizações sobre o #coronavírus no Portal Saúde saude.gov.br #socorrosp #socorrospoficial #coronavirus
2231658609582024229; 1; False; 1580254459; Por enquanto apenas casos suspeitos! #infectologistablumenau #infectologia #coronavirus #blumenau
2231658604950537011; 0; False; 1580254458; "Ya Allah, aku berlindung kepadaMu dari penyakit belang, gila, kusta dan dari lain penyakit yang buruk / mengerikan lainnya." . Many of our children are back in school today. May they be under Allah's protection. . . Our dua's are with them :two_hearts: . #coronavirus
2231658608347779550; 5; False; 1580254458; Debo admitir que extraño mi patria Y lo que me duele mas, es no poder estar con ustedes luchando! :raised_fist: Se que no pararán hasta vencer es ahora o nunca! Aguante los que luchan y si el #coronavirus lo quiere:sad_but_relieved_face: , nos vemos pronto bastardos:red_heart::raised_fist: . . . . . . . . . . #newyorkcity #timessquarenyc #timessquare #nyc #eeuu #usa #manhattan #travel #jordan #ny #newyork #f4f #followforfollowback #follow4like #siguemeytesigo #likeforfollow #followmeplease #followme #colocolo #garrablanca #instanyc #eeuu #nuevayork #nets #nba #follow
2231657519911322188; 0; False; 1580254454; :skull: • •follow @n0_.melody for more • • • • • • • • • #funny #explore #china #coronavirus #memes #3partymemes #offensivememes
2231658444931577224; 3; False; 1580254439; Si te gustan los Remedios CASEROS, Trucos de BELLEZA y mas, síguenos:backhand_index_pointing_right_medium-light_skin_tone: @lomejorensalud_ No olvides dejarnos un saludo para saber que te llegan mis Consejos. @lomejorensalud_ :backhand_index_pointing_left:
2231658427255266914; 0; False; 1580254437; Pagiku adalah awal bucinku :slightly_smiling_face: . #briankrisna . . . . #gariswaktu #fiersabesari #tereliyequote #briankrisna #sejenak #senja #kopi #rain #rainbow #qoetes #sajak #sejenakmerindu #jimbon #corona #anaksenja #viral #tereliye #coronavirus #dilan #milea
2231658132430360944; 2; False; 1580254436; 1달 전에는 이렇게 좋았는데 #코로나바이러스 로 망치기 있음?!ㅠㅠ 브금 #fever #사랑의트위스트 #bluedrag #flymetothemoon 상해를 갔으면 상하이 트위스트는 춰줘야지 ㅋㅋㅋ 원본은 유튜브에 ㅋ #상해 #여행에미치다 #여행일기 #shanghai #travelmovie #coronavirus
2231658395855841149; 1; False; 1580254433; Resumo sobre novo coronavírus, após declaração das principais autoridades de saúde do país. . Fontes: Anvisa, MS e SBI. . . #coronavirus #2019nCoV #farmacia #farmaceutico #allfarma #all_farma #anvisa #infectologia #pandemia
2231658386772324243; 0; False; 1580254432; BOM DIA!!! Nesta quarta (29/01) em seu Jornal do Agronegócio Vlamir Brandalizze nesta quarta feira comenta sobre os principais mercados do agronegócio. Coronavirus influencia mercado de commodities SOJA no Brasil com mercado calmo. MILHO em ritmo lento no Brasil. ARROZ nas gôndolas começa tendência de alta. CARNES apesar da redução dos valores neste início de ano há possibilidade de aumento. Exportações podem bater recorde para o mês de janeiro. FEIJÃO já começa a reagir e cotações tendem a subir, principalmente por conta da oferta limitada. Brandalizze também comenta sobre os acordos assinados entre Brasil e Índia Paracatu Rural ao vivo 7:45h :ear_medium-light_skin_tone:Ouça pela rádio :radio: Boa Vista FM 96,5Mhz Ouça pelo smartphone :play_button: http://bit.ly/boavistafm Ou pelo smartphone/computador :play_button: http://www.ParacatuRural.com Apoio: @SicoobCredigerais @SouMasterNet @PaulaNaturaPtu #paracatu #paracaturural #brasilnaindia #bolsonaro #terezacristina #soja #milho #arroz #feijão #trigo #carnes #boi #suinos #aves #analisedemercado #mercadoagropecuario #mercadodasoja #mercadodomilho #coronavirus
2231653102234953978; 0; False; 1580254431; USO CORRECTO MASCARILLA BOZALES o CUBRE BOCAS (1era parte). La información debe llegar a todos. . Un lado de color a prueba de agua y un lado blanco absorvente. . La orientación precisa y de primera mano es la que será útil eficiente y salva vidas. . En breve compartiré el vídeo completo vía enlace YouTube. . . #Mascarillas #bozales #Coronavirus #coronaviruschina #Coronaviruswhan #Viruscorona #Orientacionmedica #prevencion #riesgo #Republicadominicana #EEUU #china
2231658245381410322; 0; False; 1580254415; Hold up! ᴅᴏᴜʙʟᴇ ᴛᴀᴘ :heart_suit: [HASHTAGS] #meme #memes #memez #dank #dankmemes #superdank #spicymemes #darkmemes #litmemes #memesupreme #edgymemes #offensivememes #dankdank #dankmemesmakedankdreams #dankmemesmeltsteelbeams #dankmemescanmeltsteelbeams #dankmemescantmeltsteelbeams #jetfuelcanmeltsteelbeams #jetfuelcantmeltsteelbeams #rocketfuelcantmeltdankmemes #coronavirus #coronavirusoutbreak #coronavirusmemes
2231658243191561866; 1; False; 1580254415; Ada yg tau kah ini apa . . . . . . . . . . . . . . . . #roko #rokon #asaprocky #mantapersonalizada #coronavirus #obatviruscorona #virushka #corona #obatala
2231647508366740558; 0; False; 1580254397; :eyes::face_with_monocle::thinking_face: Investigadores de Hong Kong (China) advierten que el nuevo #coronavirus está a punto de convertirse en una epidemia global y estiman que unas 44.000 personas estarían infectadas con ese microorganismo, muchas más de las que sugieren las cifras oficiales hasta el momento. Fuente;actualidadrt ⠀⠀⠀⠀⠀ ⠀⠀⠀ ⠀⠀⠀⠀⠀⠀ ⠀⠀⠀⠀⠀⠀ ⠀⠀⠀⠀⠀⠀ ⠀⠀⠀ ⠀⠀⠀⠀⠀⠀ ⠀⠀⠀ ⠀⠀⠀⠀⠀⠀ ⠀⠀⠀⠀⠀⠀ ⠀⠀⠀⠀⠀⠀ ⠀⠀⠀ ⠀⠀⠀⠀⠀⠀ ⠀⠀⠀⠀⠀⠀ ⠀⠀⠀ ••••••••••••••••••••••••••••••••••••••••••••••••••••••••••••••• ⠀ @doblemoralrd noticias #actualidad #internacional #republicadominicana #view #alerta #novedad #viral #rd #dominicannetflix #doblemoralrd #dominicana #jamaica #japon #jamaica #japon #franklinmirabal #licey #cuba #haiti #toros #faride #miami #angelestevez #hanley #bonilla #ericfilia #china #wuhan #epidemia #pujeazul #seriefinallidom2020 #coronavirus.
2231658094142731808; 0; False; 1580254397; DESCARTADO CASO DE CORONAVIRUS EN BOGOTÁ Ministerio de salud descartó caso de coronavirus en la Clínica Méderi. El Ministerio de salud descartó un caso de coronavirus presentado en la Clínica Méderi en Bogotá, el paciente procedente de Barcelona, España, fue examinado por presentar síntomas similares al virus, sin embargo, tuvo un resultado negativo. De acuerdo con la clínica, el paciente manifestó algunos problemas de salud que llevaron a cabo la sospecha, pero, en centro médico indicó que “no cumple con los requisitos establecidos por las autoridades de salud para considerarlo un caso sospechoso”. Según el ministro encargado de salud, Iván Darío González, para evitar prender las alarmas de la llegada del virus al país se “deben de existir unos protocolos especiales que se deben cumplir para establecer que será objeto de estudio”. “Se cruzan antecedentes de viajes a Wuhan, China, con signos respiratorios para determinar en qué estado se encuentran los casos. Este virus es tan nuevo que en el mundo existen muy pocos países que corren pruebas específicas”, agregó el Ministro. #País .#Coronavirus #Bogotá #Periodicoeljurista Foto por: Publimetro.co visitanos en: www.periodicoeljurista.com.co
2231658074514242239; 0; False; 1580254395; :police_car_light: El número de muertos por el coronavirus se dispara a 131 y 5,484 infectados en China. . . . #A24Py #coronavirus
2231658022925980412; 1; False; 1580254389; #Repost @a_lallie_2 • • • • • • Thought I’d write a post about the new deadly #Coronavirus and other viruses like it. _ Interestingly the origin is bats :bat: but the cause is human ignorance, cruelty and greed, which is evident from this picture of a market selling bats for human consumption, which is common in countries like China, Vietnam, Indonesia and others. _ SARS (severe acute respiratory syndrome) originated in China in 2002 and killed hundreds of people. A strain of the coronavirus usually found in bats spread to civet cats and then mutated and spread to humans who were slaughtering and consuming the illegally trafficked civet cats at cruel live animal markets in the Guangdong province of China. _ MERS (Middle East Respiratory Syndrome) is another coronavirus, which has been found in bats in Saudi Arabia. It spread to camels and then passed to humans. Note that camels are slaughtered and consumed by humans largely during Eid celebrations. _ Interestingly Ebola is also believed to have originated in bats. Leading scientists claim that the virus spread to gorillas (through them eating persimmon fruits that the bats had been in contact with) and poachers then killed the gorillas and sold the bushmeat, which was consumed by humans. _ Now this new coronavirus, which has already killed over 80 people and infected thousands also originated in bats, which were being sold at the Wuhan live animal market in China, which spread to snakes that were being sold there for human consumption, which has now mutated and passed to humans. _ Conclusion - yes these live animal markets in China and other countries need to go as they’re cruel, they’re key drivers of the illegal wildlife trade and the keeping of so many wild animals in close proximity and unsanitary conditions creates a hotbed for facilitating the spread of deadly diseases but in light of all of these epidemics, which includes those caused by the farming of ‘livestock’ animals i.e. Swine Flu and Bird Flu, I feel that we must all ask ourselves a question here - is it worth us consuming animals AT ALL? #FoodForThought _ Caption @a_lallie_2 #a_lallie_2 Pic @paulhiltonphoto :copyright:
2231657997262972255; 3; False; 1580254386; dinner :smiling_face_with_heart-eyes::red_heart: #coronavirus #streamcoronavirusforclearskin
2231657998471062642; 3; False; 1580254386; Dois pacientes com suspeitas de coronavírus estão internados em Curitiba (PR) e Porto Alegre (RS), de acordo com informações obtidas pelo Correio com uma fonte do governo. Ambos apresentam sintomas da doença e estiveram recentemente na China. Os casos estão sendo acompanhados de perto pelas autoridades. . . . . . #coronavirus #brasil #china #mundo #web #noticias #famosos #sos #carnaval #2020
2231658002960472763; 0; False; 1580254386; Okay, now I'm ready to leave the house. Honestly, you can't be too cautious these day. #coronavirus #paranoidlyfe #dontbreathonme
2231657567925327697; 0; False; 1580254386; #coronavirus olha a situação na China está seria!!! FIM DOS TEMPOS!!
2231657548430558745; 0; False; 1580254378; Reposted from @cordova.media Seorang pejabat Kemenlu China, bernama Lijian Zhao memposting di akun twitternya, video pembangunan rumah sakit yang dibangun untuk pasien yang terjangkit virus Corona. Rumah sakit yang dibangun selama 16 jam ini, berbentuk box dilengkapi dengan teralis besi di jendelanya dan dan kunci yang diletakkan di pintu bagian luar.⁣ ⁣ Di postingan tersebut, ia juga menuliskan, "Let's pray for Wuhan & China", mari berdo'a untuk Wuhan dan China. Sudah jamak diketahui bahwasanya pemerintah China dari Partai Komunis China menganut paham atheisme. Namun dalam kondisi darurat seperti ini, salah satu anggotanya mengajak berdo'a untuk Wuhan dan China yang saat ini dilanda wabah virus Corona. Sudah menjadi fitrahnya, manusia bahkan ateis sekalipun, ketika dalam kesulitan, membutuhkan pertolongan dari Tuhan Yang Maha Kuasa.⁣ ⁣ "Dan dia dibantah oleh kaumnya. Dia berkata: 'Apakah kamu hendak membantah tentang Allah, padahal sesungguhnya Allah telah memberi petunjuk kepadaku'. Dan aku tidak takut kepada [malapetaka dari] sembahan-sembahan yang kamu persekutukan dengan Allah, kecuali di kala Tuhanku menghendaki sesuatu [dari malapetaka] itu. Pengetahuan Tuhanku meliputi segala sesuatu. Maka apakah kamu tidak dapat mengambil pelajaran [daripadanya]?" [QS. Al-An'am: 151].⁣ ⁣ "Dan sesungguhnya Kami jadikan untuk [isi neraka Jahannam] kebanyakan dari jin dan manusia, mereka mempunyai hati, tetapi tidak dipergunakannya untuk memahami [ayat-ayat Allah] dan mereka mempunyai mata [tetapi] tidak dipergunakannya untuk melihat [tanda-tanda kekuasaan Allah], dan mereka mempunyai telinga [tetapi] tidak dipergunakannya untuk mendengar [ayat-ayat Allah]. Mereka itu sebagai binatang ternak, bahkan mereka lebih sesat lagi. Mereka itulah orang-orang yang lalai" [QS. Al-A'raf: 179] . Revisi: di video tertulis 16 hari, yang benar adalah 16 jam sebagaimana yang tertulis di postingan Twitter tersebut. ⁣ #coronavirus #viruscorona #wuhan #china #ccp #xijinping - #regrann
2231657930776612822; 0; False; 1580254378; Coronaviruses are types of viruses that typically affect the respiratory tract of mammals, including humans. They are associated with the common cold, pneumonia, and severe acute respiratory syndrome (SARS) and can also affect the gut. #coronavirus #boostimmunesystem #immunesupport #cold #flu #viruses #prevention #preventionisbetterthancure
2231657932354199960; 0; False; 1580254378; El Coronavirus y los valientes soldados. . #coronavirus #comic
2231657923703333017; 4; False; 1580254377; Friends saying Happy New Year from #Nanjing. Hope the #wuhanvirus will be under control soon. If you’d like to donate masks and other essential medical equipments to help fight the virus, check out 4PX Worldwide Express’s Chinese website, they have just announced that they’d ship the donated goods to #wuhan for free. #prayforwuhan #prayforchina * * * * * #chinathroughphotos #writerslife #china:China: #wuhan #coronavirus #chinatravel #chinatrip #donation #charity #helpingothers
2231657879419650071; 0; False; 1580254372; AUD USD Sellers look exhausted which means It is buying time. However be aware, the sellers can still take early buyers. If an early trade is executed beware of risk management. Daily chart Interested in more knowledge? Free telegram @lupacapitalfree DM :books: for performance management and stock services, forex course. #accettalasfida #lupacapital #forex #forexdiary #trader #analyst #markets #financialfreedom #dollar #stockmarket #futurestrader #currencies #aussiedollar #coronavirus #buyers #pips #profit
2231657860503214800; 0; False; 1580254369; Message from Dr. Cícero Coimbra about the coronavirus, with English subtitles (Please type the video title to find it on YouTube, and make sure to turn on CC for subtitles). - :sun:https://m.youtube.com/watch?v=TT1zMF76y1c - #coronavirus #coronaviruses #virus #coimbraprotocol #multiplesclerosis #vitamind #coimbraprotokoll #vitamind3 #highdosevitamind #highdosesofvitamind #multiplesclerosis #multiplesklerose #mswalk #mscure #msawareness #multiplesclerosisandvitamind #bookmultiplesclerosisandlotsofvitamind #bookmultiplesclerosisandlotsofvitamind #autoimmunity #autoimmunedisease #autoimmuneprotocol #drcicerocoimbra #intelligentmedicine
2231657853767848280; 0; False; 1580254368; ¿Cuál es el origen de estos casos del Nuevo Coronavirus, 2019-nCoV ? #Antecedentes. En España se ha establecido que los centros Sanitarios pueden recoger muestras de pacientes con sospecha siempre que cumplan unos requisitos clínicos y epidemiológicos, y es el Servicio de Microbiologia de cada Hospital quien deberá enviarlas al Centro Nacional de Microbiología (CNM) (Majadahonda, Madrid), que será el encargado del análisis. #Coronavirus
2231657766887867211; 0; False; 1580254358; CORONAVIRUS. :face_with_medical_mask: What is the coronavirus? • Coronavirus is a large family of viruses that cause illnesses ranging from a common cold, to more severe diseases. Some transmits between animals, some between animals and people, others from people to people. Symptoms are very similar to a basic cold. :face_with_thermometer: ■ Runny nose ■ Headache ■ Cough ■ Sore throat ■ Fever ■ Generally feeling unwell. The CDA - Canadian dental association would like all health care providers to remind there patients that if they are feeling unwell, or have any of the symptoms stated above :up_arrow: to let your health care provider know. If you have an upcoming appointment with us, please let us know if you have/ or been around anyone that has travelled outside Canada within the last 21 days. You may also be asked some questions when we are reminding you of your upcoming visits. The CDA has sent us a letter to screen our patients, we want to do our best to protect you! Our office has provided hand sanitizer when you arrive! #health #CDA #dentist #caring #coronavirus #prevention #barrie #barriedentist #cold #flu
2231657088267116740; 0; False; 1580254352; More details to come on immune support and natural virus protection #coronavirus #immunesupport #wellnesswisdom #traditionalmedicine #holisticnutrition
2231657675142332978; 0; False; 1580254347; . ~Likes seafood:crab: ~Travel to asian countries:China: ~Fan of the early 2000s:woman_scientist: #ncov2019#nCoV#2019#короновирус#хуманизация#humanization#art#coronavirus#art#anime#picture#illustration#disease#china#рисунок#арт#medibangpaint#medibang
2231657635019357466; 0; False; 1580254342; UTSUKUSHHII 2 tahun lebih company berjuang dapetin ijin BPOM utk produk yg satu ini. Proudly present : UTSUKUSHHII BPOM RI ML 867031004482 Dengan kandungan 8 bahan aktif yang sangat powerful & bermanfaat : - Salmon DNA - Fish Collagen - L-Glutathione - Takara Kombu seaweed Extract - Lactic Acid Bacteria (FK-23) - Kiwi Seed Exract - Resevatrol (Grape Skin Extract) - Pineapple Extract Memiliki 3 patent: - Mengecilkan tumor - Mencegah kanker usus - Melawan Hepatitis C Utsukushhii akan membantu memancarkan kecantikan Anda dari dalam dengan: 1. Memberikan nutrisi yg dibutuhkan oleh kulit. Kandungan Salmon DNA dapat meningkatkan elastisitas kulit & produksi hyaluronic acid pada kulit Anda. 2. Membersihkan usus. Kemampuan Lactic Acid Bacteri, yg mengandung 1 trilyun bakteri baik, akan menyeimbangkan jumlah bakteri baik dalam usus Anda, sehingga usus terhindar dari bakteri buruk dan kesehatan Anda akan meningkat. 3. Menghilangkan racun pada usus Anda, bahkan mencegah tumor untuk dapat berkembang, terutama tumor jahat yg dapat berubah menjadi kanker. KECANTIKAN berawal dari USUS yang sehat. KECANTIKAN dan KESEHATAN usus berawal dari UTSUKUSHHII. UTSUKUSHHII merupakan produk dari AFC JAPAN. AFC adalah perusahaan FARMASI tertua & terbesar di Japan dari 1969, satu2nya perusahaan farmasi yg sudah GO PUBLIC di Japan. Menghasilkan lebih dari 100.000 produk dan merupakan produsen suplemen TERBAIK nomor 4 di Japan. AFC : NO COMPROMISE FOR QUALITY WA:082293540411 #UTSUKUSHHII #madeinJapan #Japanstandardquality #kulitdanusus #SOP100 #coronavirus #viruscorona #kekebalantubuh #semaranghits #kanker #kankerpayudara #kankerusus #infokesehatan #tumor
2231657161323524789; 0; False; 1580254337; Film: Joker Şarkı: Dinah Shore - Laughing on the outside , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , ,#corona #iamsomerhalder #thevampirediaries #thevampirediariesedit #lyrics #şarkıedit #şarkı #youtube #lyricsedits #a #beautifuldestinations #americanbully #country #korona #corona #coronavirus #china #purple #makeupartist #orphanblack #healthyfood #joker #billieeilish #fuck #shameless #joaquinphoenix
2231657582471485363; 0; False; 1580254336; #SavageMemes #Memes #MemesDaily #DankMemes #MemeLord #DailyMemes #DankMemesDaily #CoronaVirus #China #Wuhan #Chinese #Oops #Savage #RunnersOfInstagram #RunForrestRun
2231657529623379348; 4; False; 1580254330; China rencananya akan menulis ulang isi terjemahan Alkitab dan Al-Quran. Upaya itu digadang-gadang demi mencerminkan nilai nasionalis di tengah isu Uighur, yang menuduh pemerintah negara tersebut telah melakukan tindakan keras.⠀ ⠀ Kitab suci keluaran baru nanti, tidak akan mengandung konten apapun yang berlawanan dengan keyakinan Partai Komunis, menurut pihak berwenang dari partai berkuasa di China⠀ ⠀ Paragraf yang dianggap salah oleh badan sensor akan diubah atau diterjemahkan kembali.⠀ ⠀ walaupun Alkitab dan Al-Qur'an tidak disebutkan secara spesifik, partai tersebut menyebutkan "evaluasi komprehensif klasik agama yang bertujuan pada konten tak sesuai dengan perkembangan zaman."⠀ ⠀ Mandat itu diberikan pada bulan November selama pertemuan yang diadakan oleh Komite Urusan Etnis dan Agama Komite Nasional Konferensi Konsultatif Politik Rakyat China, yang mengawasi masalah etnis dan agama di Tiongkok.⠀ ⠀ Enam belas pakar, pemegang kepercayaan dan perwakilan masing-masing agama yang berbeda dari Komite Sentral Partai Komunis China menghadiri konferensi bulan lalu, menurut Kantor Berita Xinhua.⠀ ⠀ Pertemuan tersebut diawasi oleh Wang Yang, Ketua Konferensi Konsultatif Politik Rakyat China.⠀ ⠀ Wang menekankan bahwa otoritas agama harus mengikuti instruksi Presiden Xi dan menafsirkan ideologi agama yang berbeda sesuai dengan 'nilai-nilai inti Sosialisme' dan 'persyaratan era', surat kabar Prancis Le Figaro melaporkan. sumber Liputan 6⠀ ⠀ ⠀ ___________________________________________⠀ Cari Sepatu TNI POLRI Kulit Sapi Asli ?⠀ ___________________________________________⠀ ⠀ Follow @army86_id⠀ Follow @army86_id⠀ Follow @army86_id⠀ dapatkan update produk sepatu terbaru⠀ .⠀ .⠀ #beritamiliter #abdinegara #prajuritindonesia #uighur #militerindonesia #tniganteng #tnial #tniad #tniau #tnibersamarakyat #tentaranasionalindonesia #tentara_militer #prajurittni #prajuritkomando #prajuritmuda #china #abdinegaraindonesia #abdinegaracouple #angkatandarat #tniupdate #wuhan #tentaraindoesia #calontentara #islamupdate #corona #viruscorona #beritamiliter #infomiliter #galerimiliter #coronavirus
2231657450914582522; 0; False; 1580254320; Todo lo que tienes que saber sobre el CORONAVIRUS :raising_hands_light_skin_tone: ⠀⠀⠀⠀⠀⠀⠀⠀⠀ Estas son las recomendaciones del OMS: ⠀⠀⠀⠀⠀⠀⠀⠀⠀ :right_arrow:Evitar el contacto directo con personas que padezcan infecciones respiratorias agudas; :right_arrow:Lavarse las manos frecuentemente, especialmente después del contacto directo con personas enfermas o su entorno; :right_arrow:Evitar el contacto sin protección con animales de granja o salvajes; :right_arrow:Las personas con síntomas de una infección respiratoria aguda deberían tomar las siguientes precauciones: mantener cierta distancia con los demás, cubrirse la nariz y la boca con pañuelos desechables. ⠀⠀⠀⠀⠀⠀⠀⠀⠀ Estén atentos a las actualizaciones de la OMS :exclamation_mark: ⠀⠀⠀⠀⠀⠀⠀⠀⠀ #coronavirus #oms #virus #cruzroja
2231657425119628334; 0; False; 1580254317; Toplam onaylanan 5500 vaka bildirildi ve ölü sayısındaki son resmi rakam 131 olarak belirlendi. . . . . . #turkey #türkiye #corona #korona #virüs #coronavirüs #sondakika #istanbul #bursa #izmir #ankara #hasta #hastalık #virus #coronavirus #haber #haberler #sondakikahaberler #çin #china #wuhan #güncel #güncelhaber #güncelhaberler #coronaviruses #coronaviruese #new #news #sondakikahaberleri
2231657385684239124; 0; False; 1580254313; Yoo u cant do that :face_with_tears_of_joy::face_with_tears_of_joy::face_with_tears_of_joy::face_with_tears_of_joy::face_with_tears_of_joy: #meme #dankmemes #coronavirus
2231657263519773776; 0; False; 1580254311; El Dr. Pedro Luis Castellanos dijo que el Coronavirus aún no ha llegado al país Pedro Luis Castellanos El Dr. Pedro Luis Castellanos Coronavirus aún no ha llegado al país y aunque las posibilidades de que este llegue a suelo dominicano son bajas, el área de salud se está capacitando y preparando áreas restringidas. #Coronavirus
2231657351744490306; 0; False; 1580254309; For facts about the #coronavirus check industry sites like InfectionControl.Tips (TIPS) or the CDC. These photos are sourced from the TIPS website. TIPS notes that symptoms vary in severity but generally include fever, difficulty breathing, impaired liver and kidney functions, severe cough, and pneumonia.
2231657350014784037; 0; False; 1580254308; Fisioterapiaresp#fisiorespiratoria #fisioterapiaguarulhos #coronavirus #reabilitacaopulmonar #fisiomonicaferreira
2231657350023689071; 4; False; 1580254308; #Caribbean, #Disney #Epcot and #Vegas tour finished. A lot has happened since I left. Can't wait to go home in the #hawaiianislands . Go away #coronavirus and take the other viruses with you #walfridogtour
2231657309112999467; 0; False; 1580254304; Minas, Rio Grande do Sul e Paraná têm 3 casos suspeitos monitorados de coronavírus ⠀ https://www.todabahia.com.br/minas-rio-grande-do-sul-e-parana-tem-3-casos-suspeitos-monitorados-de-coronavirus/ ⠀ Foto: Marcelo Camargo/Agência Brasil ⠀ Acesse www.todabahia.com.br e saiba mais. ⠀ #coronavirus #casossuspeitos #monitorados
2231657223080089692; 0; False; 1580254293; :skull:#coron #corona:beer_mug: #coronavirus #coronavirusmemes #coronavirusoutbreak #coronaviruschina #wuhanvirus
2231657190633450363; 0; False; 1580254289; No videos today sorry #firememes #funnymemes #follow4follow #hilariousmemes #dankmemes #likeforlikes #coronavirus #dailymemes
2231657137539789611; 0; False; 1580254283; "Ya Allah, aku berlindung kepadaMu dari penyakit belang, gila, kusta dan dari lain penyakit yang buruk / mengerikan lainnya." . Many of our children are back in school today. May they be under Allah's protection. . . Our dua's are with them :two_hearts: . #coronavirus
2231657135703721776; 1; False; 1580254283; Es que es muy mala la i wn ohhh . . . . . . . . #anfp #futbol #futbolchileno #universidaddechile #udechile #clubdeportivouniversidaddechile #fome #dank #malos #gol #goleada #coronavirus #pandemia #plaga #colocolo #albo
2231657134310698397; 0; False; 1580254283; Keep your kids at home stay away be clean eat fully cooked meals just don’t eat no bs wtf why bring that shit to spread it makes no sense 2020 ain’t it :hot_face::loudly_crying_face::loudly_crying_face::loudly_crying_face::loudly_crying_face::loudly_crying_face::loudly_crying_face::face_with_symbols_on_mouth::face_with_symbols_on_mouth::face_with_symbols_on_mouth::face_with_symbols_on_mouth::face_with_symbols_on_mouth::face_with_symbols_on_mouth::face_with_symbols_on_mouth::face_with_symbols_on_mouth::face_with_symbols_on_mouth::face_with_symbols_on_mouth::face_with_symbols_on_mouth: #coronavirus #sanbernardino #danger
2231657131123599892; 4; False; 1580254282; @eddiebravo10p @samtripoli yall seen this?... Just figured yall should. #china #wuhan #coronavirus #wuhanvirus
2231649304024397560; 0; False; 1580254282; Acontecimientos de la ciudad china de Wuhan, habitantes en crisis por contagio de #coronavirus
2231657087476305983; 2; False; 1580254277; Hrmm :thinking_face: :face_with_medical_mask: #CoronaVirus #ChinaVirus #Wuhan #Virus #China #Chinese #lunarnewyear #Sydney #Melbourne #health #Australia #worldhealth #travel credit abc.net.au
2231655765450942267; 11; False; 1580254276; Good evening. I’m LogiKIL and this is the Rapping Reporter.
2231656941877175976; 0; False; 1580254260; #CoronaÖlümBilançosu:biohazard:- 29.01.2020 :red_circle: Hubei: 125 :red_circle: Pekin: 1 :red_circle: Şangay: 1 :red_circle: Henan: 1 :red_circle: Hainan: 1 :red_circle: Heilongjiang: 1 :red_circle: Hebei: 1 . . . . . . . #turkey #türkiye #corona #korona #virüs #coronavirüs #sondakika #istanbul #bursa #izmir #ankara #hasta #hastalık #virus #coronavirus #haber #haberler #sondakikahaberler #çin #china #wuhan #güncel #güncelhaber #güncelhaberler #coronaviruses #coronaviruese #new #news #sondakikahaberleri
2231653440564370100; 2; False; 1580254243; 
2231656481979990089; 1; False; 1580254205; Sizce insanlar (kimine göre tanrının,kimine göre doğanın) gazabını hak ettiler mi?
2231655502029686704; 4; False; 1580254088; we moving to greenland :smiling_face_with_heart-eyes::see-no-evil_monkey:
2231655142753582801; 0; False; 1580254045; Today got the jade citrus tea with honey and sweetener #starbucks #jadecitrus #freemont #coronavirus #coffe #relaxing
2231651788585463362; 0; False; 1580253645; #beleza nou ten fimmm #landscapephotography #villacarlospaz #tattos #landscape #instamoment #instapic #coronavirus #dalia #dalias#photography #flowerstagram #flowers:cherry_blossom: #portraits
2231650883237907642; 3; False; 1580253538; The audacity!:rolling_on_the_floor_laughing: . . . . . #kobebryant #kobe #ripkobe #roadto10k #meme #instahustle #sports #funny #funnymemes #memesdaily #memes #comedy #humor #highhumor #like #follow #share #memepage #babyyoda #edgymemes #offensivememes #glmeme #viralmemes #fitnessmeme #instagrind #influencer #lakers #nbamemes #coronavirus #memelife
2231646961320941335; 1; False; 1580253080; I mean, he's got a point
2231646543524453885; 31; False; 1580253020; Pretty girls like trap’ :grapes::gem_stone: artwork made by me :stopwatch: #lookatitclosely
2231639003871016882; 1; False; 1580252805; Bitte Leute hört euch das an und verbreitet es. Das sind Informationen die die Presse nicht teilen möchte aber ich denke wir sollten alle wissen wie ernst die Lage wirklich ist!!
2231572826997708399; 55; False; 1580244233; شكون ما تسائلش كل مرة علاه تظهر فيروسات وأوبئة جديدة سنويا في العالم؟ بعيدا عن نظريات المؤامرة التي تصلح لأفلام السينما، هناك تفسير علمي لهذه الظاهرة الطبيعية التي تحدث منذ الأزل، راح نشرحها بطريقة بسيطة . الفيروسات كائنات موجودة على سطح الأرض منذ بداية الحياة، وهي مكونة مما يسمى جينوم ( ADN أو ARN ) . عايشة حياتها في تطفل على الأجسام الحية، تدخل تهاجم خلاياها وتبدا تتكاثر . غالبا يتعرف جهاز المناعة على هذه الفيروسات ويطور وسائل باه يقضي عليها كل مرة تحاول الدخول إلى الجسم . وتتم عملية التكاثر في الجسم عن طريق إعادة نسخ ال ADN أو ARN الذي تتكون منه، أحيانا أثناء عملية النسخ، تتغير بنية هذا الجينوم, أجزاء منو تتبدل أو تختلط مع جينوم الجسم لي محتلاتو ( الإنسان أو الحيوان ) فيولي عندها جينوم جديد ! . مين يتغير الجينوم لا تتغير طبيعة الفيروس بأكمله لكن يصبح مختلف ولا تستطيع مناعة الجسم التعرف عليه ما يسهل عليه إحتلال الجسم والإنتشار خارجه . هذه الظاهرة المسماة mutation تسبب ظهور أنواع جديدة من الفيروسات والبكتيريا في الطبيعة كوسيلة منها للبقاء . أذكر كمثال في السنوات الماضية ظهور نوع آخر من الكورونا في السعودية، فيروس زيكا في أميركا الجنوبية، إيبولا في أفريقيا، والإنفلونزا الإسبانية في أوروبا . فبعيدا عن الخزعبلات، مكان حتى علاقة بنمط أكل شعوب معينة أو أجنداتهم السياسية أو درجة إيمانهم... . #algerie #corona #كورونا #coronavirus #dz #algerienne #algeria #oran #alger #rie #dzair #dzpower #love #algerien #annaba #follow #instagram #bejaia #setif #soolking #fashion #blida #tlemcen #like #algerian #france #beauty #sante #الصحة #medecine
2231552032871586514; 3; False; 1580241754; #virus #conspiracytheory #coronavirus :nauseated_face::face_with_medical_mask::face_with_thermometer::woozy_face::zipper-mouth_face:
2231299235995967681; 0; False; 1580211618; ПАНИКА В СЕТИ: ПОЯВИЛАСЬ ИНФОРМАЦИЯ О ЗАРАЖЕНИИ КОРОНАВИРУСОМ ЧЕРЕЗ БАНАНЫ В популярных российских группах в соцсетях и мессенджерах распространяется информация о заражении коронавирусом через бананы. — В больнице Синьхуа вчера ночью погибли 23 человека, которые были заражены вирусом n7n9. Самому старшему было 35 лет, самому младшему год, врачи, имевшие с ними контакт, находятся в карантине. В новостях главного канала попросили временно не употреблять бананы, особенно привезённые с юга, — говорится в пересылаемом сообщении. Аналогичные сообщения распространяются и через мессенджеры в Казахстане. Вице-министр здравоохранения Казахстана Камалжан Надыров во время брифинга опроверг данную информацию, сообщает mail.ru. — Сегодня хотим официально сказать, что это не соответствует действительности. Это фейковая информация. Стоит доверять только проверенным и официальным источникам, — заявил он, добавив, что идут поиски лиц, которые распространяют недостоверную информацию. Подписывайтесь на наш instagram и узнавайте новости первыми! Новости без Цензуры 18+ в нашем Telegram канале (ссылка в шапке профиля)
2231275119318373458; 1; False; 1580208872; Во многих городах Китая (Гуанчжоу, Шэньчжэнь, Чжухай, Чжуншань, Дунгуань) местные власти приняли постановление запрещающее находится в общественных местах без маски. Подписывайтесь на наш instagram и узнавайте новости первыми! Новости без Цензуры 18+ в нашем Telegram канале (ссылка в шапке профиля)
2231656962966447866; 0; False; 1580254262; #coronavirus #corona #coronavirusmemes #coronamemes
2231656904590266343; 0; False; 1580254255; LOL hilarious :rolling_on_the_floor_laughing::face_with_tears_of_joy: #funnyshit #wearmask people #coronavirus is deadly :skull:#coronavirusmemes Disclaimer: not my photo .. don’t sue me .. dunno who dis guy
2231656808632829180; 0; False; 1580254244; E sobre o coronavírus da China. :backhand_index_pointing_down::backhand_index_pointing_down::backhand_index_pointing_down::backhand_index_pointing_down::backhand_index_pointing_down: . A China continua tomando providências para conter a disseminação do coronavírus. . Contudo, as mortes já somam 106 casos, e alguns infectados encontram-se fora da China. Ao todo, foram registrados 4.535 casos da doença na China e 45 no exterior. Existem ainda quase 7 mil casos suspeitos em todo o país. . O vírus se espalha rapidamente com casos confirmados na Tailândia (8), Austrália (5), Estados Unidos (5), Cingapura (5), Malásia (4), Japão (4), Coreia do Sul (4), França (3), Canadá (2) e Vietnã (2). Nepal, Sri Lanka e Camboja têm um paciente infectado cada. . A China e outros países vêm tomando providências para conter o vírus do "diabo" . Fontes: R7.com e UOL. . . . #boamicrob #virus #china #paho #oms #who #virologia #virology #virusmisterioso #Infectologista #lavagemdasmaos #higienizacaodemaos #biosseguranca #biosafety #biosecurity #bioseguridad #coronavirus #virusletal #pahowho #mers #sars #biomedicina #biologia #farmacia #medicina #enfermagem #hospital
2231656793959658577; 0; False; 1580254242; Coronavírus é uma família de vírus que causa problemas de saúde com sintomas respiratórios. Nos últimos dias, um novo tipo de coronavírus foi isolado na China e tem causado bastante preocupação entre as autoridades internacionais, tendo em vista o crescimento do número de casos de pessoas infectadas e também de mortes. Compreenda as características gerais das doenças causadas pelo coronavírus e outras informações sobre o assunto acessando o link que está na bio do perfil. #pracegover #imagemacessivel Imagem: foto de uma mulher usando máscara e segurando um tubinho onde está estampado o nome coronavírus. Texto na imagem: “Afinal, o que é um coronavírus?” #coronavirus #china #saude #virus #mundoeducacao #biologia #noticiadodia #sutydgram #studygrambr #corona #viruscorona #sars #wuhan
2231656765555418838; 0; False; 1580254239; Perlukah barang yang saya terima dari negara China melalui proses 'sanitizing' selepas terjadinya wabak Novel Coronavirus? . Source: FB Rasmi KKM. . #coronavirus #ncov2019
2231656758544586023; 0; False; 1580254238; Coronavirus is growing and growing. They are still allowing people to travel to and from China. Orange county had its first case this week. This new virus has killed 106 so far and keeps growing daily. Protect yourself as life is not promised to anyone and you must make the most out of life everyday. #helpingothers #givingback #goodvibes #freefollowers #inspirational #enjoylife #coronavirus #livingyourbestlife #healthylifestyle #veganlifestlye #disease #diseaseprevention #flu #vitamins #washyourhands #cleanlife #losangeles #orangecounty #organic #billionaireboysclub #billionaire #milenials #millionairemindset #plantbased #plantbaseddiet #beverlyhills #bekind
2231656657721538186; 0; False; 1580254232; El cuerpo necesita vitamina E para ayudar a mantener el sistema inmunitario fuerte frente a virus y bacterias. http://ow.ly/Owfg50y6RDk #puroestadofisico #vitaminae #coronavirus #virus #bacterias #infecciones #salud #saludfisica #bienestar #sistemainmune #sistemainmunologico
2231656561326416484; 2; False; 1580254230; Parents and caregivers in parts of Australia have been asked to hold their children back from school if they have recently travelled to China amid the coronavirus outbreak. @sunriseon7 reporter @bianca_stone7 reports. #coronavirus #7NEWS
2231656633797305781; 0; False; 1580254229; True #doctorwho #davidtennant #coronavirus
2231656490939358645; 0; False; 1580254222; Organizzazione cinese #CoronaVirus
2231656616348638268; 0; False; 1580254221; Corona Virus Pertama Kali Ditemukan Bukan di China Tapi di Arab Saudi https://www.wartawaterkini.web.id/2020/01/corona-virus-pertama-kali-ditemukan.html #wartawaterkini #corona #coronavirus
2231656578841817717; 0; False; 1580254217; Corona #corona #coronavirus #corona:beer_mug: warning
2231656544171534528; 0; False; 1580254212; #viral #coronavirus #virus #selfreminder #muhasabbahdiri #hijrah #nasehatdiri #wahn
2231656480946482502; 0; False; 1580254212; The 2019 Coronavirus - What You Should Know. Quick and Informative Blog from MCMC READ HERE: http://bit.ly/36BmFJp #Coronavirus #2019Coronavirus #2019nCoV
2231656509512288417; 0; False; 1580254208; Earthquake of viruses :flushed_face::skull_and_crossbones: #virus #coronavirus #memes #wuhan
2231656509511345610; 0; False; 1580254208; #Repost @nacion_rex • • • • • • Debes mantenerte informada para así tomar tus precauciones y evitar a toda costa el contagio del #coronavirus :sneezing_face::face_with_thermometer::face_with_medical_mask: #enfermedadesraras #enfermedades #salud #infografia
2231656471853390798; 1; False; 1580254204; #brah #dead:skull::skull: #pettyasfuck:face_with_tears_of_joy::face_with_tears_of_joy::face_with_tears_of_joy::face_with_tears_of_joy::face_with_tears_of_joy::face_with_tears_of_joy: #kungflu #coronavirus
2231656410392268145; 0; False; 1580254196; I'm back, baby! Got the hand out of the cast yesterday and I'll be back to welding by the week's end. Stay tuned! #corona #coronavirus #chalk #chalkart #virus
2231656277809729975; 0; False; 1580254190; Damn you right. #bruhmoment #bruhmoments #coronavirus #coronavirusmemes #ironicmemes
2231656333131111164; 7; False; 1580254187; Coronavirus is out here killing people. Death toll is 102 with more than 4,500 people infected. Here is a quick guide to remain safe! #coronavirus #coronavirusoutbreak #coronavirusmemes #wuhan #china #outbreak #bestpractices #shaderoom
2231656272967982941; 0; False; 1580254180; La nueva cepa de Coronavirus (2019-nCoV) que ha cobrado 80 vidas e infectado a más de 2000 personas :microbe::crown: :biohazard: . . . Los primeros casos de este síndrome respiratorio se generaron el 12 de diciembre del 2019 en Wuhan, China :China: Las personas que asistieron al hospital presentaban dificultades respiratorias serias, y referían presentar un caso de neumonía extraña :hospital: El 31 de diciembre del 2019 se genera el primer informe sobre esta nueva enfermedad, con 27 casos relacionados :microbe::crown: Las autoridades de salud de China creen que la enfermedad se transmitió a los humanos por primera vez a través de animales como los murciélagos :bat: y las serpientes :snake: Pero de igual forma se ha confirmado que es zoonótico, transmisible entre las personas :man_frowning_light_skin_tone::woman_frowning_medium_skin_tone: . . . En un estudio actualizado del Centro de Análisis de Enfermedades Infecciosas Globales, en conjunto con la Organización Mundial de la Salud, se habló de 4000 casos graves (que pueden conducir a la muerte) con un rango de incertidumbre de entre 1000 y 9.700 casos superables :biohazard::test_tube::microbe: . . . Este virus puede desencadenar cuadros respiratorios graves en personas que padecen de: hipertensión arterial, enfermedades cardiovasculares, diabetes, enfermedades hepáticas y respiratorias, entre otras :sneezing_face::face_with_thermometer::face_with_medical_mask: . . . De esta forma, desde su aparición se han confirmado casos de contagios en diferentes países del mundo incluyendo Tailandia, Japón, EEUU, Francia, Corea del Sur, Singapur, Taiwán y Vietnam :face_with_thermometer::globe_showing_Asia-Australia: . . . Por esta razón, arriba dejamos algunas imágenes para que te mantengas informado y podamos prevenir en la medida de lo posible la propagación de este Coronavirus :microbe::crown: . . . #socorristas #socorrismo #venezuela #emergenciasmedicas #salud #emergencias #aph #voluntarios #prevencion #coronavirus
2231656268371021187; 0; False; 1580254179; Coronavírus pra cá... corona vírus pra lá... só se fala dele. Pra ficar mais fácil o COREN trouxe as principais informações nesse folder. Já que é o assunto mais bombado do momento precisamos estar por dentro. #coronavirus
2231656055888980000; 7; False; 1580254177; :face_with_medical_mask:Please be careful:folded_hands_medium_skin_tone::folded_hands_medium_skin_tone::folded_hands_medium_skin_tone: #manmade . . . #Repost . . . . . @tea_for_a_reason . . Just some tips to avoid the #coronavirus. Avoid packages from China.. just some common sense
2231656166784643264; 5; False; 1580254167; Swipe for crazy pants :flushed_face::right_arrow: #sickday #coronavirus
2231656098989623278; 0; False; 1580254159; Hubei eyaletindeki kritik durumda olan hasta sayısı tekrar arttı. Sadece #Hubei eyaletinde 899 kişi ciddi durumda. . . . . . . #turkey #türkiye #corona #korona #virüs #coronavirüs #sondakika #istanbul #bursa #izmir #ankara #hasta #hastalık #virus #coronavirus #haber #haberler #sondakikahaberler #çin #china #wuhan #güncel #güncelhaber #güncelhaberler #coronaviruses #coronaviruese #new #news #sondakikahaberleri
2231656082186346091; 1; False; 1580254157; 而家連酒精搓手都炒 我又搵最好既俾你地 美國No.1醫院品牌 我隻兔兔去開間獸醫診所都係用佢 所有搓手啫喱都含70%酒精 唔貴 （但運費貴:grinning_face_with_sweat:又重） 以下係每枝計，包左美國寄黎香港既價錢 順豐到付/就我面交（$150以上） Travel size 30ml $20 Travel size 30ml 連套可掛袋 $25 Travel size 59ml $30 236ml 吱吱裝（原味/蘆薈）$60 354ml 吱吱裝（含精油，比普通更護手）$80 請whatsapp:kissing_face_with_smiling_eyes: link in bio 陸續覆，店主會覆等左最耐既先 DM同留言唔知要輪幾多個鐘先覆到你:folded_hands_medium-light_skin_tone:
2231655698449985835; 0; False; 1580254112; Google maps ha lanzado un mapa actualizado con casos confirmados, posibles y descartados del #Coronavirus Se reportan más 4.000 casos confirmados a nivel mundial pero cifras extraoficiales señala que sobrepasan los 44.000 infectados.
2231655690069852514; 0; False; 1580254111; https://youtu.be/5d_s004ADNY Ignore the tags you degenerate. . . . . . . . #destiny #forhonor #meme #edgy #offensive #offensivememes #halo #funny #games #game #maga #trump #stopreadingmyhashtags #babyyoda #spam #edgymemes #retard #doge #obamaisalizard #cringe #videogames #dumb #halo #4chan #4changreentext #autistic #doge #stupid #unfunnymemes #wuhan #coronavirus #plague Why are you reading this? You get detention.
2231655670439092800; 0; False; 1580254108; Das neue #Coronavirus aus #China - Einigen macht es #Angst . Im Internet ist es nicht immer leicht neutrale Informationen dazu zu finden. Wir finden diesen Bericht sehr sachlich: https://zurl.co/IxEb Verhalten Sie sich einfach der allgemeinen Erkältungs- und #Grippezeit angemessen: kein Händeschütteln, häufiger #Händewaschen und grössere Menschenansammlung meiden. Die aktuellen #Panikkäufe von #Schutzmasken nützen dagegen weniger, weil die Alltagsmasken nicht dicht anliegen und eher groben Staub, statt Viren fernhalten. Passen Sie auf sich auf ... #Panik kann manchmal ansteckender sein, als der eigentliche Auslöser. Wir bleiben fair und neutral und beraten Sie bei uns in der #Apotheke vor Ort sachlich zu diesem Thema.
2231655656447567121; 4; False; 1580254107; Desde @abcdigital: :face_with_medical_mask: El ministro Julio Mazzoleni informó sobre un ciudadano extranjero, residente en el país, que presenta un cuadro sospechoso de #Coronavirus. . :face_with_monocle: Además, indicó que de los 35 pasajeros en vigilancia, 13 están descartados para la enfermedad. . :index_pointing_up: Aquí te dejamos algunas de sus frases. . :mobile_phone_with_arrow: www.abc.com.py . . . #Coronavirus #China #Paraguay #ABC #ABCColor #MSPBS #Salud
2231655643704828917; 6; False; 1580254105; Yeah #lol #memes #freshmemes #wazi #dankmemes #pfp #offensivememes #pewdiepie #promo #drakememe #shrekmemes #virus #funny #publicmemepage #memepage #growthtips #followers #coronavirus #smoshmemes #corona #bestmemes #ocmemes #memeaccount
2231655635368104114; 0; False; 1580254104; Beyaz Saray, ABD ve Çin arasındaki uçuşları askıya almayı düşünüyor. . . . . . . . #turkey #türkiye #corona #korona #virüs #coronavirüs #sondakika #istanbul #bursa #izmir #ankara #hasta #hastalık #virus #coronavirus #haber #haberler #sondakikahaberler #çin #china #wuhan #güncel #güncelhaber #güncelhaberler #coronaviruses #coronaviruese #new #news #sondakikahaberleri
2231654560852873448; 5; False; 1580254099; Que te vallan buscando la caja ,de envidia te mueres :bomb::collision:
2231655524980596973; 0; False; 1580254091; **IMPORTANT** #coronavirusoutbreak #coronaviruschina #coronavirus #china #chinesenewyear #chinesenewyear2020 #wuhanchina #wuhancoronavirus #wuhanpneumonia #wuhan #medical #doctors #nurselife #help #chernobyl #coronavirusoutbreak
2231655515661265416; 0; False; 1580254090; 2020 looking like 2010 :face_screaming_in_fear::face_screaming_in_fear: #january #2020 #walkingdead #coronavirus #scary #jan #meme #besafe #ww3 #twd #trump #kobe
2231655511015530964; 1; False; 1580254089; #fakenews#coronavirus#boogeyman# they keep you in constant fear
2231655512347365156; 0; False; 1580254089; Algérie :Algeria: : Coronavirus en Chine : Tebboune ordonne le rapatriement des ressortissants algériens #algerie#alger#chine#virus#coronavirus#epidemie#teboune
2231655434468851211; 1; False; 1580254080; Vincent Yu/AP/Shutterstock, Hong Kong government officials at a press conference about the #coronavirus outbreak on Tuesday. . "Following China’s decision to close its state museums last week, Hong Kong has shuttered its public art institutions indefinitely as it works to control the spread of the coronavirus.... The virus has already killed over 100 people, and as of Tuesday there were 4,600 confirmed cases on mainland China." Read more on @artnews: https://tinyurl.com/uu54unk. . #vincentyu #ap #shutterstock #hongkong #coronavirusoutbreak #chinesemuseum #hongkongmuseum #hongkongmuseumofart #documentaryphotography #colorphotography #photography #associatedpress
2231655397022053425; 0; False; 1580254076; You thought you can get away with what you did to innocent people? . . . . . . . #china #wuhanvirus #coronavirus #uyghurs #uyghurcamps #truth #Godiswatching #westandwithuyghur #eastturkestan
2231655376244023274; 1; False; 1580254073; O Ministério da Saúde anunciou na tarde desta terça-feira (28) dois novos casos suspeitos do coronavírus 2019-nCoV, um em São Leopoldo (RS) e outro em Curitiba (PR). Mais cedo, o governo havia noticiado a investigação de um caso em Belo Horizonte (MG). Inicialmente, o ministério disse que o possível caso no Rio Grande do Sul havia sido registrado em Porto Alegre, mas uma atualização mostra que ocorreu em São Leopoldo, região metropolitana. A notificação à pasta federal que foi feita pela Secretaria de Saúde da capital gaúcha. O governo informou, ainda, que os dois pacientes do Sul do país se enquadram na definição de quadro suspeito estabelecida pela Organização Mundial da Saúde (OMS), com febre, pelo menos um sintoma respiratório e possível contato com a doença, em qualquer lugar da China, nos últimos 14 dias. A PREVENÇÃO do Corona Vírus é a higienização das mãos, ao espirrar ou tossir cobrir a boca e o nariz, cozinhar bem carnes e ovos, não compartilhar objetos pessoais como talheres etc, e procurar o médico a qualquer sintoma suspeito! . . . Fonte: https://www.google.com/amp/s/g1.globo.com/google/amp/ciencia-e-saude/noticia/2020/01/28/brasil-tem-2-novos-casos-suspeitos-de-coronavirus-em-porto-alegre-e-curitiba-ministerio.ghtml . . . #perigo #cuidados #prevencao #coronavirus #ameaça #saude
2231655267778904334; 0; False; 1580254060; #CORONAVIRUS :red_circle:Detectaron un cuarto caso de coronavirus en Francia: un turista chino que se encuentra en estado grave El hombre, de 80 años y procedente de Hubei, está internado en París
2231655260933836913; 0; False; 1580254059; Tag unui bețiv #memesromania #romaniamemes #romemes #memesro #bancuri #memeuri #memeuriromania #memeuriro #memeuriromanesti #memeuri:red_heart: #caterinca #umor #glume #amuzament #haz #hazro #junimea #nebunie #bucuresti #clujnapoca #coronavirus #timisoara #constanta #ploiesti #iasi #moldova #romania #romanian #romaniamagica #romania:Chad:
2231655233896193339; 0; False; 1580254056; :face_screaming_in_fear::smiling_face_with_heart-eyes::dog_face: ¡UN HÉROE DE CUATRO PATITAS! Este perrito evitó que se dueña viaje a #Wuhan, la ciudad donde se originó el #coronavirus, al destruir su pasaporte. . . . Mira las fotos y los detalles de la conmovedora historia en www.ecuavisa.com
2231653891341392645; 0; False; 1580254054; Did I go into a men’s bathroom today to shoot hand washing video? Yes, yes I did. :waving_hand_light_skin_tone::thumbs_up_light_skin_tone:#ThirtySeconds #SingtheABCs #coronavirus #mmjane
2231654208648855321; 0; False; 1580254052; Drake :smiling_face_with_heart-eyes::smiling_face_with_heart-eyes::star-struck: - - - - - - - - - - - - - - - - #funnyvideos #funny #funnyvideo #video #funnymemes #mamberroi #drake #meme #memes #memesdaily #memes:face_with_tears_of_joy: #offensivememes:sweat_droplets::eyes::hundred_points::face_with_tears_of_joy::face_with_tears_of_joy::gem_stone::fire::face_with_steam_from_nose::sweat_droplets::OK_hand::hundred_points::face_with_tears_of_joy::folded_hands::face_with_tears_of_joy::face_with_tears_of_joy::gem_stone::gem_stone::fire::face_with_steam_from_nose::sweat_droplets::eyes::eyes: #offensivememes #offensivmemes #india #funnyindian #ww3 #coronavirus #memesdaily
2231655168877039156; 2; False; 1580254048; Jaime Duran Barba aseguró que la popularidad del presidente Lenin Moreno, es tan solo del 6% y que debido a ese porcentaje, su gobierno es inestable. Con este tipo de popularidad, muchos gobierno ya habrían caído, pero como es conocido, los que mantiene al gobierno inoperante Morenista, son los medios de comunicación y poderes fácticos, que se ven beneficiados por el reparto. El ex consultor político socialcristiano, es un fiel representante de la derecha neoliberal, hace poco estuvo liderando el grupo de asesores de Macri en Argentina.
2231655166216962891; 0; False; 1580254048; Tutong kulit ori Mat kulit sapi lokal Hak datar 1 cm Size 36 - 40 Idr 170 K #tutongkulit #papirutmurah #sendalkulitgarut #sendalpapirutmurah #rubenonsu #viruscorona #coronavirus #sule #fairusarafiq #parentingislami #jualsepatukulitmurah
2231655134911627591; 2; False; 1580254044; My repost. Remeber to protect your children from the coronavirus. #darkmemes #safteyfirst #coronavirus #preparedness #wuhanvirus #wuhanfever
2231655112573399034; 0; False; 1580254042; #internacional / #salud - La Organización Mundial de la Salud (OMS) determinará este fin de semana si eleva a nivel emergencia en salud pública de importancia internacional el contagio por el nuevo coronavirus, cuya capacidad de contagio por enfermo es de 2 a 3 personas cercanas. Jean Marc Gabastou, asesor internacional en Emergencias en Salud de la OPS/OMS con representación en México, explicó que el director general de la OMS se encuentra en Pekín con un panel de científicos, autoridades políticas y sanitarias, así como con encargados de la contención que se están llevando a cabo en China, para tomar una decisión y dijo que “este fin de semana vamos a tener novedades”. “La declaratoria de emergencia en salud pública de importancia internacional se asocia con una epidemia grave que podría tener una diseminación internacional y por lo cual se requiere una coordinación internacional, que puede ser una epidemia o una pandemia; por ejemplo, el ébola no fue una pandemia pero tuvo una declaratoria. #méxico #coronavirus #epidemia #oms #tendenzanews
2231655102438365521; 96; False; 1580254041; Selain tewaskan lebih dari 100 orang, Virus Corona jenis baru guncang berbagai sisi kehidupan warga dunia. Tidak hanya ekonomi, bahkan juga berpotensi goyang pariwisata Indonesia. . Semoga virusnya gak sampai ke Indonesia ya, Gais… . #Corona #Wuhan #WuhanJiayou #China #Indonesia #coronavirus
2231655092037899650; 1; False; 1580254039; ‪In #coronavirus news, the number of people worldwide infected with 2020’s answer to the bird flu pales in comparison to the number of people demanding answers to #INCESTGATE, an epidemic of rumors that @realDonaldTrump is scared to address‬
2231655046228182314; 0; False; 1580254034; Attentifs ensembles :warning: Comment réagir si vous présentez ces symptômes . ————————————————————————Un quatrième cas du coronavirus a été confirmé en France, a annoncé, mardi, Jérôme Salomon, le directeur général de la Santé, lors d'une conférence de presse. Il s'agit d'un touriste chinois originaire de la province de Hubei. et âgé d'« environ 80 ans ». L'homme a été hospitalisé en réanimation à Paris. « Il est dans un état sévère » et « nécessite des soins continus », a indiqué le directeur général de la Santé. Ajoutés aux trois cas déjà confirmés, cela fait donc un total de quatre cas avérés en France. Ce nouveau cas n'est pas lié aux trois premiers, hospitalisés à Bordeaux pour l'un, et à Paris pour les deux autres, dans un état qui ne génère pas d'inquiétude. Trois cas supplémentaires d'infection ont été détectés en Bavière, là même où a été identifié un premier cas mardi matin, a annoncé le ministère bavarois de la Santé. « Ces patients sont également des employés de l'entreprise du district de Starnberg, où la première personne touchée est déjà employée », a précisé le ministère dans un communiqué. 250 Français rapatriés depuis Wuhan Par ailleurs, les ressortissants français du Wuhan qui le souhaitent devraient être rapatriés en milieu de semaine, sous la supervision d'une « équipe médicale dédiée », a annoncé la ministre de la Santé. . . . Source : Le Parisien . . #coronavirus #infection #esimbimag #contagion #epidemie #chine #wuhan #quarantaine #bordeaux #paris #toulouse #chinois #tourist #touriste
2231655009710565012; 0; False; 1580254029; Thoughts on the #CoronaVirus going around? I saw this in the comments of a post and as of today it predicted 5100/105 and the news says ~4500/106... :thinking_face: I’m told it may just fizzle out like SARs did but in the meantime it still killed 800 and that was in 3-4 months this has only been this month end of last maybe? Depending on your immune system and all of that stuff.
2231654913291603588; 3; False; 1580254018; . . Welcome corona virus .. @marocwebawards #corona #coronavirus @unicef #professional #professeur #eljadida
2231654814107085740; 6; False; 1580254006; Passagens só de ida @jornalbobo . . . #tinder #tinderbrasil #facebook #instagood #instagram #ifood #uber #linkedin #foramaia #deputadofederal #nhonho #gordo #fakenews #boatarte #terçafeira #psol #tbt #tbt:BACK_arrow: #verdevaldo #reginaduarte #secretariadacultura #ministeriodacultura #folhadespaulo #sergiomoro #bolsonaro #novopanico #moronopanico #globolixo #coronavirus
2231654572355474974; 0; False; 1580254002; #coronavirus #mosquito
2231654744697488370; 1; False; 1580253998; Gato con coronavirus #cat #gato #michi #julianchupalo #coronavirus
2231654748348822722; 0; False; 1580253998; #coronavirus
2231654740436138474; 0; False; 1580253997; Espero que llegue a tiempo, no aguanto más estar vivo . . . . . . . #memes #memeespañol #instameme #funnymeme #risas #humor #memedeldia #memesdaily #memess #adictosalosmemes #chistes #gracioso #latino #momos #argentina #diversion #memestagram #ja #jaja #jajaja #argentina #2020 #2020goals #china #coronavirus
2231654698955688969; 0; False; 1580253992; Em tempos de viroses, devemos motivar a higienização das mãos mais vezes ao longo do dia. O uso do Álcool gel a 70% deverá ser uma das estratégias para evitarmos que uma virose se espalhe :lotion_bottle::potable_water: . O álcool 70% possui propriedades microbicidas extremamente eficazes para eliminar microrganismos e seu uso deverá ser feito após a higienização das mãos. . . . . #nutricao #coronavirus #higienizacao #higiene #creche #crecherj #nutricionistarj #sanesnutrição #assessorianutricional
2231654659100190881; 0; False; 1580253988; #coronavirus veja sintomas , e como se previnir , link na Bio #linknabio #g1 #cortesdecabelo #saude #suasaude #humano #naoperfeito #virus #sizu #prouni #ibama #amazonia #china #cidadedachina #europa #fimdetudo
2231654626954851211; 0; False; 1580253984; #memes #dankmemes #edgymemes #anime #wipawinomemes #starwars #ecchi #offensivememes #memedealer #shrekmemes #yodamemes #babyyoda #bruh #shrekmemes #corona #coronavirusmemes #coronavirus
2231654625657199434; 0; False; 1580253984; DIY virus protection! :rolling_on_the_floor_laughing::beaming_face_with_smiling_eyes::winking_face_with_tongue: #coronavirus #cdc #wuhancoronavirus
2231654609089050124; 0; False; 1580253982; - 5.572 onaylı vaka - 131 ölüm - 1.109 kritik durum - Vakaların çoğu Çin'de - 59 uluslararası vaka . . . . . . #turkey #türkiye #corona #korona #virüs #coronavirüs #sondakika #istanbul #bursa #izmir #ankara #hasta #hastalık #virus #coronavirus #haber #haberler #sondakikahaberler #çin #china #wuhan #güncel #güncelhaber #güncelhaberler #coronaviruses #coronaviruese #new #news #sondakikahaberleri
2231654609364074080; 2; False; 1580253982; Forget Train to Busan, we got Planes from Wuhan :face_with_medical_mask::airplane:⁣ ⁣ ⁣ ⁣ #coronavirus #coronaviruswugan #wuhanchinavirus #trainfrombusan #carphotography #carporn #carswithoutlimits #amazingcars247 #portraitgames #dreamwhipz #collectivetrend #supercars #exoticcars #portraitvision #carlifestyle #autogespot #autogespotusa #itswhitenoise #coronavirus2020 #hypeaf #highsnobiety #mercedesbenz #mercedes #coronaviruspics #coronavirusmemes #importmodels #moodyports #coronavirusoutbreak
2231654454712315596; 0; False; 1580253977; Bruh Coronavirus:face_with_medical_mask: . . . . . . . . . . . #meme #memevideo #funny #divertido #xd #bruh #memeespañol #memespañol #bruhmoment #memelatino #memeschilenos #memeargentino #coronavirus #coronavirusmemes #memescoranavirus #bruhcoronavirus #daunpocodemiedo #perobueno #habraqueseguir #sonriendo #ymasquesonreir #siendofeliz #pero #cuidadocoaliexpress #aliexpressmemes #ggwp #nosoydealabama #peromevoyalacama #ooohhhhquetocho #madreeee
2231654511890242660; 0; False; 1580253970; KEMASKINI INFO ON WHEELS (IOW) TERENGGANU: PUSAT MAKLUMAT RAKYAT DAERAH DUNGUN Info On Wheels Jabatan Penerangan Negeri Terengganu pada 28 Januari 2020. Penyampaian maklumat dan dasar-dasar kerajaan secara bersemuka kepada masyarakat. Fokus penyampaian maklumat adalah berkenaan: :large_blue_diamond: Novel Coronavirus (2019-nCoV) :large_blue_diamond: Langkah-langkah Pencegahan :large_blue_diamond: Tanda & Gejala :large_blue_diamond: Inisiatif-inisiatif kerajaan Kawasan yang terlibat: Pusat Maklumat Rakyat Daerah Dungun :large_orange_diamond: Teluk Lipat, Dungun :large_orange_diamond: Pejabat Kesihatan Dungun #cmstu #JPTU #JabatanPenerangan #coronavirus #beinspired #pmrdungun
2231654434142967103; 0; False; 1580253961; Fighting the virus. #coronavirus #shanghai #laoma #laomatze #shanghaimatze #chinamann
2231654374684255982; 0; False; 1580253954; JIMS HONEY X OKIE AGUSTINA Aurora Bag, designer's bag catered for Muslimah :smiling_face_with_heart-eyes: . Tas modis stylish penuh warna dengan 2 ruang besar + 1 area penyimpanan besar yang dilengkapi dengan zipper . Aurora Bag juga memiliki tali panjang, so, bisa banget untuk kamu jadikan sebagai sling bag . Dengan berat hanya 700gr, sudah pasti Aurora Bag pilihan terbaik untuk menemani aktivitas harianmu kapanpun, dimanapun :hugging_face: . catch our first ever collaboration product, produk hasil kolaborasi PERTAMA dari @jeje_collections :two_hearts: . Price : 236.000 SALE 30% menjadi 166.000 :money_bag: . Order :backhand_index_pointing_down: Line :backhand_index_pointing_right: johana_c WA :backhand_index_pointing_right: https://api.whatsapp.com/send?phone=6287768772787 Instagram :backhand_index_pointing_right: @jeje_collections Shopee :backhand_index_pointing_right: JeJe Collections Jims Honey . #iCarryJH #JHAurora #AuroraBag #OkieAgustina #gisel #gempi #garagaragempi #jimshoneyjakarta #jimshoneybatang #jimshoneyjepara #jimshoneysemarang#jimshoneykramat#jimshoneyadiwerna#jimshoneytegal#jimshoneybrebes#jimshoneypemalang#jimshoneypekalongan#jimshoneyslawi#viral#hoteldelluna#jichangwook#nikitamirzani#coronavirus
2231654367226915745; 0; False; 1580253953; Like I leave the house anyway. . . . #meme #memes #funny #dankmemes #memesdaily #funnymemes #lol #dank #follow #humor #like #dankmeme #lmao #love #anime #edgymemes #comedy #dailymemes #instagram #offensivememes #fun #fortnite #tiktok #funnymeme #memer #memestagram #memez #naruto #coronavirus #wuhan
2231654339739525376; 0; False; 1580253950; #Liebe #LiebeAufDemErstenBlick #Heirat #Hass #gutesherz #zugutfürdiewelt #Schmerzen #enttäuscht #Verletzt #summer #Liebeskummer #seelensorger #hilfe #Unterstützung #verzweifelt #Verzweiflung #tot #Beziehung #:red_heart: #Meer #Urlaub #Sonne #Strand #Wellen #geil #bayern #hessen #Corona #Coronavirus #Wissenschaftler
2231654338312721547; 0; False; 1580253949; Like I leave the house anyway. . . . #meme #memes #funny #dankmemes #memesdaily #funnymemes #lol #dank #follow #humor #like #dankmeme #lmao #love #anime #edgymemes #comedy #dailymemes #instagram #offensivememes #fun #fortnite #tiktok #funnymeme #memer #memestagram #memez #naruto #coronavirus #wuhan
2231654335341832357; 15; False; 1580253949; Yasta tenía muchas ganas de hacer mi #toonme bien divagoso con la @wacom . #toonmechallenge #2020 #draw #portrait #wacom #colors #selfie #man #ilustracion #illustration #challenge #toonme #artist #digitalart #character #2d #hambre #paraguay #coronavirus (?
2231654326089253991; 0; False; 1580253948; JIMS HONEY X OKIE AGUSTINA Aurora Bag, designer's bag catered for Muslimah :smiling_face_with_heart-eyes: . Tas modis stylish penuh warna dengan 2 ruang besar + 1 area penyimpanan besar yang dilengkapi dengan zipper . Aurora Bag juga memiliki tali panjang, so, bisa banget untuk kamu jadikan sebagai sling bag . Dengan berat hanya 700gr, sudah pasti Aurora Bag pilihan terbaik untuk menemani aktivitas harianmu kapanpun, dimanapun :hugging_face: . catch our first ever collaboration product, produk hasil kolaborasi PERTAMA dari @jeje_collections :two_hearts: . Price : 236.000 SALE 30% menjadi 166.000 :money_bag: . Order :backhand_index_pointing_down: Line :backhand_index_pointing_right: johana_c WA :backhand_index_pointing_right: https://api.whatsapp.com/send?phone=6287768772787 Instagram :backhand_index_pointing_right: @jeje_collections Shopee :backhand_index_pointing_right: JeJe Collections Jims Honey . #iCarryJH #JHAurora #AuroraBag #OkieAgustina #gisel #gempi #garagaragempi #jimshoneyjakarta #jimshoneybatang #jimshoneyjepara #jimshoneysemarang#jimshoneykramat#jimshoneyadiwerna#jimshoneytegal#jimshoneybrebes#jimshoneypemalang#jimshoneypekalongan#jimshoneyslawi#viral#hoteldelluna#jichangwook#nikitamirzani#coronavirus
2231654297972427188; 0; True; 1580253945; #mambamentality #44 #rise #christconsciousness #coronavirus
2231654232792801166; 0; False; 1580253937; :North_Korea::North_Korea::North_Korea: - - - - - - #meme #dankmemes #neoliberal #relatable #trump #democracy #funny #lmao #impeachment #coronavirus #funnymemes #funnymeme #rofl #xd #jokes #israel #virus #oc #dead #politics #neocon #maga #conservative #tajikistan #china #reddit #korea #kimjongin #kimjonghyun #kimjongun
2231654213213810863; 1; False; 1580253935; #coronavirus #mundo #infección #epidemia #umbrellacorporation #virus #gripe #gripa #quemiedo :loudly_crying_face::loudly_crying_face:
2231654102987928734; 0; False; 1580253921; Avec ma collègue Steph, on a des discussions hyper joyeuses dans les vestiaires. . La Green Dictature ma Stefit ! . Ps : reviens à la salle c’est mieux quand t’es là ! . Eh vous avez vu, j’ai dessiné mes fesses. Je vais devenir riche. :yen_banknote: #instabd #dessin #bd #bandedessinee #draw #drawing #strip #comic #illustration #girlsofillustration #coronavirus #findumonde #collapsologie #permafrost #rechauffementclimatique #ecolo #nofuture #ecologie #onvatousmouriretpuisvoila
2231654053753256194; 0; False; 1580253915; Bud light year is here to save the day:rolling_on_the_floor_laughing: Follow @ur_fave_meme_account Follow @ur_fave_meme_account . . . . . . . . . . #meme #memes #memesdaily #dankmemes #dankmemesdaily #funnymemes #funnymemesdaily #funny #relatable #relatable memes #fy #fyp #foryou #foryourpage #memesforyou #memesforyourpage #corona #coronavirus #coronavirusmemes #coronavirusoutbreak #funniestmemes #bestmemes #funnymemesdaily #bestdailymemes #buzzlightyeat #budlight #followme #bestmemesdaily #bestmemesof2020 #bestmemesever #bestmemesonly #likethispost
2231654004085976194; 4; False; 1580253910; Wabah Virus Corona sudah merebak di negara-negara Asia, tak terkecuali Asia Tenggara, termasuk negara-negara tetangga Indonesia. Selain mencegah masuknya virus melalui perketatan pengawasan terhadap kesehatan wisatawan di bandara, ada baiknya kita mencegahnya dari diri masing-masing. Kenali gejala dan cara pencegahannya yuk, #SahabatAP1! Kalian juga bisa bagikan tips pencegahan lain di kolom komentar. Meluncurrr! #AngkasaPura1 #AP1GoBeyond #CoronaVirus #VirusCorona
2231653967476882103; 0; False; 1580253905; O negócio vai ficar ainda mais sério. . Créditos @geek_culture . #umbrella #umbrellacorp #residentevil #zumbi #mortosvivos #pandemia #epidemiacacheada #coronavirus #apocalipsezumbi #nerd #geek #gamer #londrina #maringa #saopaulocapital
2231620308951647495; 0; False; 1580253899; While this #coronavirus is a lab created virus planned to be 2020' Agenda 21 apocalyptic global plague, it is much more deadlier and more details transpiring than what news media is leading people to believe.
2231653916516153979; 0; False; 1580253899; INFORME DA SOCIEDADE BRASILEIRA DE INFECTOLOGIA SOBRE O NOVO CORONAVÍRUS – PERGUNTAS E RESPOSTAS PARA PROFISSIONAIS DA SAÚDE E PARA O PÚBLICO EM GERAL (Dados atualizados em 24/01/2020) Basta clicar no link abaixo !!! https://drive.google.com/file/d/1alqe7VUWgUOyrS8kwvmKL7OCDuvJsXcx/view #coronavirus #prevencaocoronavirus
2231653857863500262; 0; False; 1580253892; What would you do if you caught this virus?? #6ixbuzztv #toronto #coronavirus
2231653828209752220; 10; False; 1580253889; O problema não é a :China:China comer morcego, :globe_with_meridians:é o mundo consumir carneS! ⠀ :microscope:Todas as maiores e mortais doenças do Planeta surgiram do.consumo.de carneSSS. :bat:Desde o morcego hospedeiro ao gado:ox::pig::fish::chicken::cow:que ingeriu algum vírus e bactéria e foi consumido depois! ⠀ Isso sem entrar no mérito que, COMPROVADAMENTE pela ONU, OMS e grandes especialistas, os :dna:cânceres e :beating_heart:problemas cardíacos/ vasculares que mais matam estão ligados ao consumo de carneS, e produtos industrializados embutidos (presunto, linguiça, salame, salsicha etc). ⠀ :petri_dish:Coronavirus é só um vislumbre de que a raça humana pagará pelas atrocidades exatamente por onde cometem as atrocidades: pelo prato, pela boca! ⠀ :revolving_hearts::counterclockwise_arrows_button:COMPARTILHE:counterclockwise_arrows_button::revolving_hearts: Informação gera reflexão! Reflexão pode gerar boas mudanças!:folded_hands: ⠀ #Coronavirus #China #VirusMortal #Doenças #China #Cancer #ShameOnChina #Morcego #SopaDeMorcego #animalNÃOÉcomida #VoxVegan
2231653820399530579; 0; False; 1580253888; #Repost @elcomerciocom (@get_repost) ・・・ #ATENCIÓN | Esta es la lista de países que anunciaron casos de contagio de un nuevo #coronavirus, de la misma familia que el SRAS, desde su irrupción en diciembre en #Wuhan, en el centro de #China
2231653680217521520; 0; False; 1580253881; Don't know bout y'all but I'm running towards his ass, I'll take one for the team on this one y'all can escape, gonna tackle his ass and cover his mouth Ill risk getting sick * * * * * #dontreadmytags #memes #funny #memepage #bottomtext #admin #hilarious #lmao #lmfao #lol #haha #dankmemes #Instagram #expertmemer #issajoke #donttakeseriously #memeplug #memedealer #englishmemes #interesting #eyecatching #lookatthis #exposure #getmelikes #needlikes #anime #animerun #coronavirus #school
2231653673430457168; 0; False; 1580253875; Follow for more! Skiddaddle • • #meme #memes #bestmemes #instamemes #funny #funnymemes #dankmemes #offensivememes #edgymemes #spicymemes #nichememes #memepage #funniestmemes #dank #memesdaily #jokes #memesrlife #memestar #memesquad #humor #lmao #igmemes #lol #ebola #corona #virus #coronavirus #china #ww3 #WW3
2231653121409789539; 0; False; 1580253872; @cordova.media Seorang pejabat Kemenlu China, bernama Lijian Zhao memposting di akun twitternya, video pembangunan rumah sakit yang dibangun untuk pasien yang terja ngkit virus Corona. Rumah sakit yang dibangun selama 16 jam ini, berbentuk box dilengkapi dengan teralis besi di jendelanya dan dan kunci yang diletakkan di pintu bagian luar.⁣ ⁣ Di postingan tersebut, ia juga menuliskan, "Let's pray for Wuhan & China", mari berdo'a untuk Wuhan dan China. Sudah jamak diketahui bahwasanya pemerintah China dari Partai Komunis China menganut paham atheisme. Namun dalam kondisi darurat seperti ini, salah satu anggotanya mengajak berdo'a untuk Wuhan dan China yang saat ini dilanda wabah virus Corona. Sudah menjadi fitrahnya, manusia bahkan ateis sekalipun, ketika dalam kesulitan, membutuhkan pertolongan dari Tuhan Yang Maha Kuasa.⁣ ⁣ "Dan dia dibantah oleh kaumnya. Dia berkata: 'Apakah kamu hendak membantah tentang Allah, padahal sesungguhnya Allah telah memberi petunjuk kepadaku'. Dan aku tidak takut kepada [malapetaka dari] sembahan-sembahan yang kamu persekutukan dengan Allah, kecuali di kala Tuhanku menghendaki sesuatu [dari malapetaka] itu. Pengetahuan Tuhanku meliputi segala sesuatu. Maka apakah kamu tidak dapat mengambil pelajaran [daripadanya]?" [QS. Al-An'am: 151].⁣ ⁣ "Dan sesungguhnya Kami jadikan untuk [isi neraka Jahannam] kebanyakan dari jin dan manusia, mereka mempunyai hati, tetapi tidak dipergunakannya untuk memahami [ayat-ayat Allah] dan mereka mempunyai mata [tetapi] tidak dipergunakannya untuk melihat [tanda-tanda kekuasaan Allah], dan mereka mempunyai telinga [tetapi] tidak dipergunakannya untuk mendengar [ayat-ayat Allah]. Mereka itu sebagai binatang ternak, bahkan mereka lebih sesat lagi. Mereka itulah orang-orang yang lalai" [QS. Al-A'raf: 179] . Revisi: di video tertulis 16 hari, yang benar adalah 16 jam sebagaimana yang tertulis di postingan Twitter tersebut. ⁣ #coronavirus #viruscorona #wuhan #china #ccp #xijinping
2231653622069261947; 1; False; 1580253864; The emergence of #Coronavirus in China is a vital reminder that there are steps we can take now to prevent the spread of the flu and other respiratory viruses. For the latest info on #Coronavirus from @cdcgov and @hcphtx visit ReadyHarris.org
2231650113281776900; 4; False; 1580253863; Rest In Peace to all the legends :folded_hands_medium-dark_skin_tone: Gone but certainly never forgotten :double_exclamation_mark:
2231653588881852821; 3; False; 1580253860; The beginning of the year of rat is extremely rough for all Chinese people, but I’m glad that I can be here with my families. My family still celebrated Chinese New Year for one time and then go back home and lock ourselves in to prevent from getting the coronavirus. This is unique experience that we see most people supporting Wuhan but also rumors terrorizing the society. China is, after all, strong and efficient fighting for its people. #HappyChineseNewYear #YearOfRat #FamilyValue #Coronavirus #MoreSupport #StayHome
2231653568641701028; 2; False; 1580253858; Rest In Peace to all the legends :folded_hands_medium-dark_skin_tone: Gone but certainly never forgotten :double_exclamation_mark:
2231653530440501447; 0; False; 1580253853; #china:China: #coronavirus #koronavirus #ilahiadalet #türkistan #dualarkabuloldu #edenbulur #çindevleti #uygur #uygurtürkleri #doğutürkistandazulümvar #doğutürkistankanağlıyor #doğutürkistan sıra #israil de #israel
2231653521396865813; 0; False; 1580253852; These are official names for the virus • Share it or get sick! • #corona #virus #coronavirus #meme #trending #relatabke #viral #global #spreading #spread #people #asia #china #illness #sickness #kungflu #funny #smart #intelligent #intelligence #hilariouse #brain
2231653489979701735; 0; False; 1580253848; JIMS HONEY X OKIE AGUSTINA Aurora Bag, designer's bag catered for Muslimah :smiling_face_with_heart-eyes: . Tas modis stylish penuh warna dengan 2 ruang besar + 1 area penyimpanan besar yang dilengkapi dengan zipper . Aurora Bag juga memiliki tali panjang, so, bisa banget untuk kamu jadikan sebagai sling bag . Dengan berat hanya 700gr, sudah pasti Aurora Bag pilihan terbaik untuk menemani aktivitas harianmu kapanpun, dimanapun :hugging_face: . catch our first ever collaboration product, produk hasil kolaborasi PERTAMA dari @jeje_collections :two_hearts: . Price : 236.000 SALE 30% menjadi 166.000 :money_bag: . Order :backhand_index_pointing_down: Line :backhand_index_pointing_right: johana_c WA :backhand_index_pointing_right: https://api.whatsapp.com/send?phone=6287768772787 Instagram :backhand_index_pointing_right: @jeje_collections Shopee :backhand_index_pointing_right: JeJe Collections Jims Honey . #iCarryJH #JHAurora #AuroraBag #OkieAgustina #gisel #gempi #garagaragempi #jimshoneyjakarta #jimshoneybatang #jimshoneyjepara #jimshoneysemarang#jimshoneykramat#jimshoneyadiwerna#jimshoneytegal#jimshoneybrebes#jimshoneypemalang#jimshoneypekalongan#jimshoneyslawi#viral#hoteldelluna#jichangwook#nikitamirzani#coronavirus
2231653424406126848; 0; False; 1580253840; Virus korona adalah virus yang dapat menginfeksi manusia dan menyebabkan penyakit Info nutrisi pencegah: WA 0812-844-1055 dodihermawan.com/colostrum #cegahviruscorona #viruskorona #coronavirus #viruscoronachina
2231651698878668452; 1; False; 1580253837; ¿#China está tomando las #medidas necesarias para controlar el #coronavirus? La información en las #BrevesInternacionales
2231653388010355961; 0; False; 1580253836; O Brasil eleva para nível 2 o risco do coronavirus no país, o anúncio veio após a primeira suspeita de um paciente, com os mesmos sintomas que veio da região afetada. O coronavirus já só se tornou uma pandemia, porque já foi constatado em vários continentes. #coronavirus #china #pandemia
2231652115766698898; 0; False; 1580253832; #CoronaVirus
2231653326654012330; 0; False; 1580253829; Follow for more! Rip a fellow soldier • • #meme #memes #bestmemes #instamemes #funny #funnymemes #dankmemes #offensivememes #edgymemes #spicymemes #nichememes #memepage #funniestmemes #dank #memesdaily #jokes #memesrlife #memestar #memesquad #humor #lmao #igmemes #lol #ebola #corona #virus #coronavirus #china #ww3 #WW3
2231653200883479640; 0; False; 1580253814; Honeys, ⁣ ⁣ 2020 trying to beat our ass ain't it???⁣ ⁣ Lol....ijs!⁣ ⁣ ⁣ Seriously though, you can rest & take a break to help you regroup, focus, all of that!⁣ ⁣ ⁣ BUT DON'T QUIT EVER! #whitehouse #war #impeachment #coronavirus #death #staystrong #rest #dontquit #traysings #wegotthis #stayfocused #takeawalk #write #meditate
2231651959907318655; 0; False; 1580253813; Oh they dead fr ———————————————— :right_arrow:Why aren’t you already following @adphobia:left_arrow: :smiling_face_with_smiling_eyes:Share if you laughed:smiling_face_with_smiling_eyes: :barber_pole:Spam W for a follow back:barber_pole: :heavy_minus_sign: :heavy_minus_sign: :heavy_minus_sign: :heavy_minus_sign: :heavy_minus_sign: :heavy_minus_sign: :wavy_dash: Sorry For Tags :wavy_dash: #ironicmemes #weirdmemes #cursedmemes #darkhumormemes #kahoot #spicymemes #ifunnymemes #originalmemes #funnybuttrue #kowalski #flextapememes #greatmemes #memesfordays #spicymemesdaily #ocmemes #yeetmemes #memesfordays #oofergang #worldwar3 #ww3 #trending #viral #explorepage #dankmemes #memesdaily #blackmamba #coronavirus
2231653077780387806; 0; False; 1580253799; It was him - - Follow @spider_man.memes_ for more - - #avengers #marvel #spiderman #docock #milesmorales #theamazingspiderman #60sspidermanmemes #mcu #spidermanfarfromhome #avengersendgame #marvelcomics #thanos #tomholland #tonystark #comics #spidermanmeme #blackspiderman #venom #spiderman2 #peterparker #endgame #webhead #tasm2 #coronavirus #marvelmeme #marvelstudios #stanlee #memes #dankmemes #spidermanps4
2231653067596947836; 4; False; 1580253798; Went to the doctor for a routine checkup. Came out thinking ima catch the #coronavirus. :face_with_medical_mask: — Not really y’all, J/K... but between the outrageous media and @netflix #pandemic, they’ll have you believing your time is coming soon. — • Don’t believe the hype. • Eat your #weed. • Drink Water. • Move your body. • Wash your hands frequently. — So that you feel good while you’re living. Because when it’s your time, there ain’t nothing you can do about it. . . #godsplan #enlightenmentcomestothosewhoseekit #buddhabless #mytimewillcome #freedom #dontbelievethehype #firstwelivethenwedie #TheMskStory #gratitudewins #cannateachya #liveyourbestlife #consciousliving :red_heart::green_heart::yellow_heart::woman_tipping_hand_medium_skin_tone: #Mskindness
2231653022568711729; 0; False; 1580253793; Zeitpunkt 29.01.2020 00:19 Der erste deutsche Corona-Patient hat sich wohl in Bayern bei einem Kollegen aus China angesteckt ! Am Dienstagabend den 28.03.2019 bestätigten die Behörden, dass es drei weitere Corona-Fälle in Bayern gibt. Bei den infizierten handelt es sich um Kollegen des ersten bestätigten Falles. #coronavirus #deutschland #virus #gesundheit #coronavirusdeutschland
2231653020309937386; 1; False; 1580253792; None
2231652970709522006; 0; False; 1580253786; Y nos juimos a la China!! Nos antojamls nomá po!!! :see-no-evil_monkey::see-no-evil_monkey::see-no-evil_monkey::grinning_face_with_sweat::grinning_face_with_sweat::grinning_face_with_sweat: Tudo bem Tudo legal! :red_heart: :face_with_hand_over_mouth: #china #empanaditaschinas #coronavirus :see-no-evil_monkey:
2231652909270069808; 0; False; 1580253779; JIMS HONEY X OKIE AGUSTINA Aurora Bag, designer's bag catered for Muslimah :smiling_face_with_heart-eyes: . Tas modis stylish penuh warna dengan 2 ruang besar + 1 area penyimpanan besar yang dilengkapi dengan zipper . Aurora Bag juga memiliki tali panjang, so, bisa banget untuk kamu jadikan sebagai sling bag . Dengan berat hanya 700gr, sudah pasti Aurora Bag pilihan terbaik untuk menemani aktivitas harianmu kapanpun, dimanapun :hugging_face: . catch our first ever collaboration product, produk hasil kolaborasi PERTAMA dari @jeje_collections :two_hearts: . Price : 236.000 SALE 30% menjadi 166.000 :money_bag: . Order :backhand_index_pointing_down: Line :backhand_index_pointing_right: johana_c WA :backhand_index_pointing_right: https://api.whatsapp.com/send?phone=6287768772787 Instagram :backhand_index_pointing_right: @jeje_collections Shopee :backhand_index_pointing_right: JeJe Collections Jims Honey . #iCarryJH #JHAurora #AuroraBag #OkieAgustina #gisel #gempi #garagaragempi #jimshoneyjakarta #jimshoneybatang #jimshoneyjepara #jimshoneysemarang#jimshoneykramat#jimshoneyadiwerna#jimshoneytegal#jimshoneybrebes#jimshoneypemalang#jimshoneypekalongan#jimshoneyslawi#viral#hoteldelluna#jichangwook#nikitamirzani#coronavirus
2231652733186784938; 0; False; 1580253775; #CoronaVirus rischio di collasso negli approvvigionamenti alimentari nelle zone in isolamento La cosa diventa estremamente seria e grave
2231652398370596277; 0; False; 1580253773; #BREAKING footage from #Fujian Province of #China civilian conflict with police. Fujian Rumoured to be going into lockdown and quarantine. #coronavirus #nCoV2019 #coronaoutbreak #BREAKING فیلم از استان فوجیان درگیری غیرنظامیان چین با پلیس. فوجیان شایعه شده است که به حالت قفل و قرنطینه می رود. #coronavirus # nCoV2019 #coronaoutbreak
2231652846724876278; 0; False; 1580253772; ‪また9.11の時みたいにCGじゃないのか？と全てのニュースを疑ってしまうゴーストタウンの様な武漢の道路。テレビでしか観ていないから。生で観ていないから。 https://youtu.be/PO-dxtGkgPM #coronavirus RT ‬
2231652835240677834; 0; False; 1580253770; Ante el posible caso de Coronavirus en el ecuador, aquí te dejamos algunas recomendaciones. . Comparte con los tuyos! :purple_heart: . #CMMBR #TipsCMMBR #LaSaludATuAlcance #Coronavirus
2231652813631818201; 1; False; 1580253768; Jon's headed through LAX ( > Phoenix and back) tomorrow, prayers appreciated :folded_hands::folded_hands::face_with_medical_mask::face_with_medical_mask: . #work #sound #coronavirus #china #lax #la #phoenix #boomoperator
2231652768158771746; 1; False; 1580253762; :skull::skull::skull: • Follow @chinavirus2020 for more
2231652738234661208; 0; False; 1580253759; . . #coronavirus #ecuador #fun #divertido
2231652395124420397; 6; False; 1580253754; Ils l'ont pas respecté :face_with_medical_mask::grinning_face_with_sweat::face_with_medical_mask::grinning_face_with_sweat::face_with_medical_mask::grinning_face_with_sweat::face_with_medical_mask: #Coronavirus #China #france #Paranoïa
2231652679229220867; 0; False; 1580253752; #memes #dankmemes #edgymemes #anime #wipawinomemes #starwars #ecchi #offensivememes #memedealer #shrekmemes #yodamemes #babyyoda #bruh #shrekmemes #corona #coronavirusmemes #coronavirus
2231652667359244756; 0; False; 1580253750; JIMS HONEY X OKIE AGUSTINA Aurora Bag, designer's bag catered for Muslimah :smiling_face_with_heart-eyes: . Tas modis stylish penuh warna dengan 2 ruang besar + 1 area penyimpanan besar yang dilengkapi dengan zipper . Aurora Bag juga memiliki tali panjang, so, bisa banget untuk kamu jadikan sebagai sling bag . Dengan berat hanya 700gr, sudah pasti Aurora Bag pilihan terbaik untuk menemani aktivitas harianmu kapanpun, dimanapun :hugging_face: . catch our first ever collaboration product, produk hasil kolaborasi PERTAMA dari @jeje_collections :two_hearts: . Price : 236.000 SALE 30% menjadi 166.000 :money_bag: . Order :backhand_index_pointing_down: Line :backhand_index_pointing_right: johana_c WA :backhand_index_pointing_right: https://api.whatsapp.com/send?phone=6287768772787 Instagram :backhand_index_pointing_right: @jeje_collections Shopee :backhand_index_pointing_right: JeJe Collections Jims Honey . #iCarryJH #JHAurora #AuroraBag #OkieAgustina #gisel #gempi #garagaragempi #jimshoneyjakarta #jimshoneybatang #jimshoneyjepara #jimshoneysemarang#jimshoneykramat#jimshoneyadiwerna#jimshoneytegal#jimshoneybrebes#jimshoneypemalang#jimshoneypekalongan#jimshoneyslawi#viral#hoteldelluna#jichangwook#nikitamirzani#coronavirus
2231652631785490764; 0; False; 1580253746; Humour noir de fin du monde. #quotes #texte #instabd #instaecrit #collapsologie #findumonde #ecologie #sante #coronavirus #virus #medical
2231652609999994519; 6; False; 1580253743; Let’s discuss how can we protect from CoronaVirus:backhand_index_pointing_down_light_skin_tone::exclamation_mark: . #coronavirus #coronavirusoutbreak #virus #wuhan #wuhanvirus #coronaviruschina #wuhanchina #corona #coronovirus
2231652547436163365; 2; False; 1580253736; Vamos agora investir em receitinhas que ajudam a dar um up na imunidade? . Nessas combinações encontramos: :play_button:Magnésio :play_button:Vitamina C :play_button:Vitamina A :play_button:Bromelina :play_button:Ácido láurico :play_button:Curcumina :play_button:Gingerol . Eles atuam no sistema imunológico, reduzem inflamação e colaboram com o funcionamento do trato gastrointestinal. . Gostou? Clica no aviãozinho e manda pra aquela amiga que precisa melhorar a imunidade dela! . Ainda temos a 3a parte da nossa sequência sobre imunidade. . Alexandra Menezes Nutricionista Emagrecimento e Saúde da Mulher :hibiscus: #coronavirus #imunidade #saude #epidemia #nutricaoeimunidade #sistemaimunologico
2231652541882490019; 0; False; 1580253735; JIMS HONEY X OKIE AGUSTINA Aurora Bag, designer's bag catered for Muslimah :smiling_face_with_heart-eyes: . Tas modis stylish penuh warna dengan 2 ruang besar + 1 area penyimpanan besar yang dilengkapi dengan zipper . Aurora Bag juga memiliki tali panjang, so, bisa banget untuk kamu jadikan sebagai sling bag . Dengan berat hanya 700gr, sudah pasti Aurora Bag pilihan terbaik untuk menemani aktivitas harianmu kapanpun, dimanapun :hugging_face: . catch our first ever collaboration product, produk hasil kolaborasi PERTAMA dari @jeje_collections :two_hearts: . Price : 236.000 SALE 30% menjadi 166.000 :money_bag: . Order :backhand_index_pointing_down: Line :backhand_index_pointing_right: johana_c WA :backhand_index_pointing_right: https://api.whatsapp.com/send?phone=6287768772787 Instagram :backhand_index_pointing_right: @jeje_collections Shopee :backhand_index_pointing_right: JeJe Collections Jims Honey . #iCarryJH #JHAurora #AuroraBag #OkieAgustina #gisel #gempi #garagaragempi #jimshoneyjakarta #jimshoneybatang #jimshoneyjepara #jimshoneysemarang#jimshoneykramat#jimshoneyadiwerna#jimshoneytegal#jimshoneybrebes#jimshoneypemalang#jimshoneypekalongan#jimshoneyslawi#viral#hoteldelluna#jichangwook#nikitamirzani#coronavirus
2231652440288325437; 3; False; 1580253723; Editing ... masks are getting sold out .. the fear of #coronavirus has everyone using one #reporter #news #newslife:television::movie_camera: #cameraman #mpocovering
2231648874627820060; 0; False; 1580253720; kalau tidak ada cctv bisa jadi tukang bakso ini akan mendekam di penjara selama 15 tahun, berhati-hatilah saat nogkrong di luar, karena bisa jadi ada oknum yg ingin mencari pangkat dengan cara memfitnah orang. TKP ; Kalideres, Jakarta Barat . 𝗟𝗜𝗞𝗘 𝗗𝗔𝗡 𝗙𝗢𝗟𝗟𝗢𝗪 𝗞𝗔𝗠𝗜 𝗕𝗜𝗔𝗥 𝗧𝗜𝗗𝗔𝗞 𝗞𝗘𝗧𝗜𝗡𝗚𝗚𝗔𝗟𝗔𝗡 𝗕𝗘𝗥𝗕𝗔𝗚𝗔𝗜 𝗞𝗢𝗡𝗧𝗘𝗡 𝗦𝗘𝗥𝗨 𝗟𝗔𝗜𝗡𝗬𝗔 . #coronavirus #coronaviruschina #infoterkini #infosurabaya #infobandung #infoindonesia #beritaterkini #beritaheboh #beritaterbaru #beritaviral #beritaindonesia #beritaharian #beritanasional #beritahariini #beritapolisi #beritamedan #kecelakaan #infounik #infosurabaya #infomedan #infokalteng #chinavirus #viruscorona #kalimantanselatan #viruscoronachina #infokalimantan
2231652340415698680; 0; False; 1580253711; Watch when we all die smh :face_with_tears_of_joy: #coronavirus #memes #shitpost #lmao
2231652002505187764; 1; False; 1580253709; Repost from @freedom_faction • Thoughts? A senior scientist who participated in a simulation of the global impact of a #coronavirus outbreak has stated that “the cat is out of the bag” when it comes to the virus and that #China is unlikely to contain its spread. Eric Toner, Senior Scholar with the Johns Hopkins Center for Health Security and Senior Scientist in the #JohnsHopkins Bloomberg School of Public Health, Department of Environmental Health and Engineering, said during an interview with CNBC that China’s efforts to contain the current outbreak of the rapidly spreading upper-respiratory illness known as 2019-nCoV are “unlikely to be effective.” Three months ago Toner, along with the #WorldEconomicForum and the #BillAndMelindaGatesFoundation, took part in a simulation called #Event201 centered around a fictional coronavirus (not 2019-nCoV) named CAPS that could potentially kill hundreds of millions of people under the right circumstances. Johns Hopkins Center for Health Security recently issued a statement about Event 201: “Recently, the Center for Health Security has received questions about whether that pandemic exercise predicted the current novel coronavirus outbreak in China. To be clear, the Center for Health Security and partners did not make a prediction during our tabletop exercise. For the scenario, we modeled a fictional coronavirus pandemic, but we explicitly stated that it was not a prediction.” The #WorldHealthOrganization (WHO) has declined to call the situation a global emergency at this time. However, the #Geneva-based organization stated that it considers China’s current situation a health emergency. As of Sunday night WHO director-general Tedros Adhanom Ghebreyesus was on his way to Beijing to “strengthen our partnership” with China “in providing further protection against the outbreak,” according to Reuters. :hand_with_fingers_splayed_medium-dark_skin_tone:More in comments:backhand_index_pointing_down_medium-dark_skin_tone:#Biowarfare #PopulationControl
2231652317388058895; 0; False; 1580253709; Tag a friend to infect them with Corona Virus memes :face_with_medical_mask: . . . . . #coronavirus #coronavirusmemes #dankmemes #memes #meme #memesdaily #funnymemes #funny #dank #lol #edgymemes #offensivememes #dankmeme #lmao #dailymemes #follow #edgy #fortnite #dankmemesdaily #comedy #memestagram #like #humor #anime #minecraft #funnyvideos #tiktok #spicymemes #memer #memez
2231652271736116128; 1; False; 1580253703; #coronachan #coronavirus #coronaoutbreak #coronabatman #corona_perfect_night
2231652206802002366; 0; False; 1580253695; Assalamu alaikum Minggu ini kita ditakutkan ttg adanya berita Corona virus yg menyebar ke Indonesia.. Kita memerlukan solusi untuk preventif mengatasinya. Alhamdulillah Propolis diciptakan sbg produk lebah yg bersifat farmakologis atas izin Allah untuk mengatasinya. Abstrak laporan berikut mengabarkan manfaat propolis thd virus corona tsb..... ikhtiar dan gunakan melia propolis yg asli dgn dosis yg tepat untuk preventif. Share dari bpk Prof.Almahdy, Apt. #propolis #virus #coronavirus #melia #propolismelia #meliasehatsejahtera #bakteri #virus #jamur #sehatsetiaphari
2231646646016589455; 15; False; 1580253627; Estou vendo em algumas postagens em páginas dizendo que não devemos falar sobre o Coronavírus para não gerar medo, a questão é que isso vai além do medo, isso se trata de empatia e solidariedade por pessoas que estão morrendo e ainda não temos respostas de como essa doença surgiu e como está ocorrendo de fato. - Em média temos a ideia de baixa de super população, arma biológica , guerra de engenharia genética, enfim, a grande questão é que só quem mora na China nesse momento sabe o que está passando. Não só lá mas como todo mundo só se fala disso e recebi esse vídeo cuja filha mostra a mãe doente presa dentro do quarto, porém o contato ocorre só de estar perto. - Parece coisa de filmes, a mídia não vai divulgar a verdade pois existem acordos por trás disso, mas a situação não está totalmente perdida, acredito que muita gente irá morrer sim , infelizmente, a massa pobre e menos favorecida da sociedade enquanto os ricos preparam sua saida para lua :new_moon: - Vamos orar e pedir a Deus que isso possa ser controlado e que não fuja do controle da raça humana para que nossos irmaos estelares nao precisem intervir, o que seria bem pior. - Para alguns, apenas teoria da conspiração, mas para outros apenas um alerta do que se aproxima a humanidade em seu desfecho original. - Que se de acordo com o tratado de paz e de acordo com as leis da federação galática os humanos se gerassem uma guerra nuclear, haveria internação das raças estelares e se o intuito das guerras era diminuir a população, acredito que pensaram em uma ideia nova, silenciosa e bélica e que está matando do mesmo jeito. - Eu realmente não posso especular , mas algo ainda vai acontecer mais à frente! Se preparem! Vamos orar e ter fé pela mudanca cristica do planeta terra :folded_hands_light_skin_tone::sparkles: - COMPARTILHE COM SEUS AMIGOS:recycling_symbol: - :warning:MARQUEM SEUS AMIGOS:warning: - :double_exclamation_mark:Ative as notificações :double_exclamation_mark: - #despertar #nibiru #anunnaki #instalikes #ovni #extraterrestrials #confederacaodemundos #novaera #thematrix #espiritualidade #historian #ufologia #alien #reptilianos #likeforfollow #instalikes #chemtrail #coronavirus #chemtrailspraying #coronavirusoutbreak #followforfollowback #instagram #virus #china:China: #orion #fema #alertamundial #china
2231651547773822269; 0; False; 1580253617; Assalamu'alaikum warohmatullahi wabarakatuh. Setiap orang pasti pernah mengalami masa kelam, tapi setiap orang punya kesempatan untuk berhijrah ke arah yang lebih baik. Sahabat-sahabatku, mari hadiri kajian Tabligh Akbar "Bengkulu Berhijrah" yang insyaAllah akan dilaksanakan pada: Hari, tanggal : Ahad, 9 Februari 2020 Waktu : 08.00 WIB s.d selesai Tempat : Masjid Raya Baitul Izzah Pemateri : -Ust. Fakhrurrazi Anshar Lc. M.A (Alumni University of Sudan Africa) -Mario Irwinsyah (Artis Hijrah) Hadirlah dan rebutlah semua majelis yang ada, karna ia dapat menghidupkan hati yang mati, dan sekiranya di dalam majelis ilmu membincangkan tentang ilmu yang sudah engkau ketahui, anggaplah itu pertama kali engkau mendengarnya, seakan akan kamu belum mempelajarinya. Banyak yang ingin berhijrah tapi tak pernah memulai, Banyak yang ingin berubah tapi tak pernah melangkah, Hijrah tanpa tindakan hanya akan menjadi angan, Perubahan tanpa realisasi hanya akan menjadi mimpi. Catat tanggal dan waktunya! Jadikan Bengkulu Berhijrah sebagai langkah nyata kita menggapai ridho Nya. *Jangan lupa bawa tumblr, Ayo less waste. #bengkuluberhijrah #ayohijrah #lesswaste #bawatumblermu #ngopibengkulu #syababbengkulu #riridpdri #bengkulufillah #ngajikaffah #tholabulilmi #ceramahislam #dakwahislami #oneminutedakwah #dakwahitucinta #motivasihijrah #dakwah_tauhid #hijrahkuy #pemudahijrah #hijrahku_dakwahku #perindusurga #penabengkulu #sahabatpb #sahabatekspresipositifmu #corona #korona #virus #coronavirus
2231623918434096379; 0; False; 1580253607; Share it with everyone #china #wuhan #wuhanvirus #coronavirus #冠状病毒 #冠狀病毒 #virus
2231650904637844137; 0; False; 1580253540; Hi people. The new Corona Virus is very serious. If people call it the Chinese Virus, I would like to say that they are very wrong because it happens world wide. Because this Corona Virus is very serious and dangerous, please, I mean, please, wash your hands very frequently and avoid going to crowded places and DON'T sneeze or cough on any other people. REMEMBER, IF YOU FEEL LIKE YOUR SICK IN ANY WAY, GO TO THE HOSPITAL IMMEDIATELY TO MAKE SURE IT IS NOT CORONA VIRUS. #coronavirus #corona
2231650156801743968; 1; False; 1580253451; None
2231649877360452105; 0; False; 1580253418; #coronavirus #china #outbreak #health #WuhanVirus
2231646408930161226; 0; False; 1580253247; #pray #for #china #coronavirus #:folded_hands_light_skin_tone: #:red_heart:
2231648351271951948; 0; False; 1580253236; Siapa nih yg takut nimbang?? :grinning_face_with_sweat: Yuk bersahabat dengan timbangan :smiling_face_with_heart-eyes::smiling_face_with_3_hearts: . kalian nga akan pernah percaya klw belum mencoba :kissing_face_with_closed_eyes: . Yuk ikutan kelas diet bln ini,jangan ditunda2 lagi:double_exclamation_mark: . Kalian memang nga akan bisa percaya,klw nga membuktikannya sendiri:double_exclamation_mark::smiling_face: . HADIAH SPECIAL Hanya untuk 10 peserta saja:double_exclamation_mark: . Mulai kelas program tgl 25 Februari 2020 Close pendaftaran tgl 20 februari 2020 SLOT TERBATAS :double_exclamation_mark: . :bento_box: Menu makan Bervariasi setiap hari :cookie: Bisa makan 5x (termasuk 2x ngemil) :shopping_bags: Daftar belanjaan diet :doughnut: snack ideals :woman_lifting_weights: Panduan olahraga dari Rumah :telephone_receiver: one by one support coach :two_women_holding_hands: Grup Support :money_bag: Potensi Menangkan hadian Cash *Syarat dan ketentuan berlaku . Daftar? : Klik Link di bio ig @unhie90 Atau WA ke: 0896-1017-0106 . Untuk Info Selanjutnya :double_exclamation_mark: . #dietsehat #diet #dietherbalife #dietsehatmakassar #hidupsehat #begadang #langsing #ibumuda #bodygoals2019 #haruskurus #programlangsing #ibuibu #antipelakor #sayangsuami #ibucantik #ibusehat #mahmudcantik #cantik #sehat #maukurus #mausehat #MUA #muamakassarhits #muaindonesia #cantikcantik #sule #istrisulemeninggal #syahnazsadiqah #coronavirus
2231645691948863587; 0; False; 1580252919; Banyak yah Karbo pengganti Nasi.. Jadi jangan dibilang blm makan kalau blm makan nasi :grinning_face_with_sweat: . kalian nga akan pernah percaya klw belum mencoba :kissing_face_with_closed_eyes: . Yuk ikutan kelas diet bln ini,jangan ditunda2 lagi:double_exclamation_mark: . Kalian memang nga akan bisa percaya,klw nga membuktikannya sendiri:double_exclamation_mark::smiling_face: . HADIAH SPECIAL Hanya untuk 10 peserta saja:double_exclamation_mark: . Mulai kelas program tgl 25 Februari 2020 Close pendaftaran tgl 20 februari 2020 SLOT TERBATAS :double_exclamation_mark: . :bento_box: Menu makan Bervariasi setiap hari :cookie: Bisa makan 5x (termasuk 2x ngemil) :shopping_bags: Daftar belanjaan diet :doughnut: snack ideals :woman_lifting_weights: Panduan olahraga dari Rumah :telephone_receiver: one by one support coach :two_women_holding_hands: Grup Support :money_bag: Potensi Menangkan hadian Cash *Syarat dan ketentuan berlaku . Daftar? : Klik Link di bio ig @unhie90 Atau WA ke: 0896-1017-0106 . Untuk Info Selanjutnya :double_exclamation_mark: . #dietsehat #diet #dietherbalife #dietsehatmakassar #hidupsehat #begadang #langsing #ibumuda #bodygoals2019 #haruskurus #programlangsing #ibuibu #antipelakor #sayangsuami #ibucantik #ibusehat #mahmudcantik #cantik #sehat #maukurus #mausehat #MUA #muamakassarhits #muaindonesia #cantikcantik #sule #istrisulemeninggal #syahnazsadiqah #coronavirus
2231643143881751017; 2; False; 1580252615; here’s to not getting the coronavirus while we were in asia @travelinlainey #lowfive #latergram #blessed #ninhbinh #vietnam #hangmua #muacaves #lyingdragonmountain #allthewayup #travel #vacation #girlstrip #flightattendant #thoseviews #asia #wheretonext #coronavirus
2231640714307993898; 0; False; 1580252325; #tbilisi #banya #pushkin #wash #clean #california155 #travel #time #justalreadydothis #in #time #whattheweatherliketoday #londonisthecapitalofgreatbritain #myway #yourway #sysertcity #7days #sixdays #bestdays #gooddays #yourdays #mydays #coronavirus #antivirus #venera #ololo #heahtag
2231531210962534001; 5; False; 1580239271; @cdcgov @cdcglobal hope you guys are at the top of your game and not slipping. I hope, you openly release all information you have on this , virus!! #ncov #ncov2019 #wuhan #wuhanvirus #wuhancoronavirus #coronavirus #coronavirusoutbreak #cdc #worldhealthorganization
2231216269741622315; 0; False; 1580202078; #medicalclubju #MedClubJu #الجامعة_الاردنية #النادي_الطبي #virus #coronavirus #كورونا #كورونا_فايروس #مرض_الكورونا
1832900163909641288; 7; False; 1532718748; What kind of position is this!? #grinding #l4l #usualhandpose #freshcut #picofday #coronavirus #coronavirusoutbreak #kobe #kobebryant
795220243722775022; 39; False; 1409017662; #tkdstunts "you ain't see nothing yet" #moisesesg #coronavirus #coronavirusoutbreak #kobe #kobebryant
2231652209257408052; 0; False; 1580253696; :triangular_flag:IMPORTANTE [Comunicado Oficial] El Ministerio de Salud confirma estado crítico de paciente con sospecha de #coronavirus en #Ecuador.
2231652129324276074; 0; False; 1580253686; #travelhealthwarning #coronavirus #fever #cough #sorethroat #breathingdifficulties #knowthesigns
2231652101784366110; 2; False; 1580253683; meanwhile in china #coronavirusoutbreak #protectcoronavirus #coronavirusmemes #coronavirus #china:China:
2231652094386112756; 0; False; 1580253682; #corona #coronavirus #coronavirusmemes
2231652055403943860; 0; False; 1580253680; Yoooo, that's a bruh moment no cap . . . . #memes#memesdaily#dank#dankmemes#dankmemesdaily#funny#funnymemes#edgy#edgymemes#autistic#autisticmemes#offensivememes#shrek#trump#obama#bruh#callofduty#fortnite#china#india#usa#coronavirus#ps4#xbox#pewdiepie#lmao#lol
2231652072969973765; 0; False; 1580253679; :NEW_button: Auf Initiative der EVP-Gruppe diskutiert das Europäische Parlament heute Maßnahmen zur Handhabung des #Coronavirus. :round_pushpin: Mittwoch, 29 Januar, 18.15 MEZ :television: Livestream: https://europarl.europa.eu/plenary/en/home.html @cducsueuropa @eppgroup #eppgroup #corona #viren @gesundheit.pflege.bayern @jensspahn @melanie.huml.bamberg
2231652006632000517; 0; False; 1580253679; #Repost @dali.islam @download.ins --- The situation in instead of #wuhan escalates more and more among the residents ... . . #china #coronavirus . . @dali.islam @dali.islam
2231651749353823428; 14; False; 1580253674; Çin halkı iyice mal olmaya başladı :face_with_tears_of_joy: #koronavirüsü #koronavirus #çinvirüsü #sondakika #sondakika #önemli #china #news #breakingnews #breaking #haber #gündem #coronavirus#sondakika #önemli #haber #gündem #karantina #coronavirüsü #koronavirus #koronavirüsü #Wuhan kentindeki sağlık çalışmaları yetmiyor. Çin'de karantina altına alınan şehir sayısı yükseliyor. Daha fazlası için takip etmeyi unutmayın :red_heart: @saglikbakanligi Daha fazlası için takip etmeyi unutmayın :red_heart: #corona #coronavirus #türkiye #tsk #hastalik #istanbul:Turkey: #kolombiya #istanbul #saglikbakanligi #cin #çin #woman #coronavirus #abd #trump #salgın #virus #
2231651923693803680; 1; False; 1580253662; Governador Wilson Lima determinou alerta máximo da rede estadual de saúde para as síndromes gripais https://bit.ly/2u0vLlv . . . #comiteestadual #coronavirus #respostarapida #amazonas #amazônia #wilsonlima
2231651891557773005; 0; False; 1580253658; Happy Corona New Year :rat: :China: :microbe: #dessin #bandedessinee #bd #instabd #dessindujour #violenteviande #nouvelanchinois #nouvelan2019 #chine #coronavirus #strip #draw #drawing
2231651789736605363; 0; False; 1580253646; KENYATAAN MEDIA SEBAR BERITA PALSU WABAK NOVEL CORONAVIRUS (2019-nCov): SEORANG INDIVIDU DITAHAN UNTUK MEMBANTU SIASATAN #AKM1998 #beritapalsu #Coronavirus #KKM #KKMM #MCMC #PDRM #seksyen233 #tidakpastijangankongsi
2231651787504189400; 5; False; 1580253645; How I’m dressing when my Asian friends come over to visit. #coronavirus #wearmasks
2231651775710986967; 0; False; 1580253644; :dna::dna::dna:¿Cómo luce el nuevo #coronavirus nombrado 2019-nCoV?:thinking_face::thinking_face::thinking_face: El Centro Nacional de Datos Microbiológicos de China publicó imágenes de microscopio electrónico del nuevo coronavirus extraídas de dos pacientes en Wuhan, China. Las dos primera imágenes corresponden a muestras extraídas el 6 de enero y la tercera de una muestra del 22 de este mes en curso.
2231651769628709902; 0; False; 1580253643; Vai ser choque de monstro. :beer_mug::zzz::butterfly::beer_mug::zzz::butterfly::beer_mug::zzz::butterfly::beer_mug::zzz::butterfly: #botecoliberal #direita #esquerda #dengue #saude #medicina #humor #brasil #coronavirus #simpsons #rupaulsdragrace #pabllo #maconha #canabis
2231651759722295791; 2; False; 1580253642; How I’m dressing when my Asian friends come over to visit. #coronavirus #wearmasks
2231650882232475145; 0; False; 1580253637; Follow My Boy @ubraw !! The guy has the best street vids on Instagram!! He’s a real One #ubraw #fights #streetnews #coronavirus #birmingham #barbershop @dailymail @grmdaily @getthemirror @nowthisnews
2231651707560359161; 0; False; 1580253636; Follow for more! Fr:( • • #meme #memes #bestmemes #instamemes #funny #funnymemes #dankmemes #offensivememes #edgymemes #spicymemes #nichememes #memepage #funniestmemes #dank #memesdaily #jokes #memesrlife #memestar #memesquad #humor #lmao #igmemes #lol #ebola #corona #virus #coronavirus #china #ww3 #WW3
2231651688268629478; 1; False; 1580253634; Saat 02:19 29 Ocak Çarşamba 2020 . . . . #corona #coronavirus #coronavirüsü #coronavirüs #coronavírus #coronavirusmemes #coronavirusoutbreak
2231651080159553351; 0; False; 1580253622; It’s going to get bad! #utah #sick #coronavirus #school #sdv
2231651484297443976; 5; False; 1580253617; Would you try this? . So as this #coronavirus continues to spread speculation that It started from Chinese people eating #batsoup and snakes that’s infected with the virus. 5 cases have been confirmed in the US and over 100 have died in China and over 44,000 possibly infected :face_vomiting: #food #china #tanzania #virus #foodporn
2231651286016336732; 5; False; 1580253617; :black_small_square:En conferencia de prensa, el ministro de Salud Julio Mazzoleni informó de un caso sospechoso de #Coronavirus. . :black_small_square:El paciente estuvo en la zona afectada y está bajo estricto monitoreo. . :mobile_phone_with_arrow: Video completo en nuestro canal de YouTube: ABC TV Paraguay. . . #ABCTVPy #Paraguay #Noticias #Nacionales #Coronavirus #Salud
2231651527961149360; 0; False; 1580253614; Hong Kong seems to be very quiet recently... Don’t panic, just wear a mask, wash your hands and all will be fine ! . [CN] 香港最近似乎很安静...不要惊慌，只需戴上口罩，洗手，一切都会好起来的 ！ . [FR] Hong Kong semble être très calme récemment... Ne paniquez pas, portez simplement un masque, lavez-vous les mains et tout ira bien ! #:China:#:Hong_Kong_SAR_China:#:face_with_medical_mask:#HongKong #香港 #China #中國 #tamarpromenade #hongkongisland #flu #coronavirus #ifc #chinesenewyear #travelphotography #travelblogger #travelgram #cuteboy #ricequeen #travelgayasia #小鲜肉 #西方人 #instaboy #travelgay #gay #instagay #gayboy #gayhongkong #gaychina #lfl #fff
2231651505529093301; 0; False; 1580253612; 仕事に戻ります〜 Back to work. Better be prepared. . . . . . #ダイエット #アラサー #公開ダイエット #減量 #diet #アラサーダイエット #ウェディングダイエット #妊活 #pregnancy #loseweight #ダイエット日記 #妊活スタート #weightloss #healthylifestyle #plankwithclaire #ダイエット記録 #weightlossjournal #intermittentfasting #インスタダイエット #coronavirus #intuitiveeating #intentionalliving #healthyfood #gym #health #healthyeating #exercise #トレーニング #ヘルシー #healthylifestyle
2231651458638755769; 4; False; 1580253606; Say NO to #coronavirus :stop_sign: . :white_small_square:wash your hands w/ soap & water x 20s :white_small_square:avoid touching your :eyes:, :nose:, :mouth: with unwashed hands :white_small_square:cover your :mouth: and :nose: when cough/sneeze
2231651440894699417; 0; False; 1580253604; Wash your hands – frequently, thoroughly, and with soap. ・ ・ ・ #bagelthebear #illustration #vectorart #coronavirus
2231651369969214853; 0; False; 1580253604; Follow for more! Run. • • #meme #memes #bestmemes #instamemes #funny #funnymemes #dankmemes #offensivememes #edgymemes #spicymemes #nichememes #memepage #funniestmemes #dank #memesdaily #jokes #memesrlife #memestar #memesquad #humor #lmao #igmemes #lol #ebola #corona #virus #coronavirus #china #ww3 #WW3
2231651407241332237; 0; False; 1580253600; Escolhi a pior hora para visitar Porto Alegre :face_screaming_in_fear::face_with_medical_mask: #ministeriodasaude #portoalegre #coronavirus
2231651291845814027; 0; False; 1580253586; #memes #dankmemes #edgymemes #anime #wipawinomemes #starwars #ecchi #offensivememes #memedealer #shrekmemes #yodamemes #babyyoda #bruh #shrekmemes #corona #coronavirusmemes #coronavirus
2231651238160565808; 0; False; 1580253580; Sabia que as principais Epidemias mundiais se deram sempre com o #Planeta #Jupiter a fazer aspectos a #Neptuno?! É verdade e o #coronavirus nao é excepcao, só que desta vez, o Baile astrológico nao acaba aqui.... a aliar-se a esta verdadeira "festa astrologica" juntam-se tambem #Saturno - antigo planeta associado à Morte e agora associado a reestruturações e #Plutao, actual planeta associado à Morte. A ultima vez que esta mesma conjugação astral ocorreu, surgiu a #Sida. Será que este virus veio para ficar? Podera transformar-se numa #Pandemia? As respostas estão ainda no #segredodosdeuses mas todo o cuidado é pouco, porque a formula não é nada convidativa... Jupiter - Expansão/Crescimento Neptuno - Desconhecido/Escondido Saturno - Reestruturação/Morte Plutao - Morte Uma doença desconhecida expande, ganha notoriedade e dimensao é mortal e obriga a grandes reestruturações. @nasminhasmaosofuturo
2231651197987356689; 0; False; 1580253575; Coronavirus • Follow @marsha_1v1 • • • • #coronavirus #meme #memes #like #follow #comment #likeforlikes #followforfollowback #like4likes #like4follow #likeforfollow #spongebobmemes #spongebob
2231651201552624392; 0; False; 1580253575; Edward mãos de piroca . . . . . . . . . . . .#filme #filmes #caxiasdosul #memes #memesbr #southamericamemes #memesbrasil #rock #escola #hunor #amor #futebol #estadual #fit #fitness #engracado #meme #netflix #domingo #find #acabou #coronavirus #cinema #filmes
2231651160305877673; 49; False; 1580253571; just in; there was an earthquake following a tsunami in Jamaica, I’m really hoping it gets better after January ends, sending love to the whole world at this point :pleading_face::pleading_face::pleading_face::pleading_face: . . . . . #kobebryant #jamaica #jamaicaearthquake #australia #australiafires #coronavirus #corona #2020 #worldwar3 #selfcare #selfcarethreads #tweets #twitter #twitterthreads #twitterposts #twitterthread #trend #trending #trendingnow #explore #explorepage #news
2231651050019134684; 0; False; 1580253557; Aquí un sitio para estar al tanto de los avances científicos en el combate del #coronavirus #coronaviruswuhan :woman_health_worker_light_skin_tone::victory_hand_light_skin_tone::dizzy: https://t.co/bZIVCPMDCZ
2231650695383407573; 1; False; 1580253545; Thank God for the helper who keeps us on the straight and narrow path.. without the Holy Spirit. :fire::fire:The Christian life is impossible to live :dove: #allhavefallenshort
2231650920666820416; 0; False; 1580253542; Información al 28 de enero sobre la epidemia de coronavirus de Wuhan. Tres ciudadanos chinos y una peruana han sido aislados en el hospital Dos de Mayo ante riesgo de haber contraído la enfermedad. . Fuente: OMS / Ministerio de Salud Perú. . Ilustraciones de @pictoline . #coronavirus #gripe #neumonia #epidemia #alerta #oms #minsa #wuham #china
2231650187637890441; 2; False; 1580253539; And we all though 2020 would be our year :sleepy_face: #ripkobybryant #ripkobe #australianbushfires #coronavirus #ww3 #tiktok
2231650858432829673; 7; False; 1580253535; PEOPLE VERY GRAPHIC BUT PLS READ AND SWIPE !! Chinese culture does this they eat rats cat dog which is why they use it in restaurants but wild animals carry diseases and these bats are reported the cause of the new virus that’s killing ppl rapidly #Repost @karmagawa with @get_repost ・・・ :warning:WARNING GRAPHIC IMAGES:warning: Please share this URGENT post about the coronavirus epidemic with your followers as the origin of the virus has been traced to the zone of the Wuhan market where live wild animals like snakes, rats, bats and monkeys were traded before China instituted a temporary ban yesterday. But a temporary ban is NOT enough, WE MUST use our social media platforms to spread awareness and BAN WILD ANIMAL TRADING WORLDWIDE as this is EXACTLY what caused the SARS virus that killed nearly 800 people in 2003! SARS was 17 years ago and yet these markets are doing the exact same thing, selling live wild animals in unhygienic conditions that create diseases with devastating consequences for the entire human race! This new virus, which has no vaccine, has killed 82 people with 2,887 confirmed cases in 15 countries, numbers which have increased 50% SINCE YESTERDAY and 60 million more people are on lockdown to prevent further spreading. To stay updated in real-time our US followers can now text us at 323-310-1679 and also follow @karmagawa on Instagram too. Please pray for the world and share this URGENT post with your followers and tag people, celebrities, influencers and news media that need to see this and let’s work together to PERMANENTLY ban the trading of wild animals that create these deadly viruses! #coronavirus #endanimalcruelty #coronavirusoutbreak #karmagawa
2231650837747216044; 0; False; 1580253532; Un #mariage #wedding in #wuhan #china #coronavirus #:face_with_medical_mask: #:face_screaming_in_fear: #:bride_with_veil: #:man_in_tuxedo: #:eyes:
2231650803731291389; 0; False; 1580253528; Awareness regarding corona virus please share... . . #coronavirus #awareness #humanity #youtuber #tiktokers #instagram
2231650770385475061; 4; False; 1580253524; Assalamu'alaikum pagi bro/sist:smiling_face::smiling_face::smiling_face: Pa kabar neh? moga Allah selalu memberikan kesehatan untuk kita semua...dan virus Corona yang lagi mewabah itu segera sirna...umat muslim selalu Allah jaga...aamiin:folded_hands::folded_hands:ini postingan pertama di tahun 2020 hihihi...maafkan jarang posting karena riweuh:grinning_face_with_sweat: tapi jellyfish tetep buka lo ya...jadi langsung aza meluncur ato delivery juga bisa ya:beaming_face_with_smiling_eyes::beaming_face_with_smiling_eyes::beaming_face_with_smiling_eyes: . . . #jajanan #pancake #jajan #makananhits #makananenak #makanmakan #cicalengkapunya #makanterus #makan #cicalengka #makanan #makanankekinian #cicalengkahits #ceritamakan #cafe #jajanenak #coronavirus
2231646967753332296; 1; False; 1580253518; De partir o coração: Vídeo mostra moradores de #wuhan (epicentro do surto do Coronavírus) na varanda de seus apartamentos gritando e cantando canções patrióticas, e o hino da China para se animarem. Wuhan, com 11 milhões de habitantes está em quarentena. A cidade está isolada pelo o Governo Chinês desde quinta-feira ( 23 ). Ruas e aeroportos vazios, hospitais lotados. :microbe: #pandemia #wuhan #oms #saude #virus #coronavirus
2231650667953872262; 2; False; 1580253512; New Coronavirus strain. Wear masks guys! #coronavirus
2231650627300292247; 0; False; 1580253507; Special deliveries going out across the world to help defend against the #coronavirus. For those asking, fulfillments are taking place as fast as possible and we are working day in and day out to deliver help to those in need! :face_with_medical_mask:
2231650602957732068; 4; False; 1580253504; 1.28.2O Downtown NYC aka Chinatown have been confirmed. Idc what others think, wear mask. Be safe everyone. #coronavirus #facemask 28/366
2231649200675100083; 2; False; 1580253503; Wishing you all a happy & healthy 2020. ⠀ ⠀ Please continue to #prayforhongkong and also the world with regard to the #coronavirus :folded_hands_light_skin_tone:⠀ ⠀ My prayers go out to everyone, medical care professionals and frontline workers. :hospital:
2231650447366362246; 6; False; 1580253502; Say sike rn:flushed_face:
2231650576718749679; 0; False; 1580253501; # #QueDeusnosproteja #repost @minsaude ・・・ O Ministério da Saúde informa que foi notificado de outros dois casos suspeitos do novo coronavírus no Brasil. Assim, no total, três casos suspeitos da doença são monitorados pelas autoridades de saúde brasileiras. Eles estão localizados em Porto Alegre (RS) e Curitiba (PR), além de Belo Horizonte (MG), noticiado nesta manhã. Confira a notícia completa no Portal Saúde. Acesse: saude.gov.br #NovoCoronavírus #coronavirus
2231649288680378631; 25; False; 1580253501; EL PRIMER CONTAGIADO POR EL CORONAVIRUS. PORTADORA EN CALI. PRECAUCION.:face_vomiting::zany_face::face_vomiting::zany_face::face_vomiting::zany_face::face_vomiting: #humorcolombiano #barranquilla #medellin #colombia #cali #bogota #risa #risas #beso #pasion #recuerdo #tramo #juntosomosmas #amorincondicional #amorpropio #findesemana #moments #videosgraciosos #mujeres #influencer #videos #instagramer #coronavirus #coro #corona
2231650576901628397; 0; False; 1580253501; Reposted from @shahihfiqih :paperclip: MEMOHON AMPUNAN DAN KASIH SAYANG ALLAH . رَبَّنَا آمَنَّا فَاغْفِرْ لَنَا وَارْحَمْنَا وَأَنْتَ خَيْرُ الرَّاحِمِيْنَ . . “Ya Rabb kami, kami telah beriman, maka ampunilah kami dan berilah kami rahmat dan Engkau adalah pemberi rahmat yang paling baik.” (Qs. Al-Mu’minun: 109) . . :right_arrow: Ingin mencetak Poster diatas? Yuk download versi high resolution : https://shahihfiqih.com/3g2x . . __________________ . :globe_showing_Asia-Australia: Web | shahihfiqih.com. :desktop_computer: Youtube : youtube.com/shahihfiqih. :globe_with_meridians: Telegram : @shahihfiqih - bit.ly/1S3K8sW . :mobile_phone: Instagram : Instagram.com/ShahihFiqih . :television: Twitter : twitter.com/shahihfiqih. :laptop_computer: Facebook : facebook.com/shahihfiqih. . . #serialdoashahihfiqih #doa #kumpulandoa #doamustadjab #ampunan #shahihfiqih #kasihsayangAllah #rahmatallah #dosa #maksiat #wabah #wuhan #taubat #corona #coronavirus #dosa #bencanaakibatdosa #dosamaksiat #syirik #bertaubat #kasihsayang #muhasabah - #regrann
2231650499625760965; 0; False; 1580253492; Wow. As soon as I start to feel better after everything that’s happened recently, I read about the Corona virus affecting many in China. I pray that they get healthy and this disease will disappear as soon as it appeared. After this atrocious month it’s more important than ever to tell your loved once you love them. You never know when you won’t be able to. #coronavirus #health #love
2231650493242155935; 0; False; 1580253491; ...matematik dalam kes #coronavirus di #wuhan #chinalaknatullah... bila dah panik dan viral kebanyakan orang mana nak pikir soal fakta dan matematik...tapi cuba renung-renungkan...kita hidup dalam dunia yang dikawal oleh mereka yang berkuasa dan berkepentingan...#hiddenhand #nwo #manmadevirus :smiling_face_with_sunglasses::winking_face::syringe::pill::skull:#wakeup #predictiveprogramming :beaming_face_with_smiling_eyes:
2231650486742909603; 0; False; 1580253490; ... principalement en République démocratique du Congo. Le taux de létalité d’Ebola c’est 66%, le corona c’est du pipi de chat à côté. Qu’on se détende un peu et qu’on arrête de faire des Jeux de mot pourris et racistes sur les chinois roh. . (Quoooi mon dessin qui suit ? :grinning_face_with_big_eyes::rat::microbe:) #citation #quotes #instaecriture #texte #motdujour #instabd #dessin #chine #ebola #virus #nouvelanchinois #coronavirus
2231650456617134347; 0; False; 1580253487; #memes #dankmemes #edgymemes #anime #wipawinomemes #starwars #ecchi #offensivememes #memedealer #shrekmemes #yodamemes #babyyoda #bruh #shrekmemes #corona #coronavirusmemes #coronavirus
2231650349102249725; 0; False; 1580253474; Be aware Of Corona Virus BE SAFE #coronavirus #coronavirusbegone #beawareofcorona
2231650329179345960; 0; False; 1580253471; :microbe::microbe::microbe::microbe::microbe: Vamos ficar atentos aos sintomas e modo de prevenir a infecção por Coronavírus - O vírus que deixou o mundo em alerta! . :microbe::microbe::microbe::microbe::microbe: . #coronavirus #prevencao
2231650262471420181; 1; False; 1580253464; Straya is not doing too well at all :Australia::skull_and_crossbones: :double_exclamation_mark: - #australia #coronavirus #coronavirusmemes
2231650253966077076; 2; False; 1580253463; please be careful of the Coronavirus guys! :sad_but_relieved_face: 코로나바이러스 조심하세요 여러분... :folded_hands_light_skin_tone:
2231650257002226016; 0; False; 1580253463; #memesgraciosos #memesespañol #memelandia #instagram #ecuador #gatosdeinstagram #memes #instagood #coronavirus
2231647913763864851; 0; False; 1580253462; #offtopic #coronavirus In diesem Video geht es nicht um Rap sondern um die Ernsthaftigkeit/ Gefahr des Corona Viruses. Ich bitte euch dieses Video anzuschauen und im voraus Maßnahmen für euch sowie für die Sicherheit eurer engsten zu ergreifen. Teilt dieses Video damit auch eure nächsten informiert werden.
2231650216151281314; 0; False; 1580253458; Close to 16 years ago, we (at least for me) learned more about hand sanitiser into our daily lives ( not just for ocds) due to Sat's 2003 We are as strong as our weakest link. Beyond wearing mask, we need to maintain good hand hygiene. Similarly, proper hand washing is as important as using hand sanitiser. Step 1 wet your hand with wash Step 2 add soap and rub your hands for 10-15 sec (including the back). This is an important step. Step 3 Rinse and dry. Apply sanitiser after that. Use only hand sanitiser alone if you do not have any other alternatives. Do not touch your mouth or face ofte unless they are clean is as important #hygiene #coronavirus #sngapore #alexgphotography
2231650193644530866; 0; False; 1580253455; The boys started drinking water from this probably freshwater lake, we heard it’s healthier than purified water. On another note, one of the homies got hella sick, hope he didn’t get the corona virus and doesn’t die a terrible death lmao. 1 like=1 PhotoBro not dying:mechanical_arm:. #tree #trees #water #branch #reflection #river #lake #hashtag #nature #photography #grass #coronavirus
2231650144318039700; 0; False; 1580253449; Okie Dokie #virus #coronavirus #memes
2231650134378578228; 0; False; 1580253448; El ministro de salud se reunió con el Presidente Alberto Fernández y lo puso al tanto sobre los peligros del virus. "No podemos decir que estamos tranquilos, pero el riesgo es lejano", afirmó el funcionario. . . . . . . . . . . . #coronavirus #gines #ministrodesalud
2231650135644036873; 66; False; 1580253448; :face_with_medical_mask: El ministro Julio Mazzoleni informó sobre un ciudadano extranjero, residente en el país, que presenta un cuadro sospechoso de #Coronavirus. . :face_with_monocle: Además, indicó que de los 35 pasajeros en vigilancia, 13 están descartados para la enfermedad. . :index_pointing_up: Aquí te dejamos algunas de sus frases. . :mobile_phone_with_arrow: www.abc.com.py . . . #Coronavirus #China #Paraguay #ABC #ABCColor #MSPBS #Salud
2231650074131990705; 0; False; 1580253441; President Duterte. Its time to protect your people. It is confirmed that even those who don't show symptoms can be infected with nCoV (Wuhan Coronavirus). Kung may alam kayo sa Virology and Epidemiology, you will understand how bad this is. Containment of the disease is very difficult. So why risk your people; na meron kang choice to halt all transportation from China? No time for kissing assess President. Patunayan mo na Presidente ka ng mga Pilipino hindi ng China! Huwag kang patay malisya diyan. Start the Ban! #Coronavirus #WuhanVirus #Ban #Prevention
2231649995420241967; 0; False; 1580253432; Players are downloading Plague inc in record numbers - As fears of the deadly coronavirus grow bigger, players have turned to Plague inc to learn more about how the disease spread. However, the games creator, Ndemic games, issued a statement saying, "The current coronavirus outbreak is a very real situation which is impacting a huge number of people." - The creators of the game have also urged players to find information on global health sites such as the CDC or the World Health Organization to learn more about the virus. - Sources: CNN, Ndemic Games Share this post with your friends to keep them informed. Follow @thegamenet for elite gaming news from Today and Tomorrow. - . . . . . #mobilegames #gaming #games #gamer #mobilegame #impeachment #mobilegaming #androidgames #pubgmobile #game #mobile #mobilegamer #android #unity #gamers #ios #videogames #gamingnews #coronavirus #indiegame #indiegames #gamergirl #news #twitch #pubgmemes #plague #youtube #esports #indiegamedev #plagueinc
2231649952428741574; 0; False; 1580253427; Bona nit! :last_quarter_moon_face: . . Què sabem del #coronavirus de Wuhan? :microbe: . . Sabem que es transmet entre persones a través de les gotetes de saliva emeses al tossir o estornudar:wind_face: . . Sabem també que pot provocar greus símptomes respiratoris com la neumònia :face_with_medical_mask: . . Sabem que per ara no hi ha cura i que porta més de 100 morts però cap d'ells al nostre país :globe_showing_Europe-Africa: . . La forma més efectiva de frenar que avanci la infecció és evitant el contagi. . . La prevenció es basa en: :sweat_droplets: rentat freqüent de mans :palms_up_together: . . :sweat_droplets: evitat el contacte amb els afectats a menys d'1 metre de distància :man_and_woman_holding_hands: . . :sweat_droplets: protegint-se del contacte amb les gotetes emeses en estornudar i tossir :wind_face: . . :sweat_droplets: evitar accedir a la zona afectada :small_airplane: fins que la trasmissió de la malatia estigui sota control . . Recordeu que la #grip si que està afectant actualment al nostre país i pot ocasionar nombroses hospitalitzacions i mortalitat en els grups de risc. :dna::microbe: . . #farmaciaavtarragona #vilafrancadelpenedes #coronavirus #grip #neumonia #prevencio
2231649832295163922; 0; False; 1580253412; #memes #dankmemes #edgymemes #anime #wipawinomemes #starwars #ecchi #offensivememes #memedealer #shrekmemes #yodamemes #babyyoda #bruh #shrekmemes #corona #coronavirusmemes #coronavirus
2231649788324345870; 0; False; 1580253407; #internacional :red_circle:ACTUALIZACIÓN El número de muertes por la epidemia de #coronavirus aumento a 131- en las últimas 25 horas, el número de casos detectados virus a alcanzado 5.484 casos detectados por el virus en las 24 horas. #coronavirus #china #Noticiaendesarrollo #actualizacion #ultimahora #colombia #virus
2231649736690291565; 0; False; 1580253401; Tomem cuidado !!! #coronavírus #coronavirus #alerta
2231649741412967125; 0; False; 1580253401; We will use the common tongue of memes to communicate truth. #memes #memesdaily #coronavirusmemes #coronavirus #fluvacccine #investing #pandemic
2231649688640714536; 0; False; 1580253395; #ripgigi #ripmambamentality #doomsdayglacier #coronavirus #beprepared #cherishlife
2231648066285123817; 0; False; 1580253391; Conspiracy Theory: Corona Virus #coronavirus#conspiracytheory#china #conspiracy#staysafe
2231648877135825756; 0; False; 1580253390; All the teenage girls at parties r so lucky!! They have been saved by their underage drinking :face_with_tears_of_joy: #corona #coronavirus #tiktok #meme #funny #coronavirusmemes #memes #tiktokmemes
2231649601636005090; 0; False; 1580253385; #meme #memes #dankmemes #memesdaily #corona #coronavirus #mexico #attitude #lol #lmao #funnymemes #memestagram #edgy #dameme6969
2231649530307209680; 0; False; 1580253376; @nina__moric bellissima !! Lascia perdere gli uomini che ti destabilizzano #coronavirus
2231649519661453815; 0; False; 1580253375; Nueve estudiantes ecuatorianos que se encuentran en el epicentro del foco contagioso de coronavirus, en China, se encuentran bajo cuarentena y en buen estado de salud, indicó este martes el canciller de Ecuador, José Valencia. : En una comparecencia de prensa en la sede de la Cancillería en Quito, el ministro explicó los esfuerzos de coordinación que realiza la Cartera, "a través de la Embajada en Pekín y de los consulados de Ecuador en China, a fin de dar seguimiento a esta pandemia del coronavirus". : Valencia indicó que entre 1.400 y 1.500 nacionales ecuatorianos residen en el país asiático, entre los que se encuentran los nueve estudiantes que lo hacen en la provincia china de Hube, donde más casos se han registrado y es considerada el "foco de la infección epidémica". : Los jóvenes estudiantes cursan estudios académicos en Wuhan, capital de la mencionada provincia, y con ellos se han mantenido contactos desde las instancias diplomáticas ecuatorianas, como una videoconferencia esta misma mañana, indicó Valencia. : "Los nueve se encuentran sin contagio, con buena salud, se encuentran como todos los estudiantes extranjeros siguiendo los protocolos sanitarios dispuestos por las autoridades de ese país que suponen la cuarentena", aclaró. :backhand_index_pointing_right: https://bit.ly/2tYgbaa : #mercurioec #ecuador #wuhan #coronavirus #china #neumonia #enfermedad #epidemia
2231649485183619119; 0; False; 1580253371; Ok so this could all be fear mongering so take it with a grain of salt and check @ctv @globaltv @city_tv and other reliable sources. If you have a fear of catching something a mouth/nose hospital mask will help you #StaySafe #CoronaVirus #TorontoON
2231649177807765962; 0; False; 1580253367; Timelapse video showing the global rates of infection as of 29th of January excluding china. Source: Rankin - Youtube #corona #coronavirus #coronavirusoutbreak #trending #info #awareness #pandemic #publichealth #safety #spread
2231641362435269083; 0; False; 1580253363; Posisikan dirimu sebagai pemesan, karna kenyamanan lebih penting daripada yang lainnya. . Terimakasih yang sudah order, ditunggu orderan selanjutnya.:smiling_face_with_smiling_eyes: . Wa : 081802154040 Line : azmalalliasdodot Gmail : labellizzerindonesia@gmail.com @labelwoven #Labeljogja #grosirlabel #agenlabel #labelbaju #labelbajumurah #label #labelmurah #labelhijab #labelbatik #labelkaos #labelbordir #labelsablon #labelprinting #labelwoven #labeldamask #woven #damask #wovendamask #vendor #konvenksi #branding #jogja #hijab #batik #baju #kaos #jaket #labellizzer #labellizzerbandung #coronavirus
2231649383053453247; 1; False; 1580253359; Nah. I’m running. :skull: :microbe:Tag someone who will appreciate this :microbe: • Follow @chinavirus2020 for more:exclamation_mark:
2231649175158653244; 1; False; 1580253359; PREVENCIÓN Y CUARENTENA RÉCORD 107 personas murieron a raíz del nuevo #coronavirus. En la ciudad de #Yueyang, ubicada cerca de #Wuhan, lugar donde se originó el virus, tomaron medidas para evitar que la amenaza se propague
2231649375586898643; 2; False; 1580253358; Travel essentials in an age of uncontained viral outbreaks. Immune system boosts one of the best strategies for protection. ⁣ ⁣ Keeping my hand sanitized after every encounter with surfaces. ⁣ ⁣ Thieves Roll-On up and down the spine every hour. ⁣ ⁣ Melissa (Lemon Balm), The Gift and Egyptian Gold on my mask alternately every two hours. #potentprotection⁣ ⁣ Thieves spray as perfume. :winking_face_with_tongue:⁣ ⁣ 4oz of Ningxia Red everyday. :cherries::lemon::tangerine::wine_glass:⁣ ⁣ Teaching in Seoul for the next few days. Come join our classes in immune boosting strategies and yoga for winter wellness. ⁣ ⁣ DM for details! ⁣ ⁣ #seoulwellness #travelingyogateacher #coronavirus #viraloutbreak #fluseason #preventionisbetterthancure #immunesupport #thievesessentialoil #younglivingessentialoils #thescentsibletribe #stayhealthytohavefun #lemonbalm #frankincense
2231649379251716036; 0; False; 1580253358; BTC Price Back at $9,000 But No, Coronavirus Isn't 'Good for Bitcoin' #Bitcoin (BTC) may be gaining thanks to “economic fear” over #coronavirus — but only up to a point, analysts are concluding as the disease spreads. The #cryptocurrency hovered at around $9,000 on Tuesday, capping 4% gains for the week in which coronavirus sent China into partial lockdown. Coronavirus uncertainty creeps into markets Fears are now surfacing about the impact on Chinese economic growth, while global signals also suggest investors are more cautious about the short term. Markets analyst Mati Greenspan, the sentiment is already palpable. Uploading a chart of United States bond yields, he noted one-month performance delivered higher returns than the longer seven-year options. “It means investors are expecting trouble in the short term,” he explained in comments. Such economic uncertainty and unease on markets have often sparked increased bullish action for Bitcoin. As Cointelegraph noted, the Iran crisis earlier this month was just the latest geopolitical event that appeared to buoy the Bitcoin price. While Greenspan noted Bitcoin remained a highly non-correlated asset, mainstream media claims that Bitcoin was defying traditional markets and gaining purely on the back of coronavirus were widely panned. A report by the Financial Times with the headline “Coronavirus is good for Bitcoin” came in for particular criticism. Notably, the report cited two random Twitter accounts dedicated to altcoin XRP as sources. As reported, Bitcoin has long exhibited increasingly strong technical fundamentals, which preceded recent price moves. Vays: virus would “hurt” #BTC in epidemic scenario Discussing the impact of coronavirus, trader Tone Vays nonetheless stopped short of agreeing with the idea that the disease could perpetually fuel further gains. If it were to spread internationally, for example, panicked investors would likely reduce speculative activity, meaning less interest in non-traditional assets such as Bitcoin. .. #kinkyhair #braidout #twastyles #naturalhairstyles #naturalhair #naturalista #naturalhairsistas #amazingnaturalhair #naturalhairdaily_ #naturalhairstyling #braids #1
2231648875188623997; 0; False; 1580253346; Khilafah bukan hanya perjuangan Hizbut Tahrir Indonesia, tapi perjuangan seluruh umat Islam Menghalangi tegaknya #khilafah bagaikan mimpi di siang bolong, karena ia adalah janji dari Allah swt. #KhilafahAjaranIslam . . Menghalanginya ibarat menghalangi terbitnya matahari fajar di pagi hari. . . Apakah para penghalang dakwah itu akan berhasil menghalangi skenario Allah?? Jelas, itu mustahil. . . Mari perkokoh langkah perjuangan, kemenangan Islam kan segera tiba..!! Tak akan lama lagi. Allahu Akbar..!!! . . #JiwasrayaGate13T #westandwithuyghur #uyghur #uighur #saveuyghur #saveuighur #khilafah #KhilafahJanjiAllah #mujahidah212 #alumni212 #adamdubby #premanmasjid #opposite6890 #whitebaretofficial #politikindonesia #politik #politikislam #radikal #penjajahan #belanda #Khilafah_MyGuardian_MyShield #saveuighur #saveuighursos #China_is_terrorist #virus #coronavirus #viruscorona #china #tiongkok #wuhan
2231649237223901582; 0; False; 1580253341; Çinli bilim adamları, Wuhan Coronavirüsünün (2019-nCoV) erken vakalarını sunan ilk çalışmada, hızla yayılan hastalık için potansiyel tedavileri tartıştı. Yeni yayınlanan Lancet tıp dergisinin son sayısı virüsün temel özelliklerini ve onaylanan ilk 41 hastadaki bulguları inceliyor. Görselde de sunduğumuz üzere çarşamba günü itibariyle bu yazı hazırlanırken resmi rakamlara göre Çin genelinde 4.690 teyit edilmiş vaka var ve 106 kişinin öldüğü bildirilmiştir. 4 gün içerisinde izlenen bu büyük değişime neden olan iki ana sorun mevcut. Birincisi, hastalık henüz belirti vermeden diğer insanlara da bulaşmaya başlıyor ve bu nedenle kimlerin izole edilmesi gerektiği öngörülemiyor. İkincisi ise bulaş oranının yüksek oluşu. Epidemiyolojistlere göre her hasta bu hastalığı ortalama olarak 2.8-3.5 oranlarında kişiye bulaştırıyor. Yani yayılım oranı da çok yüksek. Sunulan hastaların %15’i ise (6) vefat etmiş. Lancet makalesi, teyit edilen ilk 41 hastanın yüzde 73'ünün erkek olduğunu bildiriyor - bunların yarısı 49 yaşın üzerindeydi. Hastalığın başlangıcındaki yaygın belirtiler ateş, öksürük ve kas ağrısı veya yorgunluktur. Daha az görülen semptomlar balgam, baş ağrısı, öksürük kanı ve ishaldir. Hastaların yarısı, hastalığın başlangıcından sekiz gün sonra meydana gelen nefes almada zorluk çekti. 41 hastanın 28'i 22 Ocak'ta ateşi en az 10 gün boyunca düşmesi ve solunum yollarında iyileşen göğüs radyografik bulgularına göre taburcu edildi. Yayında açıklanan bulgulara göre öncelikle yeni ortaya çıkan bir virüs olduğundan tedavi etmeyi başaran bir aşı veya net tedavi bulunamamıştır.Koronavirüs enfeksiyonları için hiçbir anti-viral tedavinin şimdiye kadar etkili olduğu kanıtlanmamıştır. Koronavirüs hastalığından korunmak ve yayılmasını önlemek için özel tasarlanmış N95 özellikli (FFP3) solunum maskelerin kullanılmasını ve dış ortamda temas sonrasında ellerin etkili temizleyicilerle dikkatli bir şekilde 30sn boyunca yıkanmasını öneriyoruz. Unutmayın ki bulaşıcı salgın hastalıklarda öncelikli amaç tedavi değil hastalıktan korunmaktır. Kuanta Biosibernetik Sağlık Terapileri #coronavirus #wuhan #flu #virus #salgın #grip #sağlık #kuanta
2231649214619031817; 1; False; 1580253339; Everyone stop Fucking asking about us virus -Corona- @corona . . #corona #corona:beer_mug: #coronarender #coronavirus #virus #coronavirusoutbreak #coronavirusmemes #funnymemes #instadaily #meme #memes #wuhan #wuhanvirus #art #classic #photo #instadaily
2231649054840290680; 1; False; 1580253334; las pibas . . . . . . . . . . . . . #shitpost #shitposting #shitpostespañol #dank #dankargentinagentina #dankmemes #dankmemesdaily #dankvideos #dylanteromeme #coronavirus
2231649037937222772; 15; False; 1580253327; Follow @son_of_a_pancake . . Ignore tags . . . . . . #playboicarti #wlr #eternalatake #coronameme #coronamemes #dailymemes #wholelottared #codzombies #zombies #views #lol #lmao #dankmemes #haha #comedy #virus #corona #coronavirus #explorepage #offensivememes #wholesomememes #fun #funnyvideos #funnymemes #worldstar #liluzivert #drake
2231630146187537804; 0; False; 1580253323; :police_car_light:BREAKING: La ciudad china de Shantou, con una población de más de cinco millones de personas, cierra sus fronteras y entra en confinamiento. La gente de #Wuhan está literalmente cayendo por toda la ciudad, como algo salido de una película de terror. . . . #china #coronavirus #mundo #video #viral #virus
2231648242100523619; 0; False; 1580253317; The #coronavirus #china China is under lock down... so #sad #stay #safe #sanitize everything #California
2231648935630097066; 0; False; 1580253305; Awareness regarding corona virus please keep supporting and share... . . #coronavirus #awareness #humanity
2231648935696169883; 0; False; 1580253305; ¿Qué es el #coronavirus? Una extensa familia de virus, algunos de los cuales pueden ser causa de diversas enfermedades humanas. Provoca el síndrome respiratorio de Oriente Medio (MERS), enfermedad respiratoria vírica. Ha provocado la muerte de varias personas y el contagio de cientos. Se puede transmitir de humano a humano. Algunos de los síntomas son: Tos, dolores de cabeza, malestar en general, dificultad para respirar estornudos, dolores musculares, fatiga, escalofríos, fiebre. :warning:Aún no existe un tratamiento específico, más que el de una enfermedad viral. Recomendaciones para la prevención: :soap: Lavar las manos con frecuencia :face_with_medical_mask: Utilizar tapabocas :handshake: Evitar saludar con besos y pasar la mano :airplane: Evitar viajar a lugares en donde hubo manifestación del virus :busts_in_silhouette: Evitar ir a lugares donde hay multitudes #ClinicaSisul #Recomendaciones #Coronavirus
2231648913392315322; 0; False; 1580253303; Mmm Batdoge soup #doge #meme #dogememe #dogememes #china #pandemic #coronavirus #shitpost #haha #funny #memes
2231648918685177874; 0; False; 1580253303; #coronavirus #corona #meme #memes #funny #dankmemes #memesdaily #funnymemes #lol #dank #humor #like #follow4follow #lmao #dankmeme #edgymemes #offensivememes #comedy #dailymemes #edgy #fun #memestagram #funnymeme #instagram #jokes #tiktok #haha #memez #cursedimage #spicymemes
2231648883772058401; 0; False; 1580253299; #sushi #coronavirus @gianiudici #estinzionedelsalmone
2231648853890085553; 0; False; 1580253296; Uff #virus #coronavirus #memes
2231648717222897874; 0; False; 1580253279; Coronavirus #corona #coronavirus #china:China: #adamandeve #wuhan #gimp
2231648279053814297; 1; False; 1580253277; #coronavirus.
2231648695094743213; 1; False; 1580253277; I don't trust anything coming outta China right now! . . . . . #meme #memes #memes:face_with_tears_of_joy: #memeshooters #memer #memesdaily #memelord #memery #memed #memez #dankmemes #memeslayer #memestar #memester #memesrlife #purememes #memelords #niche #nichememes #funny #memestagram #memesaremee #memesfordays #memelife #memegod #memeoftheday #china #coronavirus
2231648574197180478; 0; False; 1580253262; :pear::penguin: . _. _. _. _. _. _. _. _. _. _. _. _.. _. _.#memeslatinos #memescolombia #chile #memeschilensis #memesvideos #momo #repoio #memesenespañol #memesespañol #memesgraciosos #insta #instagram #memes4days #animal #dog #dogmeme #memesverdadesocultas #chile #chilepurowebeo #chilewebeo #chilepaisdememes #chilegram #memechile #coronavirus
2231648458981148528; 0; False; 1580253258; #ÚLTIMO Miles de personas desesperadas intentan ingresar a Hong Kong luego que se diera a conocer la orden de cerrar la frontera el 30 de enero a quienes provengan de China continental por brote de #coronavirus de Wuhan. #Lachipainformativa
2231648541019921695; 5; False; 1580253258; Well ! #lol #madeinchina #coronavirus #toyotacoronavirus
2231648462016773481; 0; False; 1580253249; Segala penyakit pasti ada obatnya, hannya kita harus tetap ikhtiar dan selalu ber tawakkal kepada Allah SWT.... #coronavirus #bdi_smp_15 . . Official Akun "Badan Da'wah Islam" (BDI) SMP 15 Jl. Bukit Dieng T/8 65147 Malang _ _ _ _ _ _ _ _ _ _ _ _ _ _ _ _ _ _ _ _ _ _ _ _ _ _ _ . ~ IG : bdi_smp_15 ~ FB : BDI LIBEL OFFICIAL ~ YouTube : BADAN DA'WAH ISLAM SMPN 15 MALANG . _ _ _ _ _ _ _ _ _ _ _ _ _ _ _ _ _ _ _ _ _ _ _ _ _ _ _ ~Semoga konten yang kita upload baik, foto maupun video dapat bermanfaat bagi kita semuanya...:hugging_face::hugging_face: _______________________ #bdi_smp_15 #smpn_15_malang
2231648393717837969; 0; False; 1580253241; Hai #sobatcemerlang Tetap menjaga kesehatan diri dan keluarga dengan GERMAS dapat mencegah berbagai penyakit seperti halnya yang menjadi perhatian saat ini adalah #coronavirus. Berikut contoh perilaku GERMAS yang dapat anda terapkan sebagai langkah pencegahan #coronavirus #germas #cegahviruscorona #cegahcorona #coronavirus #perilakuhidupsehat #pulauhanautcemerlang
2231648389229441957; 0; False; 1580253240; Wabah virus baru yang menggemparkan dunia saat ini adalah 2019-nCoV atau virus corona. Pertama kali ditemukan di kota Wuhan, Tiongkok, virus yang mirip Server Acute Respiratory Syndrome (SARS) ini telah menyebar di sekitar 13 negara dunia, termasuk negara-negara tetangga Asia seperti Thailand dan Singapura, hingga ke Prancis dan Amerika Serikat (AS). . 2019-nCoV ini terus mempercepat penyebarannya. World Health Organization (WHO) menyatakan bahwa perkiraan masa inkubasi virus 2019-nCov dua sampai 10 hari dan mengingatkan bahwa penularan antar manusia bisa terjadi meskipun orang yang sudah terinfeksi belum menunjukkan gejala sakit. Pencegahan virus 2019-nCoV dapat dilakukan dengan menerapkan perilaku hidup bersih sehat lho! Pencegahan ini dianggap cara terbaik untuk menghindari penyakit karena sampai sekarang belum ada obat dan vaksinnya. Jaga kesehatanmu dan jangan anggap remeh jika muncul gejala-gejalanya ya. #DailyInsight #AboutBrainAcademy #Coronavirus from #brainacademy.id
2231648326517000125; 0; False; 1580253233; Jaja :face_with_tears_of_joy: #memesespañol #meme #coronavirus
2231648303144353330; 1; False; 1580253230; :pear::penguin: . _. _. _. _. _. _. _. _. _. _. _. _.. _. _.#memeslatinos #memescolombia #chile #memeschilensis #memesvideos #momo #repoio #memesenespañol #memesespañol #memesgraciosos #insta #instagram #memes4days #animal #dog #dogmeme #memesverdadesocultas #chile #chilepurowebeo #chilewebeo #chilepaisdememes #chilegram #memechile #coronavirus
2231648275429536144; 0; False; 1580253227; #simpsons #again #coronavirus #china :see-no-evil_monkey::see-no-evil_monkey::see-no-evil_monkey:
2231648011088305505; 0; False; 1580253220; #me #metal #motivation #creative #bodybuilding #crossfit #calistenics #yoga #music #moda #model #makeup #creenciabase #winter #summer #kardashian #picoftheday #pink #youtube #mode #trump #memes #sunset #food #coronavirus #coronarvirus
2231648158356741497; 0; False; 1580253213; | I N F O R MA S A L U D Biom3D | :woman_scientist::man:‍:medical_symbol: #AlertaMundial: El Coronavirus se expande en América Latina :anxious_face_with_sweat: y debemos de saber los síntomas y como prevenirlo . :right_arrow: ¿ 𝗤𝘂𝗲 𝗲𝘀 𝗲𝗹 𝗖𝗼𝗿𝗼𝗻𝗮𝘃𝗶𝗿𝘂𝘀 ? :dna::microbe: Son una extensa familia de virus, algunos de los cuales puede ser causa de diversas enfermedades humanas, que van desde el resfriado común hasta el SRAS (síndrome respiratorio agudo severo). :right_arrow: ¿𝗖𝘂𝗮́𝗹𝗲𝘀 𝘀𝗼𝗻 𝗹𝗼𝘀 𝘀𝗶́𝗻𝘁𝗼𝗺𝗮𝘀 𝗱𝗲 𝗹𝗮𝘀 𝗶𝗻𝗳𝗲𝗰𝗰𝗶𝗼𝗻𝗲𝘀 𝗽𝗼𝗿 𝗖𝗼𝗿𝗼𝗻𝗮𝘃𝗶𝗿𝘂𝘀? - Fiebre alta - Tos con flema - Falta de aliento - Dolor u opresión en el pecho cuando respira y tose :right_arrow: ¿𝗖𝗼́𝗺𝗼 𝗽𝗿𝗲𝘃𝗲𝗻𝗶𝗿 𝗹𝗮𝘀 𝗶𝗻𝗳𝗲𝗰𝗰𝗶𝗼𝗻𝗲𝘀 𝗽𝗼𝗿 𝗖𝗼𝗿𝗼𝗻𝗮𝘃𝗶𝗿𝘂𝘀? - Lavarse las manos con frecuencia con agua y jabón durante al menos 20 segundos - Evitar tocarse la cara, la nariz o la boca con las manos sin lavar - Evitar el contacto cercano con personas enfermas - Limpiar y desinfectar las superficies que toca con frecuencia - Cubrirse la tos y los estornudos con un pañuelo de papel.Luego deseche el pañuelo y lávese las manos - Quedarse en casa cuando está enfermo. #Salud #Prevención #Coronavirus #Biom3D
2231648130483237948; 2; False; 1580253209; Corona Vírus. Não entremos em pânico mas saibamos o mínimo. #coronavirus #transmissao #virus #epidemia #saude #cuidados #cuidadoscomasaude #epidemiologia
2231648096316309094; 0; False; 1580253205; Joking around, can be cool and all, but...for real...Why joke around about stuff that will happen to us every now and then? I don't think that's funny... I feel like people now and then, just don't give a shit. Makes me think they just lost their, anxiety. Also, why do I have to watch News Reports on a virus from China, first thing in the morning in school? First class every day? THAT made me scared shitless. Even though you don't see it in me, I hide it away, so people won't see me like a wuss...Yet, I always hear them joke around all the time. The fuck is wrong with these people...? If they take it as a joke, then...I no longer care. Take it as a joke, and if it happens, then... Who's laughing now...? No one. No one will laugh at all, not even me. Because all they do is joke around, like the fucking clowns they are... ...Sorry... #myart #me #digitalart #digitaldrawing #inthevoid #sad #youthinkitsajoke #coronavirus #why #fuckthesejokes #news #idontevenknow #idontevenknowanymore #depressed
2231647532485098945; 3; False; 1580253203; new pre-flight checks be like.. #viewfrommyoffice #viewfromthetop #cabincrewmemes #flightattendantmemes #aviation #aviationmemes #passengershaming #cabincrewlife #flightattendantlife #qatarairways #qatarairwayscrew #qr #emirates #emiratescrew #etihad #etihadcrew #newsmemes #news #funnymemes #falife #coronavirus #coronavirusoutbreak #wuhan #wuhanvirus #wuhanchina #china #chineseflu #flu
2231647914493581641; 0; False; 1580253184; 28/2020 . . The Real #CoronaVirus
2231647872162715770; 0; False; 1580253179; Plague Inc. really out here in irl -Fabreeze ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ #pls #follow #memes #dankmemes #fun #funny #meme #nature #autisticmemes #retard #retardedmemes #haha #ahhhhhhhhhh #thereinthetrees #memesdaily #memepage #owo #uwu #followus #desperate #edgymemes #bruh #nigga #sans #niggamemes #niggacat #corona #coronavirus #coronavirusmemes #starwarsmemes
2231647826134658063; 0; False; 1580253173; Gotta run fast af:dashing_away: #virus #coronavirus #memes
2231647793655408617; 3; False; 1580253169; :warning:1월 29일 8시 현재 보건당국이 신종 코로나바이러스 총력 대응체계를 유지하고 있습니다. 추가로 발표된 사항을 더한 에방대책을 알려드립니다. ⠀ #중국 #우한폐렴 #신종코로나바이러스 #예방 #방역 #환자 #감기 #손씻기 #주의 #이슈 #뉴스 #kbs #news #kbsnews #china #coronavirus #issue #daily
2231647780401013855; 0; False; 1580253168; #q Was halted ihr vom coronavirus #memes #funnyvideos #funnymemes #lustigevideos #corona #coronavirus
2231647461206000022; 0; False; 1580253167; #coronavirus
2231643278076759577; 0; False; 1580253162; En días en que enfermedades como el #coronavirus se encuentran latentes. Te invitamos a reflexionar sobre otros tipo de #virus qué acechan la #salud de nuestros #bebes. Que se reflejan en diarrea, vomito, fiebre y gripe. Una forma de prevenirlos es realizándole lavado, desinfección y mantenimiento general periódicamente a los artículos que ellos utilizan a diario. En @pachamamaclean somos especialistas en todo tipo de artículos para ellos. Nuestro proceso de lavado es amigable con el medio ambiente ya que utilizamos detergentes 100% biodegradables, es amigable con los bebés ya que son completamente hipoalergénicos e inoloros. Contáctanos a través del 3108696543. #mama #mamaprimeriza #mamaemprendedora #mamadegemelos #mamadedos #mamademellizos #saludinfantil #pediatria #mamapediatra #cochesdebebe #pachamamaclean
2231647681238251664; 1; False; 1580253156; O secretário de Saúde do Acre, Alysson Bestene, disse ao ContilNet que a fronteira do Acre, com os países da Bolívia e do Peru, podem ser fechadas caso se confirme casos do coronavírus. “Por ser uma área fronteiriça, temos que ter cuidado redobrado como trabalhos de prevenção para manter esse monitoramento. No tocante ao fechamento da fronteira, isso envolve o Ministério das Relações Exteriores (ou Itamaraty) caso comprovados os casos”, explicou. Link nos stories.:mobile_phone_with_arrow::laptop_computer: #contilnetnoticias #coronavirus #urgente #saude #fronteiras #peru #riobranco #acre #governodetodos #gladsoncameli #virus
2231647685191299320; 0; False; 1580253156; 2020 wack • • • • #craggotsbecraggin #wtfmemes #f #spongebobmemes #spongebob #2020 #january #ww3 #wwiii #worldwar3memes #worldwar3 #coronavirus #bushfiresaustralia #autisticmemes #storytime #meme #memes #memecity #memesdaily #grandkids
2231647571095717710; 0; False; 1580253143; #Mundo China confirma 106 muertes por el coronavirus La OMS elevó el riesgo de contagio. Ya son más de 4.000 personas en el mundo que han resultado contagiadas por el virus. Lee la nota completa en nuestra web. #coronavirus #contagio #muertes
2231647404189693907; 0; False; 1580253138; #Repost @fightdogmeat_dot_com • • • • • CHINA: Haven Dogs Running Out Of Food. The coronavirus epidemic is affecting the Haven Sanctuary. They can’t buy kibble and there’s no deliveries. They need to buy sacks of rice for 200+ dogs, while they can. Please help if you can: PAYPAL: Donate@FightDogMeat.com. Fight Dog Meat. Registered Charity. #fightdogmeat #dog #dogs #china #china:China: #coronavirus #coronavirusoutbreak
2231646052038296260; 0; False; 1580252962; Stay alert and stay healthy! . #coronavirus #virus #china #wuhanvirus #disinikoffiepeduli
2231643675795029820; 2; False; 1580252678; 1. Warna cokelat atau merah tua ⠀ Pada saat awal dan akhir haid, darah yang keluar akan berwarna cokelat atau merah tua. Warna darah haid ini artinya normal. ⠀ Darah Anda tidak keluar deras ketika awal dan akhir haid. Itu karena darah butuh waktu keluar lebih lama dari uterus. Warna cokelat atau merah tua disebabkan oleh hal tersebut. ⠀ 2. Warna merah terang ⠀ Bedakan warna merah pada darah haid Anda, ya, Bun. Ada yang gelap dan ada yang terang. ⠀ Darah haid berwarna merah terang dbiasanya terjadi pada hari kedua atau ketiga. Saat itu dinding rahim melepaskan sel telur Anda yang tidak terbuahi dengan saat cepat. ⠀ Saking cepatnya luruh, tidak ada waktu bagi molekul lain untuk menggelapkan warnanya. ⠀ 3. Warna merah muda/pink ⠀ Darah warna merah muda atau pink biasanya keluar dalam bentuk bercak pendarahan. Beberapa orang kerap mengalami mid cycle spotting. ⠀ Menurut pakar ilmu keperawatan di NY, AS, Margaret Romero, warna pink pada darah haid terjadi karena kurangnya kadar hormon estrogen. ⠀ Terlebih jika diiringi dengan volume darah yang sangat sedikit dan haid tidak teratur. ⠀ Hati-hati, kekurangan estrogen bisa menyebabkan vagina kering, tubuh lemas, dan sstt… kehilangan gairah seks. Tak mau ini terjadi kan, segera hubungi dokter Anda. ⠀ 4. Warna merah keabuan ⠀ Jika warna darah haid Anda abu-abu, jangan ragu untuk konsultasi ke dokter. Sebab ini bisa jadi terjadi gejala infeksi atau bisa jadi tanda keguguran. Anda mungkin tidak sadar kalau sedang hamil. ⠀ Kapan harus waspada? ⠀ Selain perubahan warna, menurut dr.Irvandi dari alodokter.com, ada beberapa faktor lain yang perlu Anda waspadai: ⠀ 1》》 Volume darah yang keluar saat haid. Normalnya 40 cc atau sekitar 3 sendok makan setiap harinya. ⠀ ⠀ 2》》 Periode haid memanjang lebih dari 7-8 hari. Normalnya 3-5 hari.Siklus haid terganggu (lebih cepat 21 hari atau lebih lama 35 hari) dari hari pertama haid terakhir. Semoga bermanfaat :smiling_face_with_smiling_eyes: #infowanitaid:heavy_minus_sign::heavy_minus_sign::heavy_minus_sign::heavy_minus_sign::heavy_minus_sign::heavy_minus_sign::heavy_minus_sign::heavy_minus_sign::heavy_minus_sign::heavy_minus_sign::heavy_minus_sign::heavy_minus_sign::heavy_minus_sign::heavy_minus_sign:
2231643600718672227; 0; False; 1580252669; Yo @cdcgov @cdcglobal @stophivtogether @asmicrobiology @asmicrobiology_hi @who can an ant-iviral spray be effective, as a preventive measure. Or as a treatment #ncov #ncov2019 #wuhan #wuhanvirus #wuhancoronavirus #coronavirus #coronavirusoutbreak #cdc #worldhealthorganization
2231566557745788391; 0; False; 1580243485; #youhavetodowhatyouhavetodo#coronavirus#takecare
2231485261347524452; 0; False; 1580233794; Из-за коронавирусной эпидемии нефтяные цены в понедельник упали до минимальных значений с середины октября. Влияние вируса на потребление нефти и мировой экономический рост может оказаться хуже, чем во время вспышки атипичной пневмонией (SARS) в 2003 году. Подписывайтесь на наш instagram и узнавайте новости первыми! Новости без Цензуры 18+ в нашем Telegram канале (ссылка в шапке профиля)
2231430053980282390; 0; False; 1580227213; Власти Сингапура пригрозили жесткими мерами, вплоть до тюремного заключения тем, кто будет скрывать историю посещения китайской провинции Хубэй за последние две недели и отказываться от карантина — Минздрав Подписывайтесь на наш instagram и узнавайте новости первыми! Новости без Цензуры 18+ в нашем Telegram канале (ссылка в шапке профиля)
2231428840140401285; 0; False; 1580227068; «Global Times» сообщает, что китайский город Тяньцзинь на севере Китая запускает «механизм военного времени», в результате чего главная больница и 500 медицинских групп в городе находятся под военным управлением. Это первый китайский город, сделавший такой шаг. Подписывайтесь на наш instagram и узнавайте новости первыми! Новости без Цензуры 18+ в нашем Telegram канале (ссылка в шапке профиля)
2231427209881560867; 0; False; 1580226902; :ghost: Начало всеобщей забастовки в Гонконге. Подписывайтесь на наш instagram и узнавайте новости первыми! Новости без Цензуры 18+ в нашем Telegram канале (ссылка в шапке профиля)
2231425233290781118; 0; False; 1580226638; Стюардессу, прилетевшую из Китая, госпитализировали с подозрением на коронавирус. 23-летняя бортпроводница Рената А. работает в авиакомпании Nordwind. Вчера вот вернулась из рейса — и тут же почувствовала першение в горле. У девушки резко поднялась температура, пришлось звать врачей. Ренату положили в инфекционное отделение, проверяют, не заразилась ли она тем самым китайским вирусом. Подписывайтесь на наш instagram и узнавайте новости первыми! Новости без Цензуры 18+ в нашем Telegram канале (ссылка в шапке профиля)
2231423161287794672; 0; False; 1580226391; Завтра в Гонконге начнется всеобщая забастовка. Врачи и медсестры планируют завтра выйти на протест, поскольку правительство не желает принимать подходящие меры, такие как закрытие границ между Гонконгом и Китаем, а также не предоставляет достаточное количество лицевых масок, позволяющих материковым китайцам приехать и получить БЕСПЛАТНУЮ медицинскую помощь. сообщили The Guardian источники в протестном движении территории. Подписывайтесь на наш instagram и узнавайте новости первыми! Новости без Цензуры 18+ в нашем Telegram канале (ссылка в шапке профиля)
2231420181134146319; 0; False; 1580226036; Коронавирус Воронеж. Кажется вирус добрался до России. Подписывайтесь на наш instagram и узнавайте новости первыми! Новости без Цензуры 18+ в нашем Telegram канале (ссылка в шапке профиля)
2231330898620198100; 2; False; 1580215392; Foto w/ suket. . . . . . . . . . . . . . . . #papua #indonesia #bukitteletubies #sentani #jayapura #akupapua #nkri #january #kobe #kobebryant #coronavirus #spongebob
2231152472517742960; 0; False; 1580194122; Seenak inikah makanan DIET? . Ini foto real makan siang salah satu peserta saya yah. . DILARANG LAPAR kalau lagi DIET!! WAJIB MAKAN 5x sehari :smiling_face_with_3_hearts: . kalian nga akan pernah percaya klw belum mencoba :kissing_face_with_closed_eyes: . Yuk ikutan kelas diet bln ini,jangan ditunda2 lagi:double_exclamation_mark: . Kalian memang nga akan bisa percaya,klw nga membuktikannya sendiri:double_exclamation_mark::smiling_face: . HADIAH SPECIAL Hanya untuk 10 peserta saja:double_exclamation_mark: . Mulai kelas program tgl 25 Februari 2020 Close pendaftaran tgl 20 februari 2020 SLOT TERBATAS :double_exclamation_mark: . :bento_box: Menu makan Bervariasi setiap hari :cookie: Bisa makan 5x (termasuk 2x ngemil) :shopping_bags: Daftar belanjaan diet :doughnut: snack ideals :woman_lifting_weights: Panduan olahraga dari Rumah :telephone_receiver: one by one support coach :two_women_holding_hands: Grup Support :money_bag: Potensi Menangkan hadian Cash *Syarat dan ketentuan berlaku . Daftar? : Klik Link di bio ig @unhie90 Atau WA ke: 0896-1017-0106 . Untuk Info Selanjutnya :double_exclamation_mark: . #dietsehat #diet #dietherbalife #dietsehatmakassar #hidupsehat #begadang #langsing #ibumuda #bodygoals2019 #haruskurus #programlangsing #ibuibu #antipelakor #sayangsuami #ibucantik #ibusehat #mahmudcantik #cantik #sehat #maukurus #mausehat #MUA #muamakassarhits #muaindonesia #cantikcantik #sule #istrisulemeninggal #syahnazsadiqah #coronavirus
2230319416886028689; 0; False; 1580094814; Di kelas diet sehat saya, HARUS tetap Makan Karbo,karena setiap hari,tubuh membutuhkan karbo yah. Jadi klw mau DIET tapi tetap makan Nasi, Yuk daftar sekarang:double_exclamation_mark: . kalian nga akan pernah percaya klw belum mencoba :kissing_face_with_closed_eyes: . Yuk ikutan kelas diet bln ini,jangan ditunda2 lagi:double_exclamation_mark: . Kalian memang nga akan bisa percaya,klw nga membuktikannya sendiri:double_exclamation_mark::smiling_face: . HADIAH SPECIAL Hanya untuk 10 peserta saja:double_exclamation_mark: . Mulai kelas program tgl 25 Februari 2020 Close pendaftaran tgl 20 februari 2020 SLOT TERBATAS :double_exclamation_mark: . :bento_box: Menu makan Bervariasi setiap hari :cookie: Bisa makan 5x (termasuk 2x ngemil) :shopping_bags: Daftar belanjaan diet :doughnut: snack ideals :woman_lifting_weights: Panduan olahraga dari Rumah :telephone_receiver: one by one support coach :two_women_holding_hands: Grup Support :money_bag: Potensi Menangkan hadian Cash *Syarat dan ketentuan berlaku . Daftar? : Klik Link di bio ig @unhie90 Atau WA ke: 0896-1017-0106 . Untuk Info Selanjutnya :double_exclamation_mark: . #dietsehat #diet #dietherbalife #dietsehatmakassar #hidupsehat #begadang #langsing #ibumuda #bodygoals2019 #haruskurus #programlangsing #ibuibu #antipelakor #sayangsuami #ibucantik #ibusehat #mahmudcantik #cantik #sehat #maukurus #mausehat #MUA #muamakassarhits #muaindonesia #cantikcantik #sule #istrisulemeninggal #syahnazsadiqah #coronavirus
2228449402359759155; 18; False; 1579871891; I want to be back on a scooter again, but I don’t have healed knee yet. Summer will be BANGER guys. I can’t wait for summer. :love-you_gesture::black_heart::love-you_gesture: @scootshop @scootering.cz #nike #cap #airjordan #jordanlegacy312 #nikehigh #white #filter #scooteringteam #scootshopfamily #converse #adidas #ripjuicewrld #juicewrld #juice #photooftheday #likeforlikes #l4l #coronavirus #ripkobe #kobebryant #nofilter
2231647338512814685; 2; False; 1580253133; Aqui vai minha orientação sobre o coronavírus! ⠀ #cassauara #dropshipping #china #coronavirus #dsacademy
2231647463151047699; 0; False; 1580253130; #memes #coronavirus #gatos #momazos #memesespañol #ecuador #memesgraciosos #gatosdeinstagram
2231647352758018381; 0; False; 1580253117; Follow @fergunes_skits for more memes • • • • • #meme #memes #funny #dankmemes #memesdaily #funnymemes #lol #dank #humor #like #follow #lmao #dankmeme #edgymemes #offensivememes #anime #love #minecraft #comedy #dailymemes #edgy #fun #memestagram #funnymeme #tyler1memes #coronavirus #relatablememes #relatable #sesamestreet #corona
2231647340316372676; 0; False; 1580253115; Four days into the construction of the coronavirus hospitals | spread to share knowledge #cronovirus #coronavirus #cdc
2231647283015163556; 1; False; 1580253112; Coronavirus got me like:⁣ shout out to @fuckadvertisements for this one
2231647286530620584; 0; False; 1580253109; Tips hadapi #coronavirus kredit kartun : Nazry Salam https://t.co/MlE5ApxGFa
2231640509180602718; 4; False; 1580253105; Aquí sobreviviendo al Coronavirus. :rolling_on_the_floor_laughing::face_with_medical_mask: :movie_camera: @yulitoo_ . . #coronavirus #comedy #humor #bogota #medellin #pereira #cali #colombia #usa #peru #brasil #ecuador #brasilia #mexico #lima #quito #newyork #washington
2231647184542140184; 0; False; 1580253097; La #verdad es que cada día me sorprende más la inventiva de la gente, su #originalidad, su... No se como decirlo. Su falta de algo que hacer!!! Se que la situación en #China es complicada, el porcentaje de #infecciones no es tan alto y que la #mortalidad no es muy elevada pero la vida de todos y cada uno de los fallecidos era importante. Dicho esto... Que cabrones !!! Ja ja ja ja!!! The truth is that every day I am more surprised by people's inventiveness, their #originality, their ... I don't know how to say it. Your lack of something to do !!! I know that the situation in China is complicated, the percentage of infections is not so high and that the mortality is not very high but the life of each and every one of the deceased was important. That said ... What bastards !!! LOL!!! #coronavirus #wecare #fightingnurses #nursesonnight #nurses #globalinfection #umbrella #umbrellacorporation #residentevil
2231647152017754215; 0; False; 1580253093; Take #Ganoderma #Mushroom to #clean and #protect your body, take #Spirulina to nourish and #Morinzhi to make it Strong. Organic food from @dxn_sweden #corona #coronavirus
2231646921819105695; 1; False; 1580253092; Fuck it, cough on that mf:face_with_symbols_on_mouth:
2231647105899080418; 0; False; 1580253087; RIP Coronaviruses are a group of viruses that cause diseases in mammals and birds. In humans, the virus causes respiratory infections which are typically mild including the common cold but rarer forms like SARS and MERS can be lethal. Please be aware from Coronavirus. #coronavirus #osmiumsurgical
2231647093584173193; 0; False; 1580253086; Praying for the many families in Wuhan and in China affected by the coronavirus. It has not been the Lunar New Year celebration expected. Praying for the many international students worried about their family and friends. Praying for healing and for peace. You are in our hearts! #internationalstudents #bridgesinternational #praying #coronavirus
2231644738069746535; 0; False; 1580253079; Posisikan dirimu sebagai pemesan, karna kenyamanan lebih penting daripada yang lainnya. . Terimakasih yang sudah order, ditunggu orderan selanjutnya.:smiling_face_with_smiling_eyes: . Wa : 081802154040 Line : azmalalliasdodot Gmail : labellizzerindonesia@gmail.com @labelwoven #juallabelbaju #cetaklabelbaju #bikinlabelbaju #labelpakaianmurah #cetaklabelhijab #labelhijabmurah #printlabel #labelpakaian #labelmukena #labelpitasatin #labelpitasablon #pitasouvenir #pitasatinmurah #buatlabelbaju #labelwovenbandung #pitagulungan #hijabmurah #labelbajupitasatin #bikinlabel #souvenir #pitagrosgrain #labelkerudung #labelkatun #sablonpitasatin #labelmerk #labelbandung #labellizzer #labellizzerbandung #labelwovenbandung #coronavirus
2231646988198010515; 0; False; 1580253073; Doctorandas :smiling_face_with_3_hearts::nerd_face: VERANO/20 #CoronaVirus #MardePlata #NoVuelvoEnInvierno #Portuñol #BrasilyColombiaEnArgentina
2231646969968077202; 8; False; 1580253071; Embung ah :frowning_face: ㅤ ㅤ Follow: @kangcartoon #KangCartoon #CoronaVirus
2231646960415330464; 0; False; 1580253070; die ersten Visualisierungen von 2019n-CoV via Transmissions-Elektronen-Mikroskopie aus menschlichem Gewebe Link zum frei zugänglichen, kostenfreien Artikel in der Bio von @nejm #coronaviren #coronavirus #nejm #electronmicroscope #electronmicroscopy #virus #visualisation #elektronenmikroskop #elektromenmikroskopie #visualisierung #freearticle
2231646945340289201; 0; False; 1580253068; #coronavirus#takecare#itsnotajoke
2231646894907303236; 0; False; 1580253064; 모두 꼼꼼히!:frowning_face_with_open_mouth::frowning_face_with_open_mouth:⠀ ⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⁠⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀ 프로필상단 링크 http://cbmpress.com 에서 자세한 내용을 확인하세요.⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⁠⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀ ⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⁠⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀ #우한폐렴 #코로나바이러스 #코로나예방법 #캐나다토론토 #캐나다코로나 #coronavirus #torontocorona #coronamap #캐나다여행 #toronto #토론토정보 #캐나다소식 #온타리오 #토론토정보 #Toronto #TorontoLife #크븜 #데일리그램 #일상
2231646858810703026; 0; False; 1580253058; Não tem como falar de imunidade sem falar da função intestinal. . Pra melhorar a função desse órgão tão importante pra sua imunidade, confira as dicas abaixo: :droplet:Melhore a hidratação: quando você não bebe água direito, o intestino precisa reciclar a água que tem disponível, essa reciclagem ele faz das fezes, sim, literalmente ele usa água de :pile_of_poo::woman_shrugging_light_skin_tone: isso favorece também a constipação, colaborando com um maior tempo das fezes no intestino; :peanuts:Invista nas gorduras boas! Vão auxiliar na lubrificação intestinal, além de possuírem nutrientes como zinco, selênio e vitamina E que contribuem para o fortalecimento imunológico; :broccoli:Impossível não falar de intestino e não lembrar das fibras! Além de ajudar a regular o trânsito intestinal (aumentando ou diminuindo o tempo de trânsito) também colaboram no metabolismo dos carboidratos e gorduras; :prohibited:Reduza os ultraprocessados! Excesso de sódio, açúcar simples e aditivos alimentares auxiliam no quadro de disbiose intestinal (situação de desequilíbrio entre as espécies boas e más de micro-organismos), ainda por cima tem pouca fibra e reduz o tempo de saciedade (te levando a comer mais!); :pill:Os probióticos tem sido amplamente estudados em várias situações clínicas, entre elas a colonização de micro-organismos que colaboram com a imunidade, vale lembrar que apesar de existirem opções já prontas no mercado, a suplementação deve ser feita por um profissional e de forma Individualizada (não é tudo que serve pra tudo e nem tudo que serve pra todo mundo). . Gostou? Clica em salvar e não perde as 2 outras partes da nossa sequência sobre imunidade. . Alexandra Menezes Nutricionista Emagrecimento e Saúde da Mulher :hibiscus: #alexandramenezesnutri #coronavirus #imunidade #sistemaimunologico #alimentacaosaudavel #nutricaoeimunidade
2231646841799524175; 0; False; 1580253056; As of today, #coronavirus has claimed more than 100 lives, with more than 4700 confirmed cases of the respiratory infection that originated in central China. The #CDC has confirmed five U.S. cases in Arizona, California, Illinois and Washington as of yesterday, and investigations of potential cases are being conducted in 26 states. Dr. Tim Hurtado, Medical Director of Emergency Dept. at SFMC, spoke with @kktv11news today about what coronavirus is, how it is contracted, what symptoms people should look out for and how #caregivers across Penrose-St. Francis and Centura are preparing for a y potential cases in our communities. All #CenturaHealth facilities, including #PenroseHospital and #stfrancismedicalcenter in #ColoradoSprings began screening for coronavirus last week and all safety and precaution guidelines and recommendations by health authorities are being followed by all caregivers.
2231646728327516486; 0; False; 1580253042; :police_car_light:Breaking news: America and Japan evacuating their citizens from Wuhan with special flights: Kalitta Air B-747 and All Nippon Airways B-767. The Kalitta Boeing is a cargo aircraft equipped with pallet seats for the mission. ⠀ #ana #allnipponairways #kalittaair #b767 #b747 #coronavirus #boeing #wuhan #wuhanvirus #wuhancoronavirus #flightradar24 #evacuation #virus
2231644956324711398; 10; False; 1580253035; Bros got the chrosomovirus :droplet: :droplet: :droplet: :droplet: :droplet: :droplet: :droplet: :droplet: :droplet: #ww3 #ww3memes #memes #meme #funny #dankmemes #memesdaily #funnymemes #lol #dank #humor #like #follow #lmao #dankmeme #edgymemes #offensivememes #anime #love #fortnite #comedy #dailymemes #edgy #memestagram #eatdatpussy445 #coronavirusmemes #edp445memes #tiktok #coronavirus #edp445
2231646633894935691; 1; False; 1580253031; Eat shitty food, win shitty prizes! Some of the best coverage of the UwU Flu is by Mister Metokur on youtube and bitchute. His streams have been going over the evidence smuggled out of Wuhan and beyond, with dark humor obviously #uwuflu #wuhanflu #chineseachoo #werealldoomed #mistermetokur #coronachan #coronavirus #gothsfortrump #gothright #makeamericagothagain #maga #joinus #allblackeverything #goth
2231646629341953168; 0; False; 1580253030; Esto se va a poner feo... #Meme #Humor #Coronavirus #LuisitoComunica
2231646508638460090; 1; False; 1580253016; Je suis désolée pour le virus en France en moment, je m’inquiète aussi pour mon pays. Ma maman travaille dans l’hôpital, mon papa et mes oncles travaillent dans les pharmacies. Les chiffres de l’infecté et de suspects doublés tous les jours... Mais avec une telle situation la chose la plus importante maintenant n’est pas la santé ? J’espère qu’on ait plus de compréhension de l’un et l’autre. Je suis désolée pour le virus qui se répand partout du monde mais nous sommes aussi des victimes. Il y a des décisions qui sont prises par l’état, les conséquences sont affreuses, mais c’est pas causé par la plupart de population. Je ne pense pas que la plupart du peuple chinois ont tort, et avec tout se passe en chine on veut juste se protéger avec un masque. Je comprends tout à fait que maintenant les français se méfient des chinois, mais je ne veux vraiment pas qu’en même que nous nous protégeons de virus, faisons critiquer par des français juste parce que l’on veut se protéger...” ————————————— Laissez tomber la condescendance, le racisme, les critiques... On peut reprocher les fautes après ( le gouvernement, les gens qui mangent les animaux sauvages...) et essayer d’en apprendre des leçons. Le virus a déjà répandu, c’est à tout le monde de l’arrêter. J’espère que c’est à nous, tout le monde, peu importe quelle nationalité, s’unissions pour lutter contre le virus, mais pas les racistes, l’extrême droists… contre les chinois à une telle circonstance ...” ————————————— Je respecte les gens qui portent des masques, je respecte les gens qui ne portent pas de masque, je respecte les gens qui portent les voiles, je respecte les gens qui sont porteurs de SIDA/ virus… Je respecte les gens en tant que tels, peu importe leur nationalité, origine, orientation sexuelle… 中国加油，法国加油，世界加油 :flexed_biceps: • • • #jenesuispasunvirus #racism #racismeordinaire #racismeantiasiatique #coronavirus #asiatphobie #lecombatcontinue
2231646470955146840; 0; False; 1580253012; For real, it's like that sometimes :wheelchair_symbol: . . . . Tahs: #plagueinc #plagueincmemes #coronavirus #coronavirusmemes #instagram #memes #dankmemes #meme #dankmeme #pepe #LoL #gaming #darkhumour #minecraft #insta #memer #dankmemer #memesdaily #memestergram #funnymemes #cursedmemes #memelord #shitpost #pewdiepie #epicmemes #epicgamer #gamer #photoshop #funny
2231646444094598232; 0; False; 1580253008; Imagine having a Chinese car #virus #coronavirus #memes
2231645152418813303; 0; False; 1580252999; #FuckADoor NattyDaddies - - - - - #naturallight #naturallightbeer #kobe #kobebryant #nattydaddies #nattylight #mothmemes #asu #california #arizona #tempe #coronavirus
2231646329658206474; 2; False; 1580252995; Marked #Safe from #WuhanCoronavirus :white_heavy_check_mark: :OK_hand_medium_skin_tone: #Order your #Mug today and #MakeAStatement :hundred_points: #coronavirus #wuhan #wuhanchina #starbucks #dunkindonuts #dunkin #coffee #cafe #virusfree #goodmorning #latte #latteart
2231646297505314801; 1; False; 1580252991; Aunque aún no se conoce cómo se propaga el #coronavirus, sea por aire o por contacto; es preferible estar prevenidos usando mascarillas de protección respiratoria individual #N95. :fast-forward_button: También se recomienda el lavado de manos con jabón o alcohol y pañuelos de un solo uso. #EstemosPrevenidos
2231646292950785590; 0; False; 1580252990; Türkiye'de rastlanmadı. :folded_hands: #önemli #china #breaking #haber #gündem #coronavirus#sondakika #önemli #karantina #Wuhan #coronavirus #türkiye #tsk #hastalik #istanbul #cin #çin #coronavirus #salgın #virus #woman
2231646231084230242; 0; False; 1580252983; #residentevil #resident #evil #rlsw #coronavirus #corona #virus #racooncity #racoon #city #umbrellacorps
2231646145912873947; 3; False; 1580252981; ¿EL ORIGEN DEL CORONAVIRUS? Esta es la sopa de murciélago que afirman podría haber originado la epidemia de coronavirus en Wuhan, China. #china #coronavirus #wuhan #murcielago #sopademurcielago #epidemia #virus
2231646205289209670; 0; False; 1580252980; #coronavirus son veriler; :new_moon_face:Ölen kişi sayısı:131 :face_with_thermometer:Tedavi edilen kişi sayısı:74 :face_with_medical_mask:Hasta sayısı:5515 :white_question_mark:Şüpheli sayısı:6973
2231646191345888760; 13; False; 1580252978; Welp #china #coronavirus #corona #virus
2231646190274124254; 0; False; 1580252978; Mencegah lebih baik daripada mengobati. Semoga kita semua sehat selalu dan panjang umur. #tipsjsr #virus #coronavirus #tipssehat #tipssehatalami #mpasi #parentinggoals #tipsparentinganak #beaumamainfodantips #infoterkini #infoviral #viral #nikitamirzani #fairuz
2231646052733982478; 0; False; 1580252971; #CoronaVirus || Siguen apareciendo imágenes internas de hospitales en #China Es realmente aterrador la cantidad de pacientes que intentan ser atendidos. #coronavirus #wuhan
2231646087504920452; 0; False; 1580252966; Reposted from @pictoline El coronavirus de Wuhan, China :face_with_medical_mask::globe_showing_Europe-Africa: Si no has estado al tanto de lo ocurrido en la última semana, estos son los datos más recientes: #coronavirus #wuhan #china #salud #virus
2231646025865786073; 0; False; 1580252958; Eso explica muchas cosas:face_with_tears_of_joy::thinking_face: Sígueme para más Memes así @memes4k2020 - - - - - - - #meme #memes #momos #momasos #memesenespañol #risas #buenhumor #buenardo #memes #memesmexicanos #memingo #humor #chiste #chistes #memesdelcoronavirus #memesdelvirus #coronavirus #random #
2231646005731069116; 0; False; 1580252956; Assalamualaikum Video baru sudah upload Jangan lupa tonton Video ya di channel YouTube Uda Kumis Link di deskripsi Video buat Hiburan ambil positifnya buang negatifnya !!! Terimakasih :face_blowing_a_kiss: #viral #virus #coronavirus #viralpost #viralvideos
2231645759231959008; 0; False; 1580252950; Expertos de China advierten que habría 44.000 infectados por el coronavirus Investigadores de Hong Kong (China) advierten que el nuevo coronavirus está a punto de convertirse en una epidemia global y estiman que unas 44.000 personas estarían infectadas con ese microorganismo, muchas más de las que sugieren las cifras oficiales hasta el momento. · · · #noticias #news #coronavirus #china #australia #tailandia #thailand #singapur #francia #france #malaysia #coreadelsur #southcorea #estadosunidos #usa #vietnam #nepal
2231645889792377490; 0; False; 1580252942; ‪Masques grippe ffp2 disponibles :face_with_medical_mask::thumbs_up:‬ ffp2流感面具在這裡可用 With the increasing spread of the Wuhan Coronavirus it is beneficial to take preventive measures and protect yourself and your loved ones. FFP2 masques should be used when you or the people around you are unwell. Keep safe and calm :raising_hands: #virus #chine #wuhan #ncov2019 #coronavirus #masque
2231645859276560357; 4; False; 1580252939; 18:30 ATUALIZANDO: Ao todo são 3 casos considerados suspeitos pelo Ministério da Saúde nos estados de Minas Gerais, Rio Grande do Sul e Paraná (os pacientes estão nas capitais dos estados: Belo Horizonte, Porto Alegre e Curitiba) . 10:30 AM >> Ministério da Saúde confirma caso suspeito de coronavírus em Minas Gerais. Paciente é uma estudante de 22 anos que esteve em Wuhan (cidade chinesa onde surgiu a epidemia) nos últimos dias . A paciente é uma estudante de 22 anos que chegou em território brasileiro no dia 24 de janeiro. Conforme o ministro, todas as 14 pessoas que tiveram contato com a estudante estão sendo monitoradas. . Com a suspeita confirmada, o Ministério da Saúde elevou a classificação de risco do Brasil para o nível 2, que significa "perigo iminente". Até segunda-feira (27), o país estava em nível 1 de alerta. . ÚLTIMAS ATUALIZAÇÕES: Alemanha confirma três novos casos, depois de França confirmar o quarto caso. .. :police_car_light: ALERTA>> Na Alemanha :Germany: e no Japão :Japan: surgiram os primeiros casos de coronavírus em pessoas que não estiveram na China. . O especialista japonês, professor Mitsuo Kaku da Universidade de Medicina e Farmácia de Tohoku afirmou que será difícil controlar infecções e prevenir a disseminação do novo coronavírus . Ele insiste que as pessoas não encarem o vírus de forma branda, pois trata-se de uma nova linhagem que nunca antes havia infectado seres humanos. .. #epidemia #china #brasil:Brazil: #coronavirus Via: Minha Capital
2231645849562435971; 3; False; 1580252937; A paraense Reisi Liao mudou-se de Novo Progresso para a cidade chinesa de Wuhan no dia 8 de novembro. Seu marido é natural da Província de Hubei e, depois muitos anos de idas e vindas, o casal decidiu ficar definitivamente na China por causa da "incerteza" que ronda o Brasil, da "instabilidade do governo e da economia, que não vai tão bem", segundo ela. "E a gente encontra esse cenário", diz ela, referindo-se à epidemia de coronavírus, que matou cem pessoas apenas na Província de Hubei e provocou o fechamento da cidade de Wuhan, considerada o epicentro da contaminação. Há seis dias, Wuhan vive em uma espécie de quarentena. Não se pode entrar ou sair da cidade, o transporte público parou de circular, as aulas nas escolas e na universidade foram suspensas. Apenas algumas farmácias e supermercados continuam abertos. Desde então, Reisi praticamente não saiu de casa. É o marido que sai para comprar mantimentos, apenas pelo tempo mínimo necessário e protegido por uma máscara. Com um filho de dois anos, ela não desce nem para as áreas comuns do condomínio, para evitar uma exposição desnecessária do bebê ao risco. "É como se fosse uma prisão domiciliar." Enquanto ela conversa com a reportagem, os sogros jogam dominó na sala do apartamento. https://noticias.uol.com.br/ultimas-noticias/bbc/2020/01/28/o-relato-de-uma-brasileira-confinada-em-wuhan-epicentro-do-coronavirus-e-como-uma-prisao-domiciliar.htm?cmpid=copiaecola
2231639064283489283; 1; False; 1580252932; Feliz martes queridas pacientes y seguidoras :hugging_face: . El día de hoy quiero compartirles este video en donde les dejo información de gran importancia sobre el Coronavirus, una enfermedad que ha puesto en alerta a todo el mundo. . :backhand_index_pointing_right_light_skin_tone: El Coronavirus 2019-nCoV surgió en China y se ha expandido por diferentes países a nivel mundial. En China se han confirmado: :pushpin: 106 fallecimientos por 2019-nCoV :pushpin: 4.515 casos confirmados de infección con el 2019-nCoV :pushpin: 976 pacientes en condición crítica :pushpin: 6.973 personas bajo sospecha . Si te parece importante esta información, compártela con familiares y amigos :face_blowing_a_kiss: . #DraMiggris #Ginecologia #Obstetricia #Ginecobstetra #Salud #SaludyBienestar #SaludGeneral #Coronavirus #Virus #Tariba #Guasdualito #Tachira #cucuta
2231645764440826544; 12; False; 1580252927; Repost da minha amiga @pediatria_objetiva ! Todo mundo com atenção !! #repost @pediatria_objetiva ・・・ Importante enfatizar as formas de prevenção! :police_car_light: - Evitar locais de aglomeração: shopping, cinema, Igreja, blocos de carnaval, shows, baladas, etc. - Lavar muito as mãos e caprichar no álcool em gel. - Já poderíamos começar a pensar na idéia de se usar máscaras tb!! :thinking_face: - Não entrar em pânico, mas ter consciência da situação e como prevenir. - Nada confirmado, mas a suspeita existe e precisamos manter atenção!!! #drabrunapediatra #prevencao #coronavirus
2231645694507435561; 0; False; 1580252919; New rilis... Family Set Jodha Akbar by Ahzarayy Valda . Persembahan dari @adzkia_plaza untuk pemesanan dan order silahkan klil link WA di bio ya bun:hugging_face: . . #familyset2020 #bajulebaran2020 #bajulebaran #sarimbit2020 #sarimbitkeluarga #ahzarayy #valdya #kokocouple #gamiscouple #kemkocouple #rabbani #kemejakokocouple #dresscouple #kokolebaran #gamislebaran #gamiscouplecantik #kokocouplekeren #coronavirus
2231645680011930832; 0; False; 1580252917; Becuase this will stop it! #coronavirus LoL
2231645637513135623; 0; False; 1580252912; #朝ごはん #breakfast . . * 鯖押し寿司 石見銀山の。#meidiya #江戸一 #釜あげお多福豆 * #岩手屋 #おばあちゃんの南部スープ * #北海道 #北広島市 #北海道はまなす食品 #北海道納豆 * 生野菜 #蕾菜 #:tomato: #豊川稲荷 で買ったフレンチドレッシング * #金柑 #ブリーベリー . . 納豆は 豆がおいしい、が、タレが塩っぱめ。蚕豆も美味:face_savoring_food:。 . . :face_with_medical_mask:感染拡まってます:anxious_face_with_sweat: #coronavirus
2231645528429795925; 1; False; 1580252899; #coronavirus
2231645524361459951; 0; False; 1580252899; Boost the IMMUNE SYSTEM The outbreak of the new coronavirus was first found in Wuhan, China in 2019 and now has spread rapidly to other countries, including the United States. The new coronavirus is in the same family as severe acute respiratory syndrome (SARS), which killed hundreds of people in 2003. To fight for this new virus, it is very important to take precautions- wash hands frequently with soap and water or an alcohol based sanitizer, and wear a facemask in public, even if there is no respiratory infection symptom present. Eating right can also protect our health by strengthening the immune system to fight for foreign substances. Many nutrients, such as protein, vitamin A, B, C, D, E, zinc, copper and phytochemicals, have potential anti-inflammatory and/or antioxidative properties. We can keep the immune system strong by including these nutrients and foods in meals: :play_button:Fruits and vegetables high in vitamin C, such as citrus fruits, kiwis, broccoli, peppers, etc. :play_button:Plant foods rich in beneficial phytochemicals, such as cruciferous vegetables (including cabbage, collard green, cauliflower, and brussels sprouts), berries, soybeans and soy products, garlic, ginger, turmeric, green tea, etc. :play_button:Fatty fish containing a specific fatty acid- omega 3 fatty acid. :play_button:Animal foods with good qualities of protein and essential vitamins and minerals, such as lean meat, poultry, seafood, and eggs. Don’t forget the importance of water! Our body cannot function well without enough fluid. Fill up your water more often and stay hydrated! Resources: Icons from Freepik . . . . . . #nutrition #dietitian #registereddietitian #RDN #food #health #wellness #healthyfood #immunesystem #immunesupport #coronavirus #antioxidants #vitamins #phytochemicals #omega3 #fruits #vegetables #protein #nodiet #citrus #greentea #ginger #garlic #免疫力 #肺炎 #抗氧化 #發炎 #口罩 #營養 #健康
2231645444106390493; 0; False; 1580252889; LUCAS+CORONA=LUCORONA #coronavirus
2231645418035227374; 0; False; 1580252886; Mujer asiática devastada porque su novio lo dejo por temor al coronavirus. Lamita tekulo quedó devastada luego de que su novio colombiano Armando Casa le dijera: " ushh la dejo mamacita, prefiero estar con María que es de muerte lenta, a estar con usted y su corona vaina rara". Luego de que nuestro equipo periodístico investigará, pudimos saber a qué hacía referencia Armando con muerte lenta, pues María tiene sífilis. No se pierda nuestro próximos avances. #China #Chineses #Asiática #Coronavirus #Sad #Triste #Comedy #Comedia #Humor #Notisemaforo #Podcast #Virus #Love #Relationship #Relaciones
2231645343920310570; 2; False; 1580252877; My dad just said the Corona virus should be called the Kungflu... I'm done. . . . . . . . . . . . . . . . . . #spam #spampage #coronavirus #conrona #flu #kungfu #disease #tea #tiktok #foryoupage
2231645214184296584; 0; False; 1580252862; It’s only January and I already hate 2020:neutral_face::neutral_face: #kobybryant #ww111 #australiafires #coronavirus #f***thisshitimout
2231645207841761779; 0; False; 1580252861; I’m ready to be drafted #ww3 #coronavirus #jesussmith #jesusavalos #jesusbombay #jesuslaflen #memes #raccooneggs #isis
2231643844390438721; 0; False; 1580252855; 90000 #coronavirus 'a yoluxmuş insan:hushed_face:Altyazı' nı oxuyun(Video 5 dəqiqəyə yaxın idi, hamısını paylaşa bilmədim) :small_blue_diamond: :small_orange_diamond: :white_small_square: :black_small_square: :small_orange_diamond: :small_blue_diamond: #repost #medical #china #chinese #nurse #cuba #havana #azerbaijan #doctor #earthquake #instagram #instagood #insta #instadaily #instamood #elazığ #deprem #brother #iran #trump #simpsons #istanbul #ankara #germany #france #usa #corona #virus
2231635960324694950; 1; False; 1580252852; Villages are sealing themselves off in China, blocking roads and building walls to protect against outsiders with #coronavirus. There are official and unofficial checkpoints, a dystopian vision. #Wuhan keep going. . . #china . . @dali.islam @dali.islam
2231645122505022611; 0; False; 1580252851; #funny #memes #meme #lol #coronavirus #reddit #wtf #lmao #rolf #memesdaily #dankmemes
2231645043081648972; 1; False; 1580252841; Delivering Packages in Corona California Like! #coronavirus
2231630643423121410; 0; False; 1580252833; Wuhan clan lunch Batsoup does not look delicious #wuhan #coronavirus #wutang #pandemic
2231636222458366950; 0; False; 1580252831; Not to live or be in Fear but to be AWARE! 5 cases so far in USA. There is a censorship going on about how dangerous this is. And China is lying about the severity. WE WILL NOT KNOW BUT ONLY A MONTH FROM NOW THE CONSEQUENCES. So protect yourself NOW. We really don’t know how many infected people have been traveling for the last couple months???? It sounds like morgellons in the sense that it’s an “intelligent virus” in a robotic type nature. It’s airborne- causing a cough or flu like symptoms orally. It is confirmed from mucus of the eyes also. Sounds a bit like the bird box? But some people have the virus and don’t know. This was man made virus in the Wuhan Laboratories in China where they work with biological warfare “Institute of Virology”. All their government officials fled the country. They are randomly ineffectively spraying down Wuhan with pesticides on the streets. They have known about the virus for months. The first case confirmed was a month ago so they say? So why did they not warn their own people and the rest of Gaia??? Only until MF’s were dropping dead on the streets!!!! Whether or not it was let out by accident or purpose we don’t know. But what we do know they can not seem to contain it - the virus has mutated. Which means no cure or understanding of it. It’s taking people out hard. I believe it is worse than they say it is. Vibe high friends!!!! Wear :face_with_medical_mask:mask /goggles:goggles: & gloves:gloves:. Stay in good health- be as POSITIVE (keep your frequency high) in your life as possible and stay away from certain areas or large crowds. NYC people should wear mask & gloves on subway. We don’t know who has it until a month from now. They have been letting planes go from around the world fly with Zero protection no masks or anything???? People don’t get sick until a few days later!!!.:heart_suit: #Alchemy #lightwarrior #whitewitch #extraterrestrials #hippies #selfsustainable #Plantbased #senstivesouls #healingcrystals #tarotlove #iamanoracle #coronavirus #selfcare #manifestationMagick #iammagnetic #cosmicconsciousness #galacticwarriors #soulconnection #Protectyourenergy #Ancestorswisdom #esoteric #freespirit #healingenergy #Witchymermaid #magickandMiracles #mothergaia
2231644910975900642; 0; False; 1580252826; Repost @who :thumbs_up_medium_skin_tone: In the Caribbean, we are susceptible to many diseases because of the great amount of foreigners that visit our countries! So, here’s some things you must know about the new coronavirus! :pill: . . . #facts #coronavirus #2019ncov #health #hygiene #medicine #medizine #awareness #change #kowledge #power #virus #antiobiotics
2231644891170974349; 0; False; 1580252823; Funcionarios de la Casa Blanca le han dicho a las aerolíneas estadounidenses que están considerando suspender los vuelos de China en medio de una creciente cifra de muertos por el nuevo coronavirus, según altos funcionarios de la administración. Las restricciones podrían afectar los vuelos dentro y fuera de China, así como los aeropuertos de Estados Unidos. Fuente: CNBC Recuerden seguir a @latam_markets . . . #whitehouse #casablanca #us #usa #eeuu #trump #coronavirus #virus #pandemia #china #chn #cny #shanghai #wuhan #wuhanvirus #hubei #shenzen #beijing #pekin #canton
2231644877305652701; 0; False; 1580252822; El #Coronavirus parece no tener tregua a pesar que las autoridades chinas han cercado la ciudad donde se origino los primeros brotes de la enfermedad...por lo que intentan construir un hospital en el menor tiempo posible.. Ahora esta gráfica nos muestra los países mas susceptibles ala proliferación y expansión de esta enfermedad para la que no hay vacuna y ha sido denominada de alto riesgo #venezuela:Venezuela: es de los países que no se encuentra preparados #venezolanosenelmundo #Tachira #vzla #caracas #maracaibo #aragua #bolivar ...
2231644809264296205; 0; False; 1580252813; Otra vez he dejado que pasen los días, pero viendo como va la cosa ya no lo puedo dejar más. Esta es la reflexión que hice el pasado viernes, cuando lo del coronavirus no era lo que es hoy. -Se puede comprobar en https://www.emilioenlaweb.es/Picotazos_Enero.html- Creo que no me he equivocado mucho. Pero en esto soy menos objetivo que tú. #quéopinas #periodista #ondace #reflexión #coronavirus #china #tranquilidad #sangrefría #oms #alarma #enero2020 #buenasnoches #instagram
2231644784752448166; 13; False; 1580252811; :microbe:Fashion Forward Virus Couture:microbe: . . All this talk about the virus and I’m just trying to enjoy this Asian Excursion I’m on! Picked a bad time to visit but I still don’t regret it! What an amazing trip I’ve been having! Traveling solo has certainly had its ups and downs but what an eye opening experience! I will be doing this again... :smiling_face_with_horns: . . #solo #soloexcursion #asianexcursion #asia #china #forbiddencity #virus #coronavirus #stayawayfromme #everyonehascooties
2231644771240419339; 0; False; 1580252809; Tusind tak for din opbakning, Japan, vi er varm på hjertet:red_heart::red_heart::red_heart:Thank you for your kindness and support:red_heart::red_heart::red_heart:患难见真情:red_heart::red_heart::red_heart:#freemasks#Japan#china#coronavirus
2231644738700492398; 9; False; 1580252805; Ye I’m gonna be real close to you soon :hundred_points:
2231644705959273091; 2; False; 1580252804; #Coronavirus | :black_small_square:Confirman un caso sospechoso. Se trata de un joven que pasó las fiestas en Europa y visitó China Continental, en zonas aledañas a Wuhan. El joven presentó cuadro febril y respiratorio. Está en su domicilio y siendo monitoreado estrictamente. #Unicanal:television:
2231644714667791054; 0; False; 1580252802; :face_with_medical_mask:Coronavirus 2019nCov / Coronavirus de Wuhan :face_with_medical_mask: Aunque en México de momento hay casos sospechosos sin confirmar por completo respecto a este virus , esté al igual que otros virus:microbe: que causan neumonía, el contagio se produce generalmente por vía respiratoria, a través de las gotitas respiratorias que las personas producen cuando tosen, estornudan o al hablar. Es por eso que aquí te dejamos varias formas para poder prevenirlo :index_pointing_up_light_skin_tone: . . . . . . #noticias #salud #coronavirus #wuhan #medicina #laboratorio #quimica #clinica #health #labwork #medicine #laboratory #healthcare #healthcaretips #doctor #chemistry #science #labhacks #tips #mexico #monterrey #mx #mty
2231644715898803328; 0; False; 1580252802; #coronavirus #lossimpsons #telegram
2231644634948628164; 1; False; 1580252793; TKA CHINA DILARANG KEMBALI KE CILACAP :play_button: Antisipasi Penyebaran Virus Corona . . . . Selengkapnya simak di harian pagi Tribun Jateng edisi Rabu 29 Januari 2020. . . . . #newspaper #news #info #headline #viruskorona #coronavirus #corona #cilacap #jawatengah #tribunjateng
2231644605403765848; 10; False; 1580252789; Sobe para três, o número de suspeitos de estarem contaminados com o coronavírus no Brasil, segundo o Ministério da Saúde. Além da jovem de Belo Horizonte, há um paciente sendo observado em Curitiba e outro em Porto Alegre. Especialistas acreditam que é “absolutamente possível” que o coronavírus seja transmitido pelos olhos. O contágio ocorreria quando o paciente encosta as mãos infectadas junto ao globo ocular. Especialistas em contágio da infecção ouvidos ainda ressaltam que o vírus pode se propagar por meio de tosses e espirros. Desse modo, o vírus percorreria o corpo até chegar aos olhos. Na China, 81 pessoas já morreram em decorrência da infecção. Nas Filipinas, há uma família brasileira internada com suspeita de ter contraído o vírus. . . . . . . . By: @revistaceara #virus #sus #saude #coronavirus #brasileiros #medicina #minasgerais #curitiba #portoalegre #brasil #ceara #fortaleza #infectologia #infecção #nordeste #noticias
2231644038965061381; 0; False; 1580252787; #me #metal #motivation #creative #bodybuilding #crossfit #calistenics #yoga #music #moda #model #makeup #creenciabase #winter #summer #kardashian #picoftheday #pink #youtube #mode #trump #memes #sunset #food #coronavirus #coronarvirus
2231644578083790097; 0; False; 1580252786; STARBUCKS CHINA는 어떻게 대처하고 있을까. 하워드 슐츠는 중국에서 엄청난 매출을 올릴 뿐만 아니라, 전세계로 유통하는 스타벅스 MD상품을 중국에서 만들고 있으니, 중국에게 고마워 해야한다. 미중/중미 갈등 속에서도 천문학적인 수치의 돈을 벌고 있으니 말이다. 이 #우한폐렴 #CoronaVirus 어려운 시기에 내가 대표라면, 매출고민이 아니라 사회적 역할 수행에 대한 고민을 한번 쯤 해볼 것 같다. 실천까지는 어렵더라도. (사진, 2011 북경 스타벅스) @yj_loves 용진이형은 어떻게 할 것인가. #星巴克 #스타벅스 #starbucks #teatime #喝茶 #바빠도커피한잔 #커피한잔의여유 #pantone #colors #color #팬톤 #trip #travel #여행스타그램 #인생 #행복 #life #happiness #성공 #success #사업 #management #foundr #entrepreneur #커피스타그램 #카페스타그램
2231644534975379749; 0; False; 1580252781; Image: @russellkightley * Via: @sciencephotolibrary * #CoronaVirus #virus #pandemic #disease #particle #biology #microbiology #human #China #Wuhan
2231644487301317683; 49; False; 1580252775; :globe_showing_Americas:O Ministério da Saúde anunciou na tarde desta terça-feira (28) dois novos casos suspeitos do coronavírus 2019-nCoV, um em São Leopoldo (RS) e outro em Curitiba (PR). Mais cedo, o governo havia noticiado a investigação de um caso em Belo Horizonte (MG). Inicialmente, o ministério disse que o possível caso no Rio Grande do Sul havia sido registrado em Porto Alegre, mas uma atualização mostra que ocorreu em São Leopoldo, região metropolitana. - A notificação à pasta federal que foi feita pela Secretaria de Saúde da capital gaúcha. O governo informou, ainda, que os dois pacientes do Sul do país se enquadram na definição de quadro suspeito estabelecida pela Organização Mundial da Saúde (OMS), com febre, pelo menos um sintoma respiratório e possível contato com a doença nos últimos 14 dias. - Caso em Belo Horizonte - A paciente cujo caso está sob investigação médica em Minas Gerais é uma estudante de 22 anos que viajou para Wuhan, na China. Ela chegou em território brasileiro em 24 de janeiro. Segundo o ministro da Saúde, Luiz Henrique Mandetta, a jovem está em um hospital de alta organização na área de infectologia. Todas as 14 pessoas que tiveram contato com ela também estão sendo monitoradas. - De acordo com Mandetta, a estudante relata não ter ido ao mercado de peixes da cidade, não ter tido contato com nenhuma pessoa doente e não ter procurado nenhum serviço de saúde enquanto estava na cidade. A Secretaria de Estado da Saúde de Minas Gerais informou que a jovem passa bem. - Amostra da paciente já foi recolhida e alguns exames serão realizados na Fundação Ezequiel Dias (Funed), em Belo Horizonte, como o infuenza A e B, adenovírus, bocavírus, metapneumovírus, parainfluenza 1, parainfluenza 2, parainfluenza 3 e vírus sincicial respiratório. Os demais exames, incluindo o específico para detecção do coronavírus, serão feitos na Fiocruz. Já a Agência Nacional de Vigilância Sanitária (Anvisa) está levantando os outros viajantes que estavam no voo que viajou da China até o Brasil - escalas foram feitas em Paris e Guarulhos. (Foto: Reprodução Internet) (Fonte: G1/Brasil) @exclusivo24hs
2231644414640349128; 0; False; 1580252766; Great job @caam_cdt last night at the @timberwolves halftime show where we performed for the Chinese New Year night! This was in an effort to celebrate CNY and show appreciations of the fans especially the ones in China. What made this one specially meaningful was that it was also to show love to the current situation in China as the deadly #coronavirus is being spread across not just China, but around the world. Humanity will come together stronger than ever and fight thru it! Even more, to honor and celebrate the life and passing of an NBA legend @kobebryant !!! Thank you for all you have done in the league and teaching us the value of love what you do and the work ethic known as #MambaMentality. We love you and miss you, Kobe Bean Bryant and your beautiful future WNBA daughter Gigi! Thank you @nba and @timberwolves for the wonderful opportunity! -tjxsy
2231644320461779345; 0; False; 1580252755; :sweat_droplets::sweat_droplets::dashing_away: . . . . . #meme #memes #bestmemes #instamemes #funny #funnymemes #dankmemes #offensivememes #edgymemes #spicymemes #nichememes #memepage #funniestmemes #dank #memesdaily #jokes #memesrlife #memestar #memesquad #humor #lmao #igmemes #memezerpub #memeaccount #memer #funnyposts #coronameme #coronavirus
2231644293920252293; 0; False; 1580252752; Viajeros internacionales :airplane:: ¿Van a viajar a un área :world_map: donde está circulando el nuevo #coronavirus? http://bit.ly/2Gjpmog
2231644110192810324; 0; False; 1580252747; Me #meme#memes#tyler1memes#tyler1#coronavirus#corona
2231644237992367723; 0; False; 1580252745; #coronavirus my ass!!
2231644203622933538; 0; False; 1580252741; #memes #dankmemes #edgymemes #anime #wipawinomemes #starwars #ecchi #offensivememes #memedealer #shrekmemes #yodamemes #babyyoda #bruh #shrekmemes #corona #coronavirusmemes #coronavirus
2231644136858845122; 0; False; 1580252733; Całe Orędzie: http://www.paruzja.info/2012.06.17_20-15.php #coronavirus
2231644048241000606; 1; False; 1580252729; Participe ao vivo da conferência online e saiba como se previnir e auxiliar no tratamento do Corona vírus e da Dengue através de uma boa hidratação. Clique no link e participe . https://www.instagram.com/fortmagoficial ⠀
2231644025264631784; 0; False; 1580252720; We came across a collection of photos and information from Wuhan, China while under quarantine due to the Coronavirus in an article from The Atlantic [@theatlantic]. The cover photo shows a group of women wearing protective masks while excerising.Take notice of the empty streets as the article explains that travel restrictions have been put in place. Also pictured is a police officer checking a driver's temperature. Images are from Getty Images. #NewsFTM #Coronavirus #NewsFTM057 #Disease #FaceMask #Quarantine
2231643917472529443; 1; False; 1580252710; Conoce y mantente informado sobre el nuevo virus que ha puesto en alerta al mundo. Principales preguntas sobre el coronavirus. ¿Qué es el Coronavirus? Es una gran familia de virus, algunos de los cuales pueden ser causa de diversas enfermedades humanas. Una nueva versión fue identificada en #Wuhan #China. Al día de hoy también han sido reportados casos #Japón, #Coreadelsur, #Taiwán, #Macao, #Tailandia, #Estados Unidos, #Vietnam, #Singapur, #Malasia, #Nepal, #Francia y #Australia. ¿Cuáles son sus síntomas? • Fiebre • Tos • Dificultad para respirar • Problemas gástricos • Diarrea En casos más graves: • Neumonía • Síndrome respiratorio agudo severo • Insuficiencia renal ¿Cuál es el origen? Esta nueva aparición fue detectada por primera vez en diciembre del 2019 en #Wuhan; las autoridades informaron que el centro de la epidemia fue detectado en un mercado de pescados. ¿Cómo se transmite este virus? Se encuentra entre algunos animales, pero de igual manera se transmite entre los humanos por vía aérea, contacto y a través de las secreciones por vía respiratoria. ¿Hay algún tratamiento? Todavía no hay vacunas ni algún medicamento para eliminar este virus, solo pueden ser tratados los síntomas por el momento. ¿Cuáles son las medidas de prevención? • Usar pañuelos para taparse la boca al toser y estornudar. • Lavarse bien las manos frecuentemente con abundante agua y jabón. • Evitar los lugares públicos muy concurridos. • Evitar contacto con personas que hayan viajado a las zonas donde han sido reportado los casos de la epidemia. • Acudir de inmediato a un médico tan pronto se identifiquen los síntomas. • Limpiar y desinfectar las superficies manipuladas. #Coronavirus #Coronavírus #nCoV #nCoV2019 #2019nCoV #China #epidemia #sars #virus #virus2020 #viruschino
2231643930892933994; 0; False; 1580252709; Quite a year here in Sydney... #coronavirus #bushfiresaustralia #plagues #enough
2231643931555354297; 7; False; 1580252709; Coronavirus Chino o 2019-nCov . Ya que se a poco se acerca a chile les dejo un poco de información sobre el nuevo Coronavirus que amenaza la humanidad :woozy_face: , síntomas y lo más importante como prevenir su contagio . :backhand_index_pointing_right_light_skin_tone: Si te sirvió mi post compártelo para no entrar en pánico y estar en conocimiento de las medidas a tomar :sparkles: . :backhand_index_pointing_right_light_skin_tone:Dudas o comentarios sobre el tema déjalas abajo :sparkles::smiling_face:( no me dejes tus síntomas ya que no puedo diagnosticar por Instagram :face_with_tears_of_joy:) . . . . . . . . #medicine #medicina #coronavirus #coronaviruschino #prevenircoronavirus #doctor #virus
2231643526504120494; 0; False; 1580252709; Some people in #Wuhan #China are taking the #coronavirus deadly serious. . Face masks are in short supply.
2231643840910106968; 1; False; 1580252698; Speriamo nel Corona Virus.... #china #coronavirus #pensacitu
2231643833225200351; 0; False; 1580252697; Marked #Safe from #WuhanCoronavirus :white_heavy_check_mark: :OK_hand_medium_skin_tone: #FreeShipping #OrderToday #MakeAStatement :hundred_points: #coronavirus #wuhan #wuhanchina #LetMeKnow
2231643364201924011; 0; False; 1580252682; Reposted from @cordova.media Seorang pejabat Kemenlu China, bernama Lijian Zhao memposting di akun twitternya, video pembangunan rumah sakit yang dibangun untuk pasien yang terjangkit virus Corona. Rumah sakit yang dibangun selama 16 jam ini, berbentuk box dilengkapi dengan teralis besi di jendelanya dan dan kunci yang diletakkan di pintu bagian luar.⁣ ⁣ Di postingan tersebut, ia juga menuliskan, "Let's pray for Wuhan & China", mari berdo'a untuk Wuhan dan China. Sudah jamak diketahui bahwasanya pemerintah China dari Partai Komunis China menganut paham atheisme. Namun dalam kondisi darurat seperti ini, salah satu anggotanya mengajak berdo'a untuk Wuhan dan China yang saat ini dilanda wabah virus Corona. Sudah menjadi fitrahnya, manusia bahkan ateis sekalipun, ketika dalam kesulitan, membutuhkan pertolongan dari Tuhan Yang Maha Kuasa.⁣ ⁣ "Dan dia dibantah oleh kaumnya. Dia berkata: 'Apakah kamu hendak membantah tentang Allah, padahal sesungguhnya Allah telah memberi petunjuk kepadaku'. Dan aku tidak takut kepada [malapetaka dari] sembahan-sembahan yang kamu persekutukan dengan Allah, kecuali di kala Tuhanku menghendaki sesuatu [dari malapetaka] itu. Pengetahuan Tuhanku meliputi segala sesuatu. Maka apakah kamu tidak dapat mengambil pelajaran [daripadanya]?" [QS. Al-An'am: 151].⁣ ⁣ "Dan sesungguhnya Kami jadikan untuk [isi neraka Jahannam] kebanyakan dari jin dan manusia, mereka mempunyai hati, tetapi tidak dipergunakannya untuk memahami [ayat-ayat Allah] dan mereka mempunyai mata [tetapi] tidak dipergunakannya untuk melihat [tanda-tanda kekuasaan Allah], dan mereka mempunyai telinga [tetapi] tidak dipergunakannya untuk mendengar [ayat-ayat Allah]. Mereka itu sebagai binatang ternak, bahkan mereka lebih sesat lagi. Mereka itulah orang-orang yang lalai" [QS. Al-A'raf: 179] . Revisi: di video tertulis 16 hari, yang benar adalah 16 jam sebagaimana yang tertulis di postingan Twitter tersebut. ⁣ #coronavirus #viruscorona #wuhan #china #ccp #xijinping - #regrann
2231643628593541184; 1; False; 1580252680; Follow @blac.kballs
2231643639833447376; 3; False; 1580252674; I tried to humanize the Coronavirus... And failed :D anyways, I really like how this drawing turned out. Stay safe y'all. Let's hope we all survive this plague. ° ° ° ° #coronavirus #virus #digitalart #medibangpaint #humanized
2231643629641630668; 1; False; 1580252673; My travel outfit from China due to coronavirus. Hopefully this deadly virus would be gone very soon. #godblesswuhan #godblesschina #coronavirus
2231643622410032313; 0; False; 1580252672; Repost @who :thumbs_up_medium_skin_tone: In the Caribbean, we are susceptible to many diseases because of the great amount of foreigners that visit our countries! So, here’s some things you must know about the new coronavirus! :baby_dark_skin_tone::girl_medium-dark_skin_tone::child_light_skin_tone::woman_medium-light_skin_tone::man_medium_skin_tone::old_woman_light_skin_tone::man_medium_skin_tone:‍:white_hair: . . . #facts #coronavirus #2019ncov #health #hygiene #medicine #medizine #awareness #change #kowledge #power
2231643370099116364; 0; False; 1580252666; Wuhan Jiayou! Thats happened at Wuhan in the night. #coronavirus #coronaviruses #coronavirusoutbreak #wuhancoronavirus #wuhanchina #wuhanvirus #chinavirus
2231643564184770798; 0; False; 1580252665; All the basics of the corona virus to get you up to speed and clear up any rumours/misconceptions regarding its description Source: PanayNewsDigital & Twitter #coronavirus #coronavirusoutbreak #corona #newpandemics #awareness #virus #latest #2020 #info
2231643393502984439; 5; False; 1580252662; Ops what did i drink
2231642386281781217; 1; False; 1580252652; Alex Jones show / banned.video Are you prepared for a global pandemic? Follow my Instagram:@legalize_truth_1776
2231643450655484568; 0; False; 1580252652; Epidemiological Analysis for 2019-nCoV Novel Coronavirus: https://link.medium.com/YAlockl1C3 #2019ncov #coronavirus #virus #china #wuhan #hubei #epidemic (Image credit South China Morning Post)
2231620908861553146; 0; False; 1580252649; Самые свежие новости. Организационный комитет Олимпийских игр 2022 года принял решение отменить церемонию запуска обратного отсчета до начала турнира, проведение которой было запланировано на пекинском стадионе "Птичье гнездо".. . . . . #coronavirus #короновирус #китай #европа #болезнь #смерть #опасность #мир #видео #хэштеги #новости #новости_ru #карантин #эпидемия #инстатаграм #весьмир #карантин #страх #top #люди #человек #video #life #жизнь #china #europe #ухань #wuhan #россия #болезнь
2231643406236138514; 0; False; 1580252646; [AHORA] El Ministro de Salud, Julio Mazzoleni, confirma un caso sospechoso de coronavirus en Paraguay. . Hasta ahora está bajo observación en Asunción y los resultados de análisis estarían listos entre 5 y 7 días. #A24Py #coronavirus
2231643288862302924; 1; False; 1580252632; The 1692 Jamaica earthquake struck Port Royal, Jamaica on 7 June Known as the "storehouse and treasury of the West Indies", and as "one of the wickedest places on Earth", it was, at the time, the unofficial capital of Jamaica, one of the busiest and wealthiest ports in the West Indies, and a common home port for many of the privateers and pirates operating within the Caribbean Sea. The earthquake caused most of the city to sink below sea level. About 2,000 people died as a result of the earthquake and the following tsunami; and, about another 3,000 people died in the days following the earthquakes, due to injuries and disease. #coronavirus #corona #earthquake #jamaicanhistory #jamaica #jamaicansbelike #kartel #vybzkartel #jamaicaearthquake #jamaicanmemes :black_small_square: :black_small_square: :black_small_square: :black_small_square: :black_small_square: Powered By: @SeanHenry.Gaza_Ent :black_small_square: :black_small_square: :black_small_square: :black_small_square: Follow My HashTag :backhand_index_pointing_down: For More Of Post! :black_small_square: :black_small_square: :black_small_square: #SHGE :black_small_square: :black_small_square: :black_small_square: :black_small_square: :black_small_square: #like4like #likeforlike #doubletap #likes #likesforlikes #likesforlike #likeforlikes #likes4likes #likes4like #like4likes #justinbieber #instagood #instalike #instadaily #folowforfolow #follow4follow #likeback #CaribbeanEarthquake
2231643063671790227; 4; False; 1580252628; Out here helping some of you out:folded_hands_medium_skin_tone:
2231643242624190599; 0; False; 1580252627; Gotta have a lot of fun there :eyes: #coronavirus #virus #memes
2231643158907930128; 0; False; 1580252617; ... :double_exclamation_mark:Коронавирус в Китае: По последним данным От 3000 до 4000 заразившихся. Около 100 умерших. - ВИЧ/СПИД в России: Более 1 миллиона заражённых ВИЧ. Более 37 000:double_exclamation_mark:умерших от СПИДа в 2019 году. Официальные (Данные Роспотребнадзора) - Но Российским СМИ абсолютно плевать на то, что у нас люди мрут десятками тысяч от неизлечимой болезни! Куда интереснее обсуждать вирус в Китае! . . .@respublica.dagestan подпишись чтоб оставаться в Курсе новых публикаций . . . . . . . . #coronavirus #WuhanCoronavirus⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣ #corona #ncov ⁣⁣⁣ #роспотребнадзор #спид #вич #Китай #Ухань#смертельныйвирус #вакцинация #карантин #вирус #летальныйисход #эпидемия #короновирус #короновирускитай #china #массовоезаражение #карантин #вирус2020 #эпидемия2020
2231643108366292809; 0; False; 1580252611; When paranoia kicks in. Note: masks and hand sanitizers are already sold out everywhere. I bought isopropyl alcohol as our alternative disinfectants. And good thing Bath and Body Works still has those tiny anti-bacterial hand gels available. #coronavirus #handsanitizers #surgicalmasks #alcohol #gloves
2231643074871062889; 0; False; 1580252607; Explicandole como sobrevivir a zombies ahora que hay casos de #Coronavirus :man_zombie: en Perú.
2231642989021570978; 0; False; 1580252596; US charted flight taking American citizens out of Wuhan, China, in lieu of the ongoing coronavirus outbreak. #flightradar24 #coronavirus
2231642138651434774; 0; False; 1580252596; Lemme catch any bitch ass nigga :face_with_steam_from_nose: -#ww3 #ww3memes #iran #usarmy #donaldtrump #funny #2020 #memes #barrackobama #trump #funnymemes #ww3draft #ww3drafting #ww3drafters2020 #worldwar #niggamemes #nigga #kobe #kobebryant #coronavirus #kobebryantmemes
2231642962387147729; 2; False; 1580252593; Mask up everyone :face_with_medical_mask: #coronavirus #facemask #maskup #imgood #becareful #dontcoughonme #마스크 #아프지말자 #다들조심하세요 #코로나바이러스
2231642801469232584; 0; False; 1580252589; #coronavirus
2231642928764530656; 0; False; 1580252589; Repost @who :thumbs_up_medium_skin_tone: In the Caribbean, we are susceptible to many diseases because of the great amount of foreigners that visit our countries! So, here’s some things you must know about the new coronavirus! :dog_face::grinning_cat_face_with_smiling_eyes: . . . #facts #coronavirus #2019ncov #health #hygiene #medicine #medizine #awareness #change #kowledge #power
2231642908600487436; 3; False; 1580252587; Bolver a bañarme :eyes: ~ RG Migraña - Síguenos para mas contenido :green_heart: - - - - #memesdaily #elgoth #meme #memesgraciosos #memesenespañol #memesespañol #memes:face_with_tears_of_joy: #memes #goth #siguemeytesigo #gothjaidefinichon #chileanmemes #jaidefinichongoth #china #coronavirus #gatitos #kakarot #dylantero #instagram #instamemes #simpsonsmemes
2231642893407744201; 0; False; 1580252585; Já é realidade aqui... Reposted from @minhacapital 18:30 ATUALIZANDO: Ao todo são 3 casos considerados suspeitos pelo Ministério da Saúde nos estados de Minas Gerais, Rio Grande do Sul e Paraná (os pacientes estão nas capitais dos estados: Belo Horizonte, Porto Alegre e Curitiba) . 10:30 AM >> Ministério da Saúde confirma caso suspeito de coronavírus em Minas Gerais. Paciente é uma estudante de 22 anos que esteve em Wuhan (cidade chinesa onde surgiu a epidemia) nos últimos dias . A paciente é uma estudante de 22 anos que chegou em território brasileiro no dia 24 de janeiro. Conforme o ministro, todas as 14 pessoas que tiveram contato com a estudante estão sendo monitoradas. . Com a suspeita confirmada, o Ministério da Saúde elevou a classificação de risco do Brasil para o nível 2, que significa "perigo iminente". Até segunda-feira (27), o país estava em nível 1 de alerta. . ÚLTIMAS ATUALIZAÇÕES: Alemanha confirma três novos casos, depois de França confirmar o quarto caso. . :police_car_light: ALERTA>> Na Alemanha :Germany: e no Japão :Japan: surgiram os primeiros casos de coronavírus em pessoas que não estiveram na China. . O especialista japonês, professor Mitsuo Kaku da Universidade de Medicina e Farmácia de Tohoku afirmou que será difícil controlar infecções e prevenir a disseminação do novo coronavírus . Ele insiste que as pessoas não encarem o vírus de forma branda, pois trata-se de uma nova linhagem que nunca antes havia infectado seres humanos. . #pandemia #oms #saude #virus #alerta #noticias #noticia #notícia #notícias #news #MinhaCapital #Brasília #Brasilia #BSB #MinasGerais #Coronavirus - #regrann
2231642893459005231; 0; False; 1580252585; #yummy #cancer #coronavirus :raised_fist_medium_skin_tone::microbe::face_with_tears_of_joy::microbe::microbe::microbe::skull::skull::middle_finger_medium_skin_tone::middle_finger_medium_skin_tone:#Victory for the animals :grinning_squinting_face:
2231642871847776471; 0; False; 1580252583; Coronavirus illustrated. The virus is spreading like wildfire. Countries are putting in place travel bans. Only time will tell how the world contain this deadly virus. #coronavirus #coronavirusoutbreak #keepclear #travelbans #asiapacific
2231642863878657029; 0; False; 1580252582; #Repost @cfmvoficial with @make_repost ・・・ Você sabe o que é CORANAVÍRUS? :microbe::microbe: É um novo vírus que tem causado doença respiratória pelo agente coronavírus (uma grande família viral, conhecida desde meados de 1960), com casos recentemente registrados na China. . :backhand_index_pointing_right: “Com base nas informações disponíveis não se sabe se o 2019-nCoV tem algum impacto na saúde dos animais e nenhum evento específico foi relatado em qualquer espécie animal, até o momento”, afirma nota técnica do Ministério da Agricultura, Pecuária e Abastecimento. . :writing_hand_light_skin_tone: A recomendação é que “os veterinários devem manter um alto nível de vigilância e relatar às autoridades veterinárias qualquer evento incomum detectado em qualquer espécie animal, notificando imediatamente o Serviço Veterinário Oficial pelo e-SISBRAVET”. Para a população, o Mapa orienta que “ao visitar mercados ou feiras de venda de animais vivos, carnes, peixes ou produtos de origem animal frescos, devem ser aplicadas medidas gerais de higiene e prevenção. Saiba mais sobre a nota técnica no #PortalCFMV (link na bio). . . #coronavirus #coronavírus #2019ncov #medicinaveterinaria #medvet #medicoveterinario #veterinario #CFMV #CFMVnaMidia #RedesCFMV #saudeanimal #animal #saudeunica
2231642808622737300; 0; False; 1580252575; Plomo hijueputa jajajja Sigueme para más contenido @pegaconhuevo #memeslatinos #memesenespañol #memesmexicanos #humorlatino #humormexicano #memesdivertidos #momos #memesgraciosos #memesdemexico #diversion #memesenespañol #memesespañoles #humor #meme #humornegro #humorcrew #memesespaña #memess #memeslatinoamerica #memesmundial #instamemes #memesinstagram #memescolombia #memesargentina #chilememes #expert #coronavirus #bff
2231642457712357782; 90; False; 1580252575; :face_with_medical_mask::skull: @amanlikejoseph #coronavirus
2231642788976655308; 0; False; 1580252573; Sorry for inactivity, I was busy with myself. I'm just thinking about this year. I mean, 2020 already fucked everything. Swipe left for the video:woman_facepalming_light_skin_tone: #Jufu #Tiktok #CoronaVirus #Earthquake #corona #wuhan #australia
2231642777242993883; 0; False; 1580252571; #coïncidence #:thinking_face: #mysterious #coronavirus #china #virus #:face_with_medical_mask:
2231642608623781956; 0; False; 1580252568; Don't worry guys, we're safe :upside-down_face: - - - - - - - - #shitpost #oc #dankmemes #dank #China #coronavirus #Luigi #meme #memes #offensivememes:sweat_droplets::eyes::hundred_points::face_with_tears_of_joy::face_with_tears_of_joy::gem_stone::fire::face_with_steam_from_nose::sweat_droplets::OK_hand::hundred_points::face_with_tears_of_joy::folded_hands::face_with_tears_of_joy::face_with_tears_of_joy::gem_stone::gem_stone::fire::face_with_steam_from_nose::sweat_droplets::eyes::eyes: #edgymemes #edgyhumor
2231642732842335852; 0; False; 1580252566; Marked #Safe from #WuhanCoronavirus :white_heavy_check_mark: :OK_hand_medium_skin_tone: #Order your #Tee today and #MakeAStatement :hundred_points: #coronavirus #wuhan #stayaway #stayvirusfree #wuhanchina
2231642508084580058; 136; False; 1580252555; Menschenleere Straßen statt dichtem Gedränge - die 11-Millionen-Stadt Wuhan wurde nach dem Ausbruch des Coronavirus unter Quarantäne gestellt. An den Straßen, die aus der Stadt führen, hat die Polizei Straßenblockaden errichtet. Alle Flüge sind gestrichen, es fahren keine Busse und U-Bahnen. Autos dürfen nur noch mit einer Sondergenehmigung im Zentrum von Wuhan fahren - zum Beispiel Krankentransporte oder Behördenfahrzeuge. Millionen Menschen stecken fest, dürfen nicht raus. Sie sollen am besten nicht vor die Tür gehen - und wenn, dann nur mit Mundschutz. Sonst droht Strafe. Die Menschen dürfen einkaufen gehen. Viele decken sich jedoch direkt mit großen Mengen Lebensmitteln ein, um nicht so oft vor die Tür zu müssen. Eine so große Stadt wurde noch nie unter Quarantäne gestellt. Experten sehen das Vorgehen der chinesischen Regierung kritisch. "Es ist nicht möglich, eine Stadt von der Größe New Yorks oder Londons ohne erhebliche Menschenrechtsverletzungen zu schließen", sagt Lawrence Gostin, Direktor des O'Neill Instituts für Nationale und Globale Gesundheit der Georgetown University in den USA. Die Abriegelung könne zu Panik und Versorgungsengpässen führen. Auch viele Menschen aus Europa sind noch in Wuhan. Die Europäische Kommission hat angeküdigt, zwei Flüge zu finanzieren, um die Menschen zurückzuholen. Laut Medienberichten plant auch die Bundeswehr, 90 Deutsche aus der Region nach Deutschland zu holen. Das neuartige Coronavirus kann eine Lungenkrankheit auslösen, an der im Hauptverbreitungsland China bereits mehr als 100 Menschen gestorben sind. Die meisten von ihnen waren ältere Patienten mit schweren Vorerkrankungen. Die Gesamtzahl der weltweit bekannten Erkrankungen liegt derzeit bei mehr als 4500. #wuhan #coronavirus #china #tagesschau
2231637320073964646; 5; False; 1580252498; Is China lying? Experts question why authorities suddenly kicked into action weeks after first coronavirus case was reported. Claims that China used its superpower status to stop UN declaring an international emergency
2231641945277849393; 0; False; 1580252472; Such a good start. #meme #memes #dankmemes #kobebryant #australiafires #ww3 #coronavirus #january2020 #2020 #bad #pokemon #anime
2231641548150392677; 0; False; 1580252425; Lush store is open for everyone who want to wash your hands. #AllareWelcome#러쉬에서손씻기 고객여러분과 직원의 건강을 위해 러쉬는 직원들의 마스크 착용을 권고하고 있습니다. 모두모두 건강하게 지나가기! #신종코로나바이러스 #coronavirus #러쉬손씻기 #손씻기 #손씻자 :smiling_face_with_smiling_eyes: #seoul #seoultravel #lush #southkorea #seoulfood #koreafood
2231641174580696450; 0; False; 1580252380; El KoRonaViruz Credit: @caladrilp0st . . . . . . . . . . . . . . . . . . . . . . . . . . . . #marvel #dc #dccomics #coronavirus #memes #meme #memeespañol #momazo #memesdaily #argentina
2231640402283651985; 1; False; 1580252348; http://thoibao.com/hau-qua-cua-dich-viem-phoi-corona/
2231634837742457606; 4; False; 1580252137; Arkadaşımız çinden yolladı bu video china virüs #china #wuhan #virus#coronavirus
2231635346351911528; 0; False; 1580251685; :China::broken_heart: • #CORONAVIRUS #coronaviruschina #travel #travelphotography #travelling #china #china:China: #beijing #beijing:China: #beijingtrip #короновирус #короновируснаяинфекция #короновирускитай #коровавирус #комаровирус #кротовирус
2231594710787842205; 0; False; 1580246841; :prayer_beads::nazar_amulet: #coronavirus
2231536104054676567; 0; False; 1580239855; @wylsacom, Apple и Samsung под угрозой! В китае закрыли заводы Apple и Samsung. Расположенное в Китае производство продукции Apple находится под угрозой срыва из-за коронавируса, пишет Bloomberg со ссылкой на экспертов, а также Nikkei Asian Review со ссылкой на источники среди поставщиков компании. Подписывайтесь на наш instagram и узнавайте новости первыми! Новости без Цензуры 18+ в нашем Telegram канале (ссылка в шапке профиля)
2231509105009285413; 0; False; 1580236636; :high_voltage:Во Франции подтверждён 4 случай заражения коронавирусом — Le Figaro состояние пациента – критическое. Подписывайтесь на наш instagram и узнавайте новости первыми! Новости без Цензуры 18+ в нашем Telegram канале (ссылка в шапке профиля)
2231377480049478966; 0; False; 1580220945; #publichealth #coronavirus
2231368443848654359; 0; False; 1580219893; Wuhan, China #coronavirus #coronaviruses #coronavirusoutbreak #wuhancoronavirus #wuhanchina #wuhanvirus #chinavirus
2231334126942652129; 1; False; 1580215799; #coronavirus #coronaviruses #coronavirusoutbreak #wuhancoronavirus #wuhanchina #wuhanvirus #chinavirus
2231642636346085616; 0; False; 1580252554; CDC TESTS FOR CORONAVIRUS ON LI! One person who recently passed through Nassau County is among 4 individuals in the state who are under surveillance for the coronavirus. Health officials report one of the cases has tested negative while the other 3 remain unknown. Click here for more information. ⠀ #coronavirus #publichealth #nassaucounty #sileringber⠀ https://www.newsday.com/news/health/coronavirus-nassau-county-health-advisory-long-island-1.40963011
2231642557805584467; 0; False; 1580252549; O início de 2020 está sendo abalado por uma emergência internacional: o surto do novo coronavírus originado na China. O país asiático já registra mais de 100 mortes e milhares de infectados pelo mundo. Para evitar a disseminação do vírus, que provoca sintomas de gripe que levam a síndrome respiratória grave, o governo chinês adotou uma série de medidas como o isolamento de 11 milhões de pessoas que moram na cidade de Wuhan, o epicentro do vírus. ⠀ Na eventualidade do surto chegar ao Brasil, teria o país estrutura para uma resposta das proporções demonstradas pelo governo chinês (como o isolamento de milhares de pessoas e a construção rápida de hospitais)? O país não é estranho a surtos e epidemias, como ocorreu na H1N1, zika, chikungunya, febre amarela e dengue. Dessa forma, as autoridades brasileiras possuem protocolos de ação para situações semelhantes, mas há quem questione se esses conhecimentos, e as respostas postas em prática, seriam suficientes para proteger a população. ⠀ Você acha que o Brasil está preparado? Responda no #Quinto :mobile_phone_with_arrow: . . . . #somosquinto #coronavirus #saude #brasil #mundo #china #corona
2231642569121465800; 0; False; 1580252546; #coronavirus :clapping_hands_light_skin_tone::clapping_hands_light_skin_tone::clapping_hands_light_skin_tone:
2231642481133710400; 5; False; 1580252536; The Simpsons called the Coronavirus too :face_with_tears_of_joy::face_with_tears_of_joy::face_with_tears_of_joy: #coronavirus #virus #meme #viral #comedy #china #thesimpsons #simpsons #flu #lol #2020 #followforfollowback #follow
2231641960065316786; 0; False; 1580252530; #FLERISMO #postgraffiti #calligraffiti #graffuturism #sculpture #graffitrips #lordgraffiti #fler1 #3d #deltas #coronavirus #lettering #letters #artcontemporain #abstractart #arquitectura #design #ceramica #clay #barro #abstractexpressionism #art #colima #mexico #minimalism #mixedmedia #Flerstudio #goodvibes
2231642428972435265; 0; False; 1580252530; BTC Price Back at $9,000 But No, Coronavirus Isn't 'Good for Bitcoin' #Bitcoin (BTC) may be gaining thanks to “economic fear” over #coronavirus — but only up to a point, analysts are concluding as the disease spreads. The #cryptocurrency hovered at around $9,000 on Tuesday, capping 4% gains for the week in which coronavirus sent China into partial lockdown. Coronavirus uncertainty creeps into markets Fears are now surfacing about the impact on Chinese economic growth, while global signals also suggest investors are more cautious about the short term. Markets analyst Mati Greenspan, the sentiment is already palpable. Uploading a chart of United States bond yields, he noted one-month performance delivered higher returns than the longer seven-year options. “It means investors are expecting trouble in the short term,” he explained in comments. Such economic uncertainty and unease on markets have often sparked increased bullish action for Bitcoin. As Cointelegraph noted, the Iran crisis earlier this month was just the latest geopolitical event that appeared to buoy the Bitcoin price. While Greenspan noted Bitcoin remained a highly non-correlated asset, mainstream media claims that Bitcoin was defying traditional markets and gaining purely on the back of coronavirus were widely panned. A report by the Financial Times with the headline “Coronavirus is good for Bitcoin” came in for particular criticism. Notably, the report cited two random Twitter accounts dedicated to altcoin XRP as sources. As reported, Bitcoin has long exhibited increasingly strong technical fundamentals, which preceded recent price moves. Vays: virus would “hurt” #BTC in epidemic scenario Discussing the impact of coronavirus, trader Tone Vays nonetheless stopped short of agreeing with the idea that the disease could perpetually fuel further gains. If it were to spread internationally, for example, panicked investors would likely reduce speculative activity, meaning less interest in non-traditional assets such as Bitcoin.
2231641697368324171; 0; False; 1580252525; People heard chanting “WUHAN, FIGHT!” From their windows. Purchase Respirator Masks to prevent yourself from catching the virus. Stay safe. #coronavirus #wuhan #china #wuhanvirus #coronavirusleaks #wuhannews #coronavirusnews #virusleaks #coronaleaks #wuhanleaks #wuhanvirusleaks #plague #reshare
2231642355721923531; 2; False; 1580252521; Aveces tomar otro aire no hace mal:face_with_medical_mask::face_vomiting: . . . . . . . . #nuevoaire #nuevavida #conocergentenueva #sacaralperro #comeratones #coronavirus #likeforlikes #followforfollowback #instagood #instalike
2231642347704062582; 0; False; 1580252520; Amigo policía, sabemos que por tu trabajo estás expuesto a muchos riesgos, custodias hospitales, aeropuertos y lugares donde la exposición al contagio es muy alta. Es por esto que @saludpol_peru te informa sobre el #coronavirus. @policiaperu @mininterperu
2231642332141352498; 0; False; 1580252518; • • • #coronavirus #reddit #redditmemes #meme #memes #dankmeme #dankmemes #funny #funnymeme #funnymemes #memegod #memesdaily #dailymemes #dailymemesforyou #dailydankmemes #area51memes #offensivememe #offensivememes #darkhumor #twittermemes
2231642329088030839; 0; False; 1580252518; Y'all in? #virus #coronavirus
2231642247107745797; 0; False; 1580252508; #wuhanvirus #coronavirus #kobebryant #sacrifice #ontariocalifornia #bayarea #freemasonritual
2231640191184138805; 0; False; 1580252505; China eats anything that flies that’s not aeroplane Anything that stands on fours that’s not a table Anything that’s under the sea that’s not a submarine Anything that moves that’s not metal .......it’s true!!!!! That’s why they are now suffering from #coronavirus #coronavirus #chinatown #chinavirus #chinavirusnews #chinacoronavirus
2231641848162953127; 0; False; 1580252485; #Repost @minhacapital • • • • • • Wuhan, China EXCITANTE: Los videos muestran a los residentes de Wuhan (el epicentro del brote de Coronavirus :microbe:) en el balcón de sus apartamentos gritando por las ventanas y cantando canciones patrióticas y el himno chino para animarse. Los videos se están difundiendo en las redes sociales. . Wuhan, con 11 millones de habitantes, está en cuarentena. La ciudad ha sido aislada por el gobierno chino desde el jueves (23). Calles y aeropuertos vacíos, pero los hospitales aún están llenos. EMOCIONANTE: Vídeos mostram moradores de Wuhan (epicentro do surto do Coronavirus :microbe:) na varanda de seus apartamentos gritando pelas janelas e cantando canções patrióticas e o hino da China para se animarem. Os vídeos estão se propagando nas redes sociais. . Wuhan, com 11 milhões de habitantes está em quarentena. A cidade está isolada pelo Governo chinês desde quinta-feira (23). Ruas e aeroportos vazios, mas hospitais continuam lotados. . #pandemia #Wuhan #oms #saude #virus #alerta #noticias #noticia #notícia #notícias #news #MinhaCapital #Brasília #Brasilia #BSB #MinasGerais #Coronavirus Vídeo: reprodução #colombia #venezuela #portugal #españa #usa #madrid #barcelona #china #europe
2231641781405421572; 5; False; 1580252484; Writer:@catherinelizmorgan⁠ Media:@kathryn.mcauliffe⁠ As of January 28, 2020 [GMT 1:30AM], the global regions with official confirmed cases of Coronavirus are the following: China - Hubei (2,714), Zhejiang (173), Henan (168), Guangdong (151), Chongqing (132), Anhui (106), Hunan (100), Sichuan (90), Shandong (87), Beijing (80), Jiangxi (72), Jiangsu (70), Shanghai (66), Fujian (59), Guangxi (51), Shaanxi (35), Hainan (33), Hebei (33), Heilongjiang (30), Liaoning (27), Yunnan (26), Tianjin (23), Shanxi (20), Gansu (19), Inner Mongolia (11), Guizhou (9), Ningxia (7), Jilin (6), Qinghai (6), Xinjiang (5) Global - Hong Kong (8),Thailand (8), Macau (6), Taiwan (5), Singapore (5), Australia (5), Japan (4), Malaysia (4), South Korea (4), France (3), Vietnam (2), Cambodia (1), Nepal (1), Sri Lanka (1), Canada [ON - 1], Germany [BY -1], United States [CA - 2, AZ - 1, WA - 1] ** Data projected has been gathered through data provided by Johns Hopkins CSSE using data from CDC, WHO, NHC, and Dingxiangyuan**#politics #news #currentevents #politica #politik #politicalscience #politicalcompass #balancetheballot #youth #voting #mun #debate #discussion #politicaldebate#Wuhan #china #chinese #wuhanvirus #coronavirus #who #worldhealthorganization
2231642036419696162; 0; False; 1580252483; #health #santé #salud #prevention #coronavirus #virus #hygiène #propreté #agua #water #eau se #laver les #mains #:face_with_medical_mask: #:clapping_hands: #:raising_hands: #:open_hands: #family #society #petits et #grands #:family_man_woman_girl_boy:
2231642037317101824; 1; False; 1580252483; Info On Wheels Team JaPenKB turun padang semalam 28/01/2020 untuk mengedarkan risalah dan penyampaian maklumat berkenaan; :large_blue_diamond: Novel Coronavirus (2019-nCoV) :large_blue_diamond: Langkah-langkah Pencegahan :large_blue_diamond: Tanda & Gejala Di harapkan agar semua warga Kota Belud untuk sentiasa mengambil langkah berjaga-jaga bagi membendung penularan wabak ini. Mohon juga untuk tidak panik dan terus menerus menyebarkan info yang belum pasti kesahihannya memandangkan pelbagai maklumat viral yang palsu di media sosial kini, pastikan anda merujuk kepada laman web / Page Facebook Kementerian Kesihatan Malaysia. #InfoOnWheels #coronavirus #JapenSabah #JaPenKB #SayangiMalaysiaku #MalaysiaBersih #SharedProsperity
2231641779215089734; 67; False; 1580252478; Expertos de China advierten que habría 44.000 infectados por el coronavirus Investigadores de Hong Kong (China) advierten que el nuevo coronavirus está a punto de convertirse en una epidemia global y estiman que unas 44.000 personas estarían infectadas con ese microorganismo, muchas más de las que sugieren las cifras oficiales hasta el momento. · · · #rtenespañol #actualidadrt #rtplayes #noticias #news #coronavirus #china #australia #tailandia #thailand #singapur #francia #france #malaysia #coreadelsur #southcorea #estadosunidos #usa #vietnam #nepal
2231641987724329307; 0; False; 1580252477; Stay safe! Take Precautions :dizzy_face::alien::confounded_face::weary_face::fearful_face: #coronavirus #coronavirusoutbreak #precautions
2231641945260665068; 2; False; 1580252472; Get your face masks now
2231641894760587826; 48; False; 1580252471; Big Up :folded_hands::fire: Credit if reposted - - - Tags: ____________________ #wholesomememes #pronouncingthingscorrectly #cancerousmeme #dankmemesmeltsteelbeams #memesdaily #funniestmemes #wuhanvirus #offensive #coronavirus #cutememes #wholesomegfmemes #vinesthatkeepmefromendingitall #videomemes #dankmemes #edgymemes #originalmemes #wholsomememes #freshmemes #kobe #kobememes #ripkobe #nicememes #goodmemes1 #regularshow #regularshowmemes #ww3 #wwiii
2231641863620721269; 0; False; 1580252462; Good evening - - - #meme #memes #dankmeme #dankmemes #coronavirus #coronavirismemes #pewdiepie #pewdiepiememes
2231641800086681923; 0; False; 1580252455; Tras el anuncio de cuatro posibles casos del #coronavirus en el Perú, el Ministerio de Salud (MINSA) a comenzado a tomar medidas. ¿Sabes lo que debes hacer para prevenir el contagio de este virus respiratorio? :thinking_face: Te lo explicamos. :winking_face: #EmpresaSaludable
2231641486890689083; 0; False; 1580252443; China: Un paciente contagiado del Coronavirus intentando salir del área de aislamiento. Cientos de muertos y miles de infestados, propagado a varios países. #Coronavirus https://t.co/FIh0GPAWWH
2231641682494327175; 2; False; 1580252441; If you read this NYT story carefully you’ll catch reference to this not being the ONLY case of American Scientists trying to or successfully steal and sell bio tech to China. Nothing to worry about though I’m sure. #coronavirus #novelcoronavirus #conspiracyrealist #lookintoit #smokeindicadoshitanyway
2231641670265136048; 1; False; 1580252439; El coronavirus de Wuhan es una nueva cepa que no se había visto antes en humanos, lo que significa que aún queda mucho por investigar al respecto. Este virus afecta las vías aéreas bajas (de la tráquea a los bronquiolos) y está relacionado con el SARS-CoV y MERS-CoV. :warning:El lapso de tiempo entre la infección y la aparición de los síntomas (conocido como el período de incubación)es de entre uno y 14 días. :ballot_box_with_check:Los primeros síntomas son fiebre, malestar general, tos seca y dificultad respiratoria. :question_mark:En caso de que tengas alguna inquietud, puedes preguntarme, con confianza. :slightly_smiling_face: :hospital: HMG Hospital Coyoacán, torre médica sexto piso, consultorio 609. :credit_card: Se aceptan tarjetas de crédito, débito. :white_heavy_check_mark:Expido factura, por si lo necesitas. :spiral_calendar:Por favor, agenda tu cita, con mi asistente de lunes a viernes de 10 a.m. a 8 p.m. y sábados de 9 a.m. a 1 p.m. :telephone: 55 4435 8345 #coronavirus
2231641029769719939; 1; False; 1580252437; 16 Negara Terinfeksi Virus Corona⁣⁣ ⁣⁣ Otoritas China mengumumkan peningkatan total kematian akibat virus corona, dari sebelumnya berjumlah 82 orang meningkat menjadi 106 orang. Selain itu, total negara yang telah terdeteksi virus corona menjadi 16 negara.⁣⁣ ⁣⁣ Negara mana sajakah itu? Simak informasi selengkapnya dalam video berikut ini!⁣⁣ ⁣⁣ cr : @kompastv ⁣⁣ #coronavirus #corona #wuhan #china #newsupdates #infoterkini #beritaterkini #sulawesi24jam
2231641347412755749; 1; False; 1580252432; Corre!!! . . . . (Tags ignorem) . #memesbrasil#coronavirus#piadas#piada#humor#humornegro#humoracido#zueira#memesengraçadosbrasil#memes#memesbrasileiros#run#corre
2231641546556629756; 2; False; 1580252425; 𝑩𝒓𝒐𝒘𝒏𝑺𝒌𝒊𝒏𝑮𝒊𝒓𝒍 @divarhxoxo
2231641480725197199; 0; False; 1580252417; Coincidence? I think not #coronavirus #racoon #umbrella #zombie #zombieoutbreak #residentevil #mate #whatthefuck
2231641433251853827; 0; False; 1580252411; #Repost @bk3_adaro • • • • • • Novel Corona Virus adalah Virus jenis baru penyebab penyakit saluran pernafasan. Virus ini diketahui pertama kali muncul di china. Yuk Kenali Tanda Gejalanya serta Pencegahannya. #corona #coronavirus #who #healthtalk #healthylifestyle #bulank3 #bulank3nasional #kesehatan #kesehatankerja #kesehatandankeselamatankerja #minerba #pertambangan #tambangbatubara #adaro #adaroenergy #adaromining #adaroindonesia #kitasatumindset_zeroaccident
2231641429401466297; 1; False; 1580252411; #ApodérateEc #Urgente #ÚltimaHora #Internacionales #China:China: #Coronavirus Las autoridades de China acaban de confirmar 25 muertes más en este país por el coronavirus. Así las víctimas suben a 131.
2231641429913100434; 0; False; 1580252411; With news about the novel coronavirus outbreak circulating, people are becoming fearful and may be letting their fear get the best of them. The chances currently of an outbreak in Canada is very low and even if contracted, the chances of death is also low because pneumonia, which is the primary killer caused by the coronavirus, can also be caused by viruses that are present in our everyday life —Canada’s healthcare system is also more equipped than China’s to treating pneumonia. Experts say that the flu is projected to kill more this year than the coronavirus. With that being said, we should still take sanitary precautions to prevent from catching anything at all. Remember to; . 1. Wash your hands thoroughly with soap before eating or touching your face. . 2. Cover your mouth when you cough and sneeze. . 3. Avoid close contact with people who are sick. . 4. Take precaution if you are sick yourself so you don’t infect others. . 5. Don’t let your fears get the best of you. Educate yourself and don’t believe everything you see on social media! . Photos from ISTOCK . #virus #coronavirus #health #healthy #canada #coronaviruscanada #staysafe #safe #sanitary #toronto #outbreak #wuhan #pneumonia #corona
2231641395553267680; 0; False; 1580252407; Corona virus some pussy shit #memes #dankmemes #memez #dankmemez #mastermemasaurus #corona #coronavirus #epedemic #china #yeet #zuckles #alcohol #explore #explorepage
2231641366965139570; 0; False; 1580252403; Hong Kong closes China borders as Wuhan coronavirus spreads https://cnn.it/37zihvA #CoronaOutbreak #coronavirus
2231641354551104916; 0; False; 1580252402; :eyes::face_with_monocle::thinking_face: ⠀⠀⠀⠀⠀⠀ ⠀⠀⠀ ⠀⠀⠀⠀⠀⠀ ⠀⠀⠀⠀⠀⠀ ⠀⠀:Thailand: | URGENTE - CORONAVIRUS: Tailandia reporta 14 casos del virus, 5 de ellos han regresado a casa y 9 continúan hospitalizados. Al menos 81 sospechosos de la enfermedad. ⠀⠀⠀⠀⠀⠀ ⠀⠀⠀ ⠀⠀⠀⠀⠀⠀ ⠀⠀⠀⠀⠀⠀ ⠀⠀⠀⠀⠀⠀ ⠀⠀⠀ ⠀⠀⠀⠀⠀⠀ ⠀⠀⠀ ⠀⠀⠀⠀⠀⠀ ⠀⠀⠀⠀⠀⠀ ⠀⠀⠀⠀⠀⠀ ⠀⠀⠀ ⠀⠀⠀⠀⠀⠀ ⠀⠀⠀⠀⠀⠀ ⠀⠀⠀ ••••••••••••••••••••••••••••••••••••••••••••••••••••••••••••••• ⠀ @doblemoralrd noticias #actualidad #internacional #republicadominicana #view #alerta #novedad #viral #rd #dominicannetflix #doblemoralrd #dominicana #jamaica #japon #jamaica #japon #franklinmirabal #licey #cuba #haiti #toros #bonilla #ericfilia #delacruz #pelucho #brito #pujeazul #seriefinallidom2020 #coronavirus #wuhan #tailandia #wuhanvirus #wuhanchina.
2231641323186475021; 0; False; 1580252398; #caso de #coronavirus confirmado no Brasil e outros casos ainda em suspeita. Vamos nos cuidar e ficar atentos. Os cuidados são os mesmos que tantos outros vírus transmitidos pelo ar, como a gripe. #prevenção #ebserh
2231641288489613394; 12; False; 1580252394; Koronavirüs salgını sebebiyle ölenlerin sayısı 131'e yükseldi. -Son 24 saatte 25 kişinin öldüğü koronavirüs salgınında, virüs tespit edilen vaka sayısı 5.484 ulaştı. #bilgi #bilgiler#gündem #sondakika#haber #koronavirüs #coronavirus
2231641262126435528; 0; False; 1580252391; :Philippines:Friends who are in #POLITICS now its your time to help our people. Philippines as a great tourist destination will surely be at #HIGHrisk in aquirring this #coronaVirus :double_exclamation_mark:Eyes here! Calling to those in position of #POWER in the #PhilippineGovernment Increase the salaries this 2020 of our #FilipinoHealthWorkers Lets retain our #FilipinoDoctors, #FilipinoNurses, #FilipinoBiomedicalScientist and #FilipinoHealthCareExperts for our own sake. #Philippines Health Care system. Who will take care of us in #ThePHILIPPINES if everyone flies abroad. #Migration is not because of low salaries in PH but rather a rare calling. Shall we call it migration growth of the soul and finding Sense of Purpose.
2231641262098749702; 0; False; 1580252391; #wuhanjiayou #coronavirus #prayforwuhan:folded_hands_light_skin_tone: #화이팅
2231639970781802439; 0; False; 1580252386; :grinning_face_with_sweat: ‘you gon die’ #coronavirusmemes #coronavirus #memes#meme#drip #driptoohard #darkmemes #darkhumour #dankmemes #dankmemesdaily #lightskinwonderful #ynwmelly #mixedpersonalities #crush #rapperedits
2231641203724378135; 0; False; 1580252384; O Ministério da Saúde confirmou nessa tarde mais duas suspeitas de infecção por coronavírus, desta vez em Porto Alegre (RS) e Curitiba (PR). #portallr1 #brasil #confirmacao #ministerio #saude #coronavirus #suspeita #rs #pr
2231641192188988872; 0; False; 1580252382; F*#deu . . . . . . . #coronavirus #Umbrella
2231641162427724494; 0; False; 1580252379; Marked #Safe from #WuhanCoronavirus :white_heavy_check_mark: :OK_hand_medium_skin_tone: #Order your #Mug today and #MakeAStatement :hundred_points: #coronavirus #wuhan #coffee #starbucks #dunkindonuts #dunkin #FeverFree :grinning_face_with_big_eyes:
2231639781142602264; 0; False; 1580252370; #virus #china #coronavirus #news #health #worldwide #corona
2231639689405074170; 8; False; 1580252365; #wuhan #coronavirus I think this is very serious click the #hashtag do ur your research and #pray keep ur #immune #system #strong #herbs and #fruits #faith in #jesus
2231641037814617578; 1; False; 1580252364; FLU BOMB! With everyone freaking out over the coronavirus, which is just another variant of the flu, figure it’s time to do a post. ************************************ The best way to protect yourself from either getting the flu OR treating it if you get it is through boosting your immune system ************************************ Best way to boost the immune system is through proper nutrition and essential oils!
2231640987491114323; 0; False; 1580252358; ¡¡¡ NOTICIAS IMPORTANTES INFORMACIÓN !!! "El CORONAVIRUS". El nuevo virus de China (2019-nCoV), se detectó por primera vez en Diciembre del 2019, en un mercado de Wuhan. Es un tipo de Microorganismo diferente de cualquier otro "CORONAVIRUS" humano descubierto hasta ahora. Los "Coronavirus" son una gran familia de Virus Respiratorios que pueden causar enfermedades que van desde el resfriado común, hasta el síndrome respiratorio de Medio Oriente y el síndrome respiratorio agudo severo (SARS-coV). NOTICIAS, INFORMACIÓN, NOTICIAS, INFORMACIÓN. :information: #Información y #Contacto: :telephone:Tel: +34 916 64 52 67 :e-mail:E-mail::backhand_index_pointing_right_medium_skin_tone: info@aseseyfo.com :incoming_envelope:E-mail 24h: :backhand_index_pointing_right_medium_skin_tone: emergencias24h@aseseyfo.com :small_blue_diamond:Facebook::backhand_index_pointing_right_medium_skin_tone: @Aseseyfo :camera:Instagram::backhand_index_pointing_right_medium_skin_tone: @Aseseyfo_ :bird:Twitter::backhand_index_pointing_right_medium_skin_tone: @Aseseyfo2 :globe_showing_Europe-Africa:web::backhand_index_pointing_right_medium_skin_tone: http://www.aseseyfo.com/ #Noticias #Información #Coronavirus #GrupoAssefAseseyfo #Asesoría #ConsultoríaenSeguridad #Servicios #Eventos #FormaciónEspecializada #Defensapersonal #Autoprotección #PrevenciónViolenciadeGenero #Jornadas #Airsoft #Localización #Madrid #Chopera
2231640945908382676; 0; False; 1580252353; Sekarang banyak banget masalah kesehatan salah satu yang di serang di negeri Semoga bermanfaat yaaa dear:folded_hands: . #cina #wuhan #wuhanchina #wuhanvirus #viruscorona #corona #virus #caramencegahcorona #coronavirus #coronarender
2231640891483155497; 0; False; 1580252346; Its better to be safe, than Sorry :neutral_face: ⠀ ⠀ How to avoid #coronavirus :microbe::face_with_medical_mask:⠀ ⠀ :backhand_index_pointing_right_light_skin_tone:Boost your Immune System⠀ :white_heavy_check_mark:Get enough Sleep:sleeping_face:⠀ :white_heavy_check_mark:Eat Vit. C rich food:kiwi_fruit::tangerine:⠀ :white_heavy_check_mark:Take 24 Alkaline-C⠀ :white_heavy_check_mark:Clean your hands with Soap or 24Thirty Germproof Solution more often:raising_hands:⠀ ⠀ • • • • ⠀ ⠀ 24 ALKALINE-C⠀ The Non-Acidic Vitamin-C⠀⠀⠀⠀ Every capsules of 24Alkaline-C Contains 562.43mg of pure and natural Sodium Ascorbate.⠀⠀ ⠀ Iba pag alagang 24 Alkaline -C! Subukan mo!⠀ ⠀⠀⠀⠀ :heavy_check_mark:Safe even with an Empty Stomach.⠀⠀⠀ :heavy_check_mark:Superbrands Certified ⠀⠀⠀⠀ :heavy_check_mark:Halal⠀⠀⠀⠀ :heavy_check_mark:FDA Approved⠀⠀⠀⠀ :heavy_check_mark:Guaranteed Safe & Effective⠀⠀⠀⠀ ⠀⠀⠀⠀ #weimprovelives #24alkalinec #emcore #superbrand #vitaminc #instavitamin #superbrand #sodiumascorbate #natural #nonacidic #health #wellness #protected #coronavirus #ncov #24thirty #germproof
2231640736118711750; 0; False; 1580252328; :grinning_face_with_sweat: #mexicanmemes #hispanicmemes #mexicansbelike #hispanicsbelike #mexicantarugadas #mexicanproblems #hispanicproblems #beingmexican #beinghispanic #memesmexicanos #memeshispanos #memesmexico #mexicanmemeswey #truemexicans #truemexicansbelike #nomames #nomameswey #memesderisa #takuachememes #corridosybandas #narcocorridos #funnymexicanmemes #regionalmexicano #mexicanfacts #latinosbelike #latinoproblems #coronavirus #mexicomedy
2231640698401267148; 0; False; 1580252323; #Repost @infodenpasar (with @report.for.insta) ... Saat ini, dunia sedang mewaspadai penyebaran Novel Coronavirus (2019-nCoV) yg berasal dari Tiongkok. Virus baru ini penyebab penyakit saluran pernapasan. . Utk meningkatkan kewaspadaan kita, yuk ketahui gejala & langkah pencegahan agar tidak tertular virus nCoV. #coronavirus . Via @kemenkes_ri
2231640539262790021; 1; False; 1580252317; Get his ass - - - Follow me for more @baljeetvibin
2231640621554590978; 4; False; 1580252314; Who else is getting a little worried about the start of 2020? Too much bad stuff is happening, and it’s honestly starting to concern me. Edit: I just realized that I forgot to put (of) in my meme... oh well. Y’all know what I mean. :face_with_tears_of_joy: The best way to cope is to make a meme about it. Meme made by me: @galarian_rapidash Please ignore @ and # thank you :folded_hands: @pokemon @pokemon_jpn #pokemon #pokémon #pokemonmeme #pokemonmemes #pokemonmemesfunny #meme #memes #dank #dankmemes #pokemoncommunity #gamefreak #nintendo #pokemonsun #pokemonmoon #pokemonsunandmoon #pokemonsunmoon #pokemonultrasun #pokemonultramoon #pokemonultrasunmoon #pokemonusum #pokemonusummeme #alola #mimikyu #coronavirus #coronavirusmemes
2231640530729853651; 0; False; 1580252303; China's delivery is definitely faster! #virus #coronavirus
2231640501429656659; 3; False; 1580252300; :musical_notes:Me, just tryna dodge a coronavirus/ had to turn down yo hoes they came with hella mileage :musical_notes: :woman_running_medium-dark_skin_tone::face_with_medical_mask: don’t listen to me. :grinning_face_with_sweat:
2231640476683700044; 0; False; 1580252297; #coronavirus or #kobe got you down? Well laughter is the best medicine so come down to the @americancomedyco #tonight for the GREAT Gaslamp Open Mic This is the only mic where if you kill it you could be opening for nationally known headliners on the weekend!!! #showtime 8pm #freeshow $5 #HappyHour #allnight #raffle #tickets to #preform given 7 to 730 #sandiego #socal #sandiegoevents #sandiegoshows #thingtodoinsandiego #funny #standup #Comedy #live #liveart Reposted from @prozaknathan
2231640465417901496; 0; False; 1580252296; #Coronavirus : Tiga lagi kes positif, jumlah terkini tujuh di Malaysia #CoronavirusOutbreak #WuhanCoronavirus #novelcoronavirus #2019ncov #CoronavirusMalaysia #WuhanOutbreak #KLCeria #CMSWPKL
2231640461918035790; 0; False; 1580252295; Cuida de los tuyos ¡Haz tus pedidos aquí! :backhand_index_pointing_down::dna::petri_dish: #Lima #peru #coronavirus #prevencion #evita #cuidate #precaucion #sintomas
2231640396319142065; 4; False; 1580252287; #coronavirus
2231640178075027787; 0; False; 1580252261; Привет @kinderwond ,теперь мы братья :SOS_button::A_button_(blood_type):М:B_button_(blood_type)::O_button_(blood_type):#coronavirus
2231640115722113246; 0; False; 1580252260; China is testing HIV drugs as a treatment for symptoms of the new coronavirus as the global race for a cure continues. Pharmaceutical research and development company AbbieVie Inc revealed on Sunday that Chinese health authorities requested supplies of Aluvia as an ad hoc treatment for pneumonia caused by 2019-nCov. #HIV #research #medicine #coronavirus #pandemic
2231640138789580763; 32; False; 1580252257; :red_circle::red_circle:#SONDAKİKA : #coronavirus nedeni ile ölen sayısı 131 oldu! Tedavi edilen sayısı 74, hasta sayısı 5515, Hastalığı şüpheli olan sayısı 6973
2231639958401391110; 0; False; 1580252235; Lmao on god tho #memes #spicymemes #coronavirus #corona
2231639950231653119; 0; False; 1580252234; Vorbereitung auf mögliches Auftreten des Coronavirus im Kreis Siegen-Wittgenstein Siegen 28.01.2020 | Landrat: Detaillierte Ablaufpläne für Rettungsdienst und Krankenhäuser „Kreisgesundheitsamt, Rettungsdienst und Krankenhäuser in Siegen-Wittgenstein bereiten sich intensiv auf ein mögliches Auftreten des Coronavirus vor. Für diesen Fall bestehen bereits detaillierte Ablaufpläne“, sagt Landrat Andreas Müller: „Zentrale Anlaufstelle für Patienten mit einem Verdacht auf Infizierung mit dem neuen Grippevirus ist das Kreisklinikum in Weidenau. Mögliche Patienten werden dort aufgenommen und isoliert werden.“ Mehr Infos aktuell auf wirSiegen.de #corona #coronavirus #kreissiegenwittgenstein #kreissiegen #siegerland #virus #kreuztal #weidenau #wilnsdorf #pandemi #ausbruch #rettungsdienst #krankenhäuser #nrw #deutschland #ablaufpläne #vorsichtsmassnahmen #littfeld #sauerland #westerwald #china #infizierung #gesundheit #siegen #grippevirus
2231639933521806707; 1; False; 1580252232; The Corona Virus currently! #mapofthevirus #coronavirus in real time. #chinavirus
2231639903213516938; 0; False; 1580252229; #coronavirus #3 . follow @pr0grammy :upside-down_face: follow @pr0grammy :upside-down_face: follow @pr0grammy :upside-down_face: . . . Please ignore text & hashtags below (: . I only use #parentingmemes and #engineeringmemes on my insta page #pr0grammy to post #memerelateable stuff here. These are #chilememes and for everyone whos still reading also #funmemes dont get fooled #memeslayer by this text which i wrote between the #funnypage because this is all #funnyedits for the mechanic of the page #memesfunny i found a new way to post #trumpmemes and #newfunnymemes to support #feminism and get some jokes about #funnymom out for you guys. All this stuff is #selfcreated because im a #memester and everything on this page is #funnyisfunny and I also post only #truethings if you are still reading this #believeit #voidmemes you really have to much time i guess #memessad you should really stop reading this #indianmemesdaily and for all #niggermemes thank you #gfmemes that you support my page #memestore got nothing left to say as a #memedealer with some #funnycomics but atleast i wasted #newmeme some time and hope you enjoy the content
2231639853938119373; 2; False; 1580252223; “ #geturknowledgeup “ :warning:WARNING GRAPHIC IMAGES:warning: Please share this URGENT post about the coronavirus epidemic with your followers as the origin of the virus has been traced to the zone of the Wuhan market where live wild animals like snakes, rats, bats and monkeys were traded before China instituted a temporary ban yesterday. But a temporary ban is NOT enough, WE MUST use our social media platforms to spread awareness and BAN WILD ANIMAL TRADING WORLDWIDE as this is EXACTLY what caused the SARS virus that killed nearly 800 people in 2003! SARS was 17 years ago and yet these markets are doing the exact same thing, selling live wild animals in unhygienic conditions that create diseases with devastating consequences for the entire human race! This new virus, which has no vaccine, has killed 82 people with 2,887 confirmed cases in 15 countries, numbers which have increased 50% SINCE YESTERDAY and 60 million more people are on lockdown to prevent further spreading. To stay updated in real-time our US followers can now text us at 323-310-1679 and also follow @karmagawa on Instagram too. Please pray for the world and share this URGENT post with your followers and tag people, celebrities, influencers and news media that need to see this and let’s work together to PERMANENTLY ban the trading of wild animals that create these deadly viruses! #coronavirus #endanimalcruelty #coronavirusoutbreak #karmagawa
2231639029530795494; 0; False; 1580252221; Taxi driver in China kicks out coughing passenger who just returned from #Wuhan amid #coronavirus #outbreak.
2231639741563333301; 0; False; 1580252209; In photos: Life at the virus-stricken 'ghost town' of China's Wuhan https://www.channelnewsasia.com/news/asia/in-photos-life-at-the-wuhan-pneumonia-virus-epicentre-12362386#.XjC7-8r88rM.twitter #CoronaOutbreak #coronavirus
2231639726119557277; 0; False; 1580252208; We have a good laugh, but seriously friend protect yourself!!! :rolling_on_the_floor_laughing: #coronavirus #protect #staysafe
2231639715594221541; 0; False; 1580252206; La Organización Mundial de Salud (OMS) calificó el coronavirus que ha dejado cerca de 80 muertes y más de 2.300 infectados en China, como una patógeno de alto riesgo mundial, tras publicarlo en nivel bajo “por error” en días pasados, reseñó este lunes el medio ruso RT. “Muy alta en China, alta a nivel regional y alta a nivel mundial”, refiere el boletín de la OMS, el cual resalta que el riesgo se mantiene como desde la última evaluación el pasado 22. #china #oms #coronavirus #salud #virus #sinesquemastv #albertoatallah
2231639695266650504; 0; False; 1580252204; #coronavirus #coronavirusmemes :sneezing_face:
2231639516993671945; 0; False; 1580252198; #CoronaVirus
2231639398605336362; 0; False; 1580252195; Когда живешь в Врн области #AmorousPWNZ #coronavirus
2231639623620484094; 0; False; 1580252195; #Epidemia Será coincidência? . . #coronavirus #virus #curiosidades #teoria
2231639610702617356; 1; False; 1580252194; :glowing_star:Si el universo supiese cuánto te amo, le daría vergüenza ser tan pequeño:glowing_star: • ● • ● • #panda #china #coronavirus #galaxy #galaxia #animal #peligrodeextincion #lamasguapa #space #espàcio #universo #universe #potato #patata #tequiero #amor #mio
2231639578731971889; 0; False; 1580252190; Det kan godt være at DR er blevet voldtaget af DF, og har mistet deres to bedste kanaler, men de har, i det mindste, IKKE Coronavirus #prayfordr #coolcorona #nicedevice #drtv #coronavirus
2231639205079839520; 0; False; 1580252186; #coronaviruses #coronavirus #virus #becareful #pandemia #diagnosis #usa:United_States: #usaroadtrip #please #becareful #usanews #alert #noticias #noticiaimportante #noticiasqueimportan #important #importantes#informaciones #information #informa #ultimanoticiavzla #noticias #noticiaimportante #noticiasenespañol #noticiasalud #alerta
2231639116211013777; 24; False; 1580252184; Skating in a mask sucks but we made the best out of it :red_envelope::China::skateboard:#spotsfordays #iloveskateboarding @loyd_lee
2231639528652035542; 0; False; 1580252184; #wtfisthis #umbrellacorporation #residentevil #coronavirus #howsoonisnow :skull::syringe::face_with_medical_mask:
2231638943706943648; 0; False; 1580252181; . 마스크가 부족해서 기저귀와 생리대를 임시로 사용하는 중국 우한 시민들. #Coronavirus #武汉
2231639477273348260; 0; False; 1580252178; :face_with_hand_over_mouth: #Corona #coronavirus #virus #respectforaffected
2231639455119231928; 0; False; 1580252175; Pandemia. China weakened and isolated from corona virus. . #china #coronavirus #panda #cage #animals #virus #corona #viral #editorial #editorialillustration #art #draw #illustration #newspaper #newyorkerartist #picame #graphicdesign #grapichgang #2020 #ink #photoshop #procreate #artist #illustrator #magazine #artdirection #work #design #creative #ideas
2231639441318314399; 1; False; 1580252174; #corona #coronavirus #china #islam #ummah #health #dua #prophetmuhammed
2231639272062741958; 1; False; 1580252153; Arizona and 4 other places in the U.S with cases of the virus ,y'all better get supplements stop making bad health decisions eat yo damn greens ,use home remedies ,make an escape plan but do not be in fear ,feel empowered in fact that you know what's going :raised_fist_medium-light_skin_tone: so take action tell your peeps to be careful ,stay inside eat from home don't get no new flu vaccine or any vaccine if you eat right you won't get sick . Remember don't fear it .Just prepare and be Aware . . #california #coronavirus #wuhanvirus #wuhanchina #china #kobe #freemason #kobebryanthelicoptercrash #illuminati #depopulation #sandiego #losangeles #ontariocalifornia #arizona #homeremedies #vegan
2231639238641008409; 0; False; 1580252149; #coronavirus jsjsjsjjs xd
2231639234541223930; 2; False; 1580252149; Que nosso bom Deus nos proteja. . . . . . #deus #deusnafrente #coronavirus #emoracao #deusnosproteja #protecao
2231639224247758239; 0; False; 1580252148; #gobiernodeanzoategui @barretosira @saludanzoficial Desliza :left_arrow: Hasta el momento en nuestro país y por tanto en nuestro estado #Anzoátegui No se ha detectado caso sospechoso de esta enfermedad, sin embargo, se mantiene la vigilancia epidemiológica activa en puertos y aeropuertos. . . De acuerdo con declaraciones ofrecidas por la Dra. Marisela Azocar, directora de Epidemiología de Saludanz, este virus se presenta como cualquier otro, no obstante, se considera sospechoso cuando el infectado es proveniente de China o ha estado en contacto con alguna persona que estuvo en el país asiático, lugar de origen del mismo. . . #coronavirus #prevencion #epidemiologia #SaludEnMovimiento #salvarvidas #anzoateguienmovimiento
2231639209433624445; 5; False; 1580252146; @foundconscious #racooncity #coronavirus
2231637264341391936; 0; False; 1580252143; ARRASTE 》》》》》》》 #Brasil #cricritheman #brasileiro #armas #afrodescendente #br #naoaopactodemigracao #naoaerotizacaoinfantil #epidemia #naoaideologiadegenero #legitimadefesa #brasileiros #defesapessoal #epidemia #NaoVamosDesistirdoBrasil #nossabandeirajamaisseravermelha #cristãos #forapt #redessociais #midiassociais #forapsol #forapsdb #esperança #comunicação #informação #coronavirus #stephenking
2231639136846326484; 0; False; 1580252137; :eyes::face_with_monocle::thinking_face: ⠀⠀⠀⠀⠀⠀ ⠀⠀⠀ ⠀⠀⠀⠀⠀⠀ ⠀⠀⠀⠀⠀⠀ ⠀China confirma 25 nuevas muertes a causa del coronavirus. ⠀⠀⠀⠀⠀⠀ ⠀⠀⠀ ⠀⠀⠀⠀⠀⠀ ⠀⠀⠀ ⠀⠀⠀⠀⠀⠀ ⠀⠀⠀⠀⠀⠀ ⠀⠀⠀⠀⠀⠀ ⠀⠀⠀ ⠀⠀⠀⠀⠀⠀ ⠀⠀⠀⠀⠀⠀ ⠀⠀⠀ ••••••••••••••••••••••••••••••••••••••••••••••••••••••••••••••• ⠀ @doblemoralrd noticias #actualidad #internacional #republicadominicana #view #alerta #novedad #viral #rd #dominicannetflix #doblemoralrd #dominicana #jamaica #japon #jamaica #japon #franklinmirabal #licey #cuba #haiti #toros #faride #bonilla #ericfilia #delacruz #pelucho #brito #pujeazul #seriefinallidom2020 #coronavirus #china #cuba #jamaica #islacaiman #wuhan
2231639130102469082; 1; False; 1580252136; Según el diario El TROME en Perú ! Dígalo menor @venenewsperu Casos de #coronavirus chinos infectados son venezolanos true
2231639129790260115; 0; False; 1580252136; :clinking_beer_mugs: #corona #corona:beer_mug: #coronavirus #twitter #memes #memesdaily #instagram #lmfao:face_with_tears_of_joy::face_with_tears_of_joy::face_with_tears_of_joy::loudly_crying_face::loudly_crying_face::loudly_crying_face::skull::skull: #cheers
2231639110471613939; 0; False; 1580252134; Wanna learn new techniques to die fast #virus #coronavirus
2231639104381143322; 0; False; 1580252133; The China Plague . . . #meme#memes#dank#dankmeme#dankmemes#wholesome#wholesomememe#wholesomememes#edgy#edgymeme#edgymemes#coronavirus#coronavirusmeme#coronavirusmemes#plague#plaguememe
2231639080886424676; 0; False; 1580252131; ‏:red_heart::repeat_button:SIGUEME Y TE SIGO:repeat_button::red_heart: ‎#coronavirus ‎#ايمان_براك_العازمي ‎#يحدث_الآن ‎#SiguemeYTeSigo ‎#SigamonosLosBuenos2020 ‎#KobeRIP ‎#IFB ‎#كلهم_زبالات_ياعلي ‎#Mexico ‎#ULTIMAHORA ‎#Tsunami ‎#LaRosaDeGuadalupe ‎#televisa YA ES HORA DEL PROGRAMA AMIGOS:smiling_face_with_halo: https://t.co/XCm5icnqjH‎
2231639036418964237; 0; False; 1580252125; https://mobile.abc.net.au/news/business/ Let’s hope for the best! #coronavirus #vaccine #australian #lab
2231639012559799615; 0; False; 1580252122; China vows to slay 'devil' virus, as countries scramble to evacuate citizens https://www.channelnewsasia.com/news/asia/wuhan-virus-china-countries-evacuation-12363098#.XjC7qV2acDA.twitter #CoronaOutbreak #coronavirus
2231638867629650772; 0; False; 1580252105; I’ve been so sick the past 4 days and honestly #coronavirus
2231638803768767381; 0; False; 1580252098; Informação e precaução! #instrumentacao #informacao #coronavirus
2231638803590767795; 0; False; 1580252098; #coronavirus
2231638808315526155; 0; False; 1580252098; Look de 2020 #epidemia #pandemia #virus #coronavirus
2231638671596773567; 1; False; 1580252082; Maldita sea . #Meme #Momazos #Spiderman #Momazo #Humor #Coronavirus #Venon #Virus
2231638663444478659; 3; False; 1580252081; #Repost @fabricatedbeer • • • • • • Dallol, Ethiopia I keep seeing these clickbait articles about how heating up alcohol to 54 degrees Celsius kills the Coronavirus. That’s why we created “Corona Virus Cure” the one true cure for this deadly illness. Heat this Mexican lager up a little bit and watch it cure the world, the corona way. The best part is because of who distributes @corona , you already know this beer is coming off the truck with blazing hot temperatures. Thanks @manhattanbeer , you guys are truly one of a kind. Anyways, drink this beer. #corona #coronavirus #coronavirusmemes #corona:beer_mug: #craftbeer #craftbeerporn #craftbeerlife #craftbeerlover #craftbeernerd #craftbeersnob #craftbeerlove #beer #beerstagram #beertography #beerlover #beerporn #beergeek #beerme #parody #ethiopia #mexicanlager #:beer_mug: #canrelease #lager #lagerbeer
2231638573535657625; 0; False; 1580252070; :China:Не все баррикадируются у себя в квартирах, районах и населенных пунктах. У многих людей в провинции Хубэй сдают нервы и они пытаются покинуть зону карантина. #коронавирус #coronavirus #хубэй
2231628460168779063; 0; False; 1580252068; Billy Bishop :River cover will be out tonight! :slightly_smiling_face::grinning_face::grinning_face::musical_notes::musical_notes::musical_notes::heart_with_ribbon::heart_with_ribbon: #sick #muscian #muscially #toronto #belleville #ottawa #coronavirus #musicismylife #billybishop #river
2231638466329174354; 2; False; 1580252057; Como faz para voltar para 2019? #coronavirus #china #fudeo
2231638399394429346; 0; False; 1580252049; Dronkss #virus #coronavirus
2231638341806548542; 0; False; 1580252042; Paracetamol y mucha awa kabros . . . #memesgraciosos #memesenespañol #memesdaily #coronavirus
2231638329737679030; 0; False; 1580252041; Desarrollo del #coronavirus en España.
2231638325448825046; 0; False; 1580252041; Wuhan virus: Singapore confirms 2 more new cases, bringing total number infected to 7 https://www.channelnewsasia.com/news/singapore/wuhan-virus-singapore-latest-confirmed-cases-coronavirus-12360924#.XjC7WYqTjEo.twitter #CoronaOutbreak #coronavirus
2231636915124468755; 0; False; 1580252037; #coronaviruses #coronavirus #virus #becareful #pandemia #diagnosis #usa:United_States: #usaroadtrip #please #becareful #usanews #alert #noticias #noticiaimportante #noticiasqueimportan #important #importantes#informaciones #information #informa #ultimanoticiavzla #noticias #noticiaimportante #noticiasenespañol #noticiasalud #alerta
2231638154379959056; 0; False; 1580252023; Dr. Kate Land (@kpkiddoc , Permanente Pediatrician at Kaiser Permanente Vacaville, shares "What we Know So Far" about the #CoronaVirus on the "Thriving Families Blog" and shares tips to prevent getting sick. Read more: http://ow.ly/P0Rh50y7ujY
2231635279555658422; 0; False; 1580252021; #Bacon#pork#porkchops#Meat eaters #Karma is delicious#coronavirus#is on your way #Keep eating animals #Karma is coming :face_savoring_food:#meat is definitely delicious #Keep :microbe:eating animals :microbe:Finally they going to kill you :face_savoring_food::microbe::microbe::microbe::microbe::microbe::woman_shrugging_medium-light_skin_tone::microbe::raised_fist_medium_skin_tone::OK_hand_medium_skin_tone::microbe::microbe::microbe::microbe:#fuckyoufilings#:skull::skull::skull::skull::skull::middle_finger_medium_skin_tone::middle_finger_medium_skin_tone::middle_finger_medium_skin_tone::middle_finger_medium_skin_tone::middle_finger_medium_skin_tone:#meatismurder :skull::middle_finger_medium_skin_tone::middle_finger_medium_skin_tone::microbe::microbe::microbe::microbe::microbe::microbe:
2231608098988766345; 0; False; 1580252018; Still wondering how they brought in #Coronavirus??? This is what I call #livingdangerously .
2231637913544598575; 5; False; 1580252014; Can’t wait to come to your city:smiling_face_with_horns::drooling_face:
2231636771888929977; 6; False; 1580252012; Petite gauchneck de sumatra :mushroom::palm_tree::microbe::ox: :camera_with_flash: @julienchaillou #coronavirus #mangerduriz @theujungbocurbungalows @mikasurfshop
2231638064479630045; 0; False; 1580252009; Honest to god? I’m scared of tourist season this year, considering the little town I live in get literal bus load of them coming through :fearful_face::anxious_face_with_sweat: . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . #memes #dankmemes #funny #lmao #stolenmeme #jokes #relatable #memepage #lol #dailymemes #meme #offensivememe #edgymeme #humor #oof #cursedmemes #coronavirus #elonmusk
2231637147899411872; 3; False; 1580252005; #ÚLTIMO Miles de personas desesperadas intentan ingresar a Hong Kong luego que se dio a conocer la orden de cerrar la frontera el 30 de enero a quienes provengan de China continental por brote de #coronavirus de Wuhan.
2231636116736666194; 0; False; 1580252002; Spreading quicker than the Australian bushfires :mouse_face: - - - - - - - - - - - - - - #meme #memes #memes:face_with_tears_of_joy: #memesdaily #dailymemes #dankmemes #lmao #lmao:face_with_tears_of_joy::face_with_tears_of_joy::face_with_tears_of_joy: #lmao:face_with_tears_of_joy::face_with_tears_of_joy::face_with_tears_of_joy: #lmaomemes #lmaooo #coronavirus #coronavirusoutbreak #lol #funny #funnymemes #funnyvideos #funnyvideo
2231634795767632964; 0; False; 1580251995; Kurze Information. #coronavirus
2231637931311863173; 0; False; 1580251994; Grafik: :copyright: stefanbuddesiegel Unternehmensgruppe 1992 - 2020 #arbeitssicherheit #arbeitsschutz #betriebsanweisung #betriebsanweisungen #betriebsanweisungnichtgelesen #china #corona #coronavirus #coronavírus #coronavirusoutbreak #pandemie - #berlin #herne #stefanbuddesiegel #stbuddesiegel @stbuddesiegel #buddesiegel @buddesiegel #design #medien #sicherheit #architektur #stadtplanung #webdesign #webdesigner #brandschutz #brandschutzbeauftragter #sigeko
2231637823944303258; 0; False; 1580251981; :double_exclamation_mark:Important announcement:double_exclamation_mark:Those who come back from China in the last two weeks and who have developed flu-like :microbe: symptoms, they need to call ahead to their GP :stethoscope: or emergency department and notify us of their travel :luggage: history and get tested. *Do not come into the clinic unless you have called us and spoke to a nurse :woman_health_worker: #medicalonmary #betterhealthstartshere #gympiedoctors #coronavirus
2231637825219209450; 4; False; 1580251981; Saludos! . Hoy les traigo este post con información sobre el NUEVO CORONAVIRUS . FUENTE: ORGANIZACIÓN MUNDIAL DE LA SALUD #Coronavirus . #CoronavirusDeWuhan . #NuevoCoronavirus . #LavadoDeManos
2231637783504339225; 0; False; 1580251976; ウイルス当番はクレベリンと同じ効果ですよ:hugging_face:昨夜19時の日本人感染発見以降、日本人の方がたくさんマスク:face_with_medical_mask:消毒薬を買いに来られています:pensive_face:対策は充分に気を付けてくださいね:person_bowing: #ウイルス当番 #クレベリンと同じ効果 #クレベリン品切れ #興和 #クレベリン #新型コロナウイルス対策 #ウイルス対策グッズ #新型肺炎対策 #新型コロナウイルス #スエヒロ薬店 #スエヒロ #徳庵駅すぐ #大阪シティバス徳庵駅口 #比枝神社すぐ #今津小学校すぐ #大阪市鶴見区ドラッグストア #鶴見区今津北 #今津北 #薬店 #coronavirus #coronavirusmeasures #paypay使えます #alipay #auペイ使えます #d払い使えます
2231637069926902249; 0; False; 1580251957; #memes #filthyfrank #cursedimage #corona:beer_mug: #coronavirus
2231637592208864393; 4; False; 1580251953; bELLY ARGGHHHHHhaha lol just kiddinng #shrekvibes #shrek #bosnianfood #justplaying #messinaround #chillness #chilloutman #tiktokcringe #tiktokfun #follow #getinmybelly #boobalicious #smellyfeet #gross #ozzyosbourne #parkinsons #dealingwithanxiety #coronavirus #modelovirus
2231637482100160024; 0; False; 1580251940; Traveling tips for those who must travel during this time. Because most coronaviruses are spread through airborne droplets (sneezing or coughing), touching or touching an infected surface, hand washing is an effective way of reducing the potential for infection. :airplane: . :keycap_1: Avoid contact with sick people (reported symptoms include a fever, chills, headaches, difficulty breathing, and a sore throat) :keycap_2: Wash hands often with soap and water for at least 20 seconds. . :keycap_3: Carry alcohol-based hand sanitizer (the CDC recommends at least 60% alcohol) in case water isn't nearby. :keycap_4: Avoid touching your eyes, nose and mouth with unwashed hands. :keycap_5: Wipe down the arm rests and tray table with sanitary wipes and bring tissues to open the bathroom door. . :keycap_6: Avoid travel when sick. #coronavirus #safetravel #diabetesbag #diabetes #travelingwithdiabetes #type1diabetes #t1dlookslikeme #type2diabetes #t1d #t2d #sale #travel #travelbag #insulated #medicalbag #medicalcase #travelcase
2231637478895579891; 0; False; 1580251940; Wuhan virus death toll jumps to 106, more than 4,000 cases confirmed in China https://www.channelnewsasia.com/news/asia/wuhan-virus-death-toll-china-cases-coronavirus-12360208#.XjC68nxcSIw.twitter #CoronaOutbreak #coronavirus
2231637389674397806; 0; False; 1580251929; Introverts be like :smirking_face::smirking_face::smirking_face: #virus #coronavirus
2231637371378795373; 0; False; 1580251927; Seems coincidental does it not? #coronavirus #2ndamendment
2231636755505038899; 8; False; 1580251853; 연휴 잘 지내셨나요:orange_heart: 새해 복 많이 받으세요 ! . 아~요니요니네 연휴동안 완벽하게 먹고 놀고 잠자는 먹놀잠 패턴 구현했구요 ! 다음주 제주 여행은 완죠니 캔슬(!ㅠㅠ) 아요니 엄마는 마스크 사쟤기 :-) 신종 코로나 바이러스 때문에 외계인 침공, 생물학 테러, 바이러스 전쟁, 지구 인구 줄이기, 경제 음모론 등등.... 영화에서 참 많이 보던 내용이 현실화된 것 같은 기분에, 아윤맘 완전 공포에 떨고 있어요 ... (이과충 ㅇㅈ ㅠㅠㅠ) :woman_facepalming_light_skin_tone: 넘 무서운 걸 우째요 .. 모두 건강 관리 열 심 히 잘하구 혹시라도 무슨 일 터지면 우리 꼭 살아남고 혹시라도 이별하게 되면 광화문 광장에서 매년 1월 1일 12시부터 4시 사이에 만나기로 해요 ! 매년 꼭 그 장소에 그 시간에 나타나기에요 !!! 하 울 엄마는 공포심 좀 줄어들고 진정하면 답방 돌게요.. 작은 소음에도 가슴 두근거려하는 쫄보 엄마에요 .. 새해에도 울 엄마 잘 부탁드려요 헤헿... #kkyulkkyul
2231636383000508613; 2; False; 1580251809; The state of our gut helps determine how we feel, physically and mentally. What’s going on in your intestines is an essential component to your health. If you feel like your immune system is not up to par, instead of focusing solely on supplementing with immune boosting herbs and oils, take a good look at the state of your gut & provide your body with good gut support. - Somethings I like to do to support my gut are: eating prebiotic foods, increasing fiber intake, staying away from raw or undercooked meat/fish & lowering stress! - If you suggest you may have some issues with gut health, let’s talk about digging in and finding the root cause.
2231635703515046969; 1; False; 1580251728; MIX DE ÓLEOS ESSENCIAIS ON GUARD: é uma mistura protetora composta por óleos essenciais de Laranja, Cravo, Casca de Canela, Eucalyptus Radiata e Alecrim (Rosemary). Indicada para momentos sazonais, de mudança de temperatura, quando vírus e bactérias se proliferam pelo ar. On Guard ajuda nosso sistema imunológico a se precaver nessas situações, fortalecendo nossa imunidade, limpando e purificando o ar que nos rodeia. :sneezing_face: pode ser diluído em um suco, usado em cápsulas, diluído em seu álcool gel, em seu sabonete líquido. :face_with_medical_mask: deve ser diluído todas as noites em seu difusor para limpar o ambiente. :face_with_thermometer: cuide de sua saúde. Consulte um aromaterapeuta de confiança.
2231635148743368983; 0; False; 1580251662; Fique por dentro! ⠀ 10 fatos sobre o coronavírus, segundo Ministério da Agricultura, Pecuária e Abastecimento (NT2/2020)⠀ ⠀ 1. Denominação do vírus: 2019novel-Coronavirus;⠀ 2. Detectado pela primeira vez na China em dezembro de 2019;⠀ 3. Coronavirus pode causar infecções em animais. Está em estudo qual espécie é fonte e possível reservatório;⠀ 4. Não se sabe se o 2019nCov pode impactar saúde animal e não há relatos de qualquer caso até o momento;⠀ 5. Animais doentes não devem ser abatidos para consumo e deve-se utilizar proteção para manipular seus fluidos e carcaça;⠀ 6. Carcaças devem ser enterradas ou destruídas;⠀ 7. Antes e após contato com animais vivos, mortos ou produtos de origem animal, lavar bem as mãos, não levando-as ao nariz ou boca;⠀ 8. Evitar consumo de produtos não inspecionados, crus ou mal cozidos;⠀ 9. Funcionários de matadouros ou qualquer outro que possa entrar em contato com animais abatidos e produtos de origem animal, devem portar roupas e equipamento de proteção e realizar boas práticas de higiene pessoal;⠀ 10. Médicos veterinários devem manter alto nível de vigilância e comunicar qualquer suspeita ao Serviço Veterinário Oficial (IN50/2013 MAPA)⠀ ⠀ Por: @lu.giacometti ⠀ :heart_suit:use a #mulheresdoagroms⠀⠀ :woman_farmer:marque o @mulheresdoagroms ⠀⠀ ⠀ #mulheresdoagroms #mulheres #matogrossodosul #brasil #agribusiness #safra #safrinha #farm #fazenda #agronomist #agronomiaporamor #agronomo #agronoma #agrolife #agronegocios #agrorotina #mulher #coronavirus #china #mapa
2231630213648215123; 2; False; 1580251123; BirdsRevelation #Phonk #phonkmusic #phonkrap #666 #flacflava #808 #flstudio #memphisrap #lofi #trill #trap #jdm #underground #style #devilish #trio #studio #drift #worldwide #sample #beat #making #fire #Hiphop #producer #underground #soundcloud #musica #coronavirus
2231624573812550967; 0; False; 1580250464; :high_voltage:В Германии выявлены еще три случая заражения коронавирусом. Подписывайтесь на наш instagram и узнавайте новости первыми! Новости без Цензуры 18+ в нашем Telegram канале (ссылка в шапке профиля)
2231624304141976538; 35; False; 1580250369; alexa skip 2 friday:white_heart::white_heart::white_heart::white_heart::white_heart::white_heart::heavy_heart_exclamation::peace_symbol::two_hearts::cowboy_hat_face::alien::woman_fairy::woman_fairy::woman_fairy::woman_fairy::woman_fairy::woman_fairy::woman_fairy::couple_with_heart_woman_woman::couple_with_heart_woman_woman::dog_face::dog_face::dog_face:
2231593302908852065; 1; False; 1580247175; Snippet from our Stock Market Strategy Session Live Webinar with the squad in preparation for the week of January 26 2020. Review the market with our macro top down approach. Preview upcoming stock market impacting events. Use that data to form biases in the markets for potential trades to make money in the stock market this week. Free Copy of "INTRO TO OPTIONS TRADING" https://wallstreetjackboyz.com/introt... Enroll in our online stock options trading premium course at www.wallstreetjackboyz.com New Merch https://teespring.com/wsjb-TakeProfit... Send all questions to info@wallstreetjackboyz.com Facebook: https://www.facebook.com/WallstreetJa... Instagram: https://www.instagram.com/wallstreetj... Twitter: https://twitter.com/WallstJackboyz Pinterest: https://www.pinterest.com/wallstreetj... *U.S. Government Required Disclaimer – Commodity Futures Trading Commission. Futures and options trading have large potential rewards, but also large potential risk. You must be aware of the risks and be willing to accept them in order to invest in the futures and options markets. Don’t trade with money you can’t afford to lose. This document is neither a solicitation nor an offer to Buy/Sell futures or options. No representation is being made that any account will or is likely to achieve profits or losses similar to those discussed on this website. The past performance of any trading system or methodology is not necessarily indicative of future results. If you decide to invest real money, all trading decisions should be your own.
2231579801730993948; 0; False; 1580245069; :speaking_head: . . . . . . #coronavirus #virus #memesespañol #memes #tiktok #china #instagram
2231431413076669819; 2; False; 1580227375; aw man! better to be safe than sorry :face_with_medical_mask::man_gesturing_NO_light_skin_tone: #coronavirus #ncov
2231427195243200638; 0; False; 1580226872; #코로나바이러스잡는청정기 #앳모스피어스카이 #atmospheresky #암웨이공기청정기 가장 많은 시간 머무는 집에서라도 청정지역에서 숨쉴 수 있다는게 #너무안심 바이러스까지 걸러주는 유일한 청정기 쓰고있어서 #너무다행 #진짜잘샀다 #쓰면쓸수록 #뽕빼는가전 #강추강추 . 인친여러분~ 빨리사서 하루라도 빨리 쓰는게 뽕빼는거에요!! 10개월무이자할부 기간이 얼마 안남았습니다!! 중국에서는품절사태!! 전세계품절나기전에주문해주세요!! 구입은 꼭 저같은 사업자를 통해서 정식루트로 하셔야 합니다~ 다른인터넷루트로는 5년보증 받을 수 없어요:loudly_crying_face: 가짜필터일 가능성도 있다하구요:face_screaming_in_fear: #제품문의 #dm주세요:hugging_face: #우한폐렴 #우한폐렴예방 #우한폐렴예방청정기 #코로나바이러스 #coronavirus
2231636460343459023; 0; False; 1580251913; -Fiscal general revela conspiración en contra del MP. -Implementan medidas de prevención para evitar el #coronavirus en Islas de la Bahia. -Capturan a pareja de supuesto extorsionadores en La Ceiba. -Fallecimiento de una mujer embarazada y un menor de edad, nuevas víctimas por dengue en la zona norte. #Noticias #Canal6 #Honduras
2231637196922967992; 1; False; 1580251906; CAMALEOA NEWS INFORMA! #coronavirus #virus #gripe #china #china:China: #febre #remarcar #ticket #passagem #passagemaerea #viajar #viajando #trip #travel
2231637146096053058; 0; False; 1580251900; #meme #dankmemes #funnymemes #coronavirus #whitepeople
2231634780794374549; 1; False; 1580251899; • #DiasporaDigest: Here’s all you need to know about the virus that’s taking the world by storm. __ BEIJING — A top U.S. health official said Tuesday that he offered to send a team from the U.S. Centers for Disease Control and Prevention to China to help with the coronavirus outbreak. Health and Human Services Secretary Alex Azar did not describe the Chinese health minister’s response but said he hopes that Beijing will accept the offer. The World Health Organization said Tuesday that China had agreed to allow global health experts into the country. Chinese leader Xi Jinping said Tuesday that his country is being “open, transparent, responsible” in its handling of the coronavirus outbreak, as the number of cases continues to increase. Here’s what we know: ● The death toll has risen to 106 in China, with more than 4,565 cases of infection. Other countries in the region also are reporting more people infected — nearly all of them tourists from China. // :movie_camera:: @cnn :pen:: @washingtonpost _ #CNN #WHO #Virus #China #Health #CoronaVirus __ #PR #Africa #Black #Media #Style #Smile #Beauty #Rocnation #Grammys #NewYork #Diaspora #Publicist #FatimaPR #Like4Like #Burnaboy #Becoming #Like4Likes #LikeForLikes #SierraLeone #FatimaSesay #YoungOprah #BlackExcellence #FollowForFollowback
2231637105184831716; 0; False; 1580251895; #coronavirus#antivirus :face_blowing_a_kiss::face_blowing_a_kiss:
2231636974036032376; 0; False; 1580251879; Os dejamos un enlace de Laboratorios Normon con información respecto al Coronavirus para que estéis informados. La información que os facilitamos está contrastada y es la misma que facilita el Ministerio de Sanidad a fecha de hoy : https://www.normon.es/articulo-blog/infeccion-por-coronavirus-2019-ncov-todo-lo-que-debes-saber. #sanidad #informacion #salud #prevencion #virus #coronavirus
2231636887129371832; 0; False; 1580251874; #depremelazığ #coronavirus
2231636901408754069; 0; False; 1580251871; Malaysia negara nombor 3 paling bersedia dalam menangani ancaman wabak di Asia selepas Thailand dan Korea Selatan - Global Health Security (GHS) Index #CoronavirusOutbreak #WuhanCoronavirus #novelcoronavirus #2019ncov #coronavirus #WuhanOutbreak #KLCeria #CMSWPKL
2231636816413733637; 0; False; 1580251861; Like to stay safe and share with your loved once:face_screaming_in_fear: :/ :( #memes#bestmemes#bestmemesever#bestmemesdaily#top#memesonly#coronavirusmemes #ripcobe#bdg#funny#lol#coronavirus#bestburgerintown#justforfun#whynot#virus#daily#sendit#justdoit#love#hustle#bro#notprivate#me#rejected
2231636714911546599; 3; False; 1580251849; #coronavirus with #lyme #Lousday
2231636681358857545; 5; False; 1580251845; CORONAVIRUS Conoce rapidamente de que trata está enfermedad y lo más importante ok a prevención. Acá te traigo un breve resumen de Coronavirus, con fuente de medilineplus.gob #pediatra #pediatraonline #pediatravenezolano #medicovenezolano #coronavirus #virus
2231633382906766736; 1; False; 1580251843; This year just keeps on getting worse and worse and it’s just the 4th week. Week after week it’s getting worse this world is only gonna get worse and worse unless if it don’t change but I guess that’s what we where put on earth for just to watch it die from the side because everyone says they hoping it changes but it’s the people who have to change :black_heart::broken_heart: - - - #2020 #ww3 #australia #australiawildfires #coronavirus #ripkobe #kobe #heart #heartbroken
2231636589008498635; 0; False; 1580251834; Protect yourself out there. #coronavirus
2231636006335920830; 0; False; 1580251812; ¡'Wuhan jiāyóu'! ¡Wuhan, sigue adelante! Así exclamaban sus habitantes durante la noche. La ciudad permanece en cuarentena por ser el epicentro del coronarvirus, epidemia que ha dejado 106 muertos y unos 4.500 infectados en China. #28Ene . . . . . . . . . . . . . . #noticias #coronavirus #china #virus #latierra #wuhan #venezuelalibre:Venezuela: #jguaido #oscarpérez #venezuelalibreysoberana #venezuelalamejor #venezuelasindictadura #venezolanosenusa #venezolanosarrechos #venezolanosenlima:yellow_heart::blue_heart::red_heart: #venezolanosenmiami #venezolanosenpanama #oscarperezsomostodos #caracas #venezolanosenmadrid #sancristobal #sisepuede #venezolanosenespaña #barinas #maracay #maracaibo #maduroconoetumadre
2231636251583662875; 4; False; 1580251793; #coronavirus #corona
2231636172774268019; 0; False; 1580251784; What do you think :thinking_face:? #becareful #coronavirus #wearamaskplease and clean your hands more often than normally
2231636140487059020; 0; False; 1580251780; What do you think :thinking_face:? #becareful #coronavirus #wearamaskplease and clean your hands more often than normally
2231485923561230662; 6; False; 1580251763; Moving around like while fire :fire: around the world , start with a cleanse and detox from @veganchoicefoods link in the bio family ___ Also to learn everything Dr. Sebi visit www.veganchoicefoods.com ___ #coronavirus #china #memes #rpm #preppertalk #bronchitis #bacterialvaginosis #aids #dallas #repost #urbansurvival #beready #preppernation #virus #doomsdaypreppers #candidiasis #pandemic #preparedness #virologia #paragrafando #studygram #med #biomedicas #brucellosis #chikungunya #chickenpox #flu #drsebirecipes #hepatitise #drsebi
2231635286114541450; 0; False; 1580251763; DPRD Riau Koordinasi Pemulangan Warga Riau di Wuhan China #viruscorona #coronavirus #dprd #wargariau #infopku_ #beritapekanbaru #beritariauhariini #beritariauterkini #inforiau #inforiau_
2231635991653895227; 0; False; 1580251762; :astonished_face::face_with_tears_of_joy::face_with_tears_of_joy::rolling_on_the_floor_laughing::rolling_on_the_floor_laughing::rolling_on_the_floor_laughing: . . . . . . . . . . . #corona #coronavirus #funnymemesdaily #funnymemes #stolenmemes #memesthatkeepmealive #memesthatkeepmefromendingitall
2231635979146785479; 1; False; 1580251761; In comes little frat boy Josh, thinking it has something to do with actual Coronas. #ub #coronavirus #buffalo #universityatbuffalo #dankmemes #spongebobmemes #dank #wny
2231635950895039332; 10; False; 1580251757; Skull & Bones :skull_and_crossbones: @eldinhesselgrave X @kodachiphotos / @skullandbones_nyc :sunglasses: . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . #KodachiStyle #usa #newyork #man #uomo #modeltest #malemodel #fit #athlete #medellin #fashionphotography #hunk #madrid #coronavirus #bogota #men #fitness #top #expofitness2020 #hung #army #undies #bodygoals #fitguy #wild #animalprint #moda
2231635946684473238; 0; False; 1580251757; #memes #funnymemes #dankmemes #coronavirus
2231635934888180781; 0; False; 1580251756; #brotheroneness #prayers to “End #coronavirus #crisis in #china #usa #canada (in all 17 #countries) “May #1 #God :star_and_crescent::wheel_of_dharma::menorah::star_of_David::latin_cross::om: #restore #health to #one :index_pointing_up:& #all” #onenessofallmessagepromoter #inspiration #sssbaba #love #hatenone #spiritualbillionaire #1world #oneness :grinning_face::two_hearts::index_pointing_up::globe_showing_Americas::peace_symbol:#sdg16 1/28/2020
2231635922131104947; 0; False; 1580251754; Me while exams thinking about to learn useless stuff while a virus is spreading #yoda#babyyoda#coronavirus#virus#prüfungsphase#lernen#mood#sad
2231635881664364496; 0; False; 1580251752; China confirma 25 nuevas muertes a causa del coronavirus. #noticias #China #coronavirus #luto #epidemia #ultimominuto #ultimomomento #loultimo #news #urgente
2231635862821972914; 14; False; 1580251747; The #coronavirus has hit SoCal. I’m not leaving my house. Not eating any Chinese food, and stayin away from everyone. PASS THIS ON, REPOST IT, AND SAVES LIVES.
2231635838386880286; 0; False; 1580251744; 우한 폐렴의 여파가 한인 여행사나 식당 등 한인업소들에게 타격을 줄까 걱정입니다. 더 많은 흥미진진한 뉴스들을 원하시면 아래 주소로 www.koreatimes.net . #canada #toronto #ontario #wuhan #coronavirus #토론토일상 #토론토맘 #토론토정보 #밴쿠버 #밴쿠버일상 #밴쿠버맘 #밴쿠버정보 #koreatimes #캐나다한국일보 #카드뉴스 #우한 #폐렴 #코로나바이러스
2231635812131309488; 0; False; 1580251741; 2020, лесные пожары, умирающие коалы, коронавирус, сбитые сомолеты и приближающиеся метеор #oni #onidsgn #art #mem #virus #coronavirus #animals #design
2231635057441191669; 0; False; 1580251724; The coronavirus is amount us:skull::microbe: #meme #memes #memesdaily #corona #coronavirus #virus #coronavirusmemes
2231635672082724675; 0; False; 1580251724; #coronavirus#메르스 랑 #사스 만 기억났는데 #신종플루 뭐임? 사망자#ㅎㄷㄷ 치사율도 1프로 밖에 안되는데 ㅠㅠ #신종코로나바이러스 벌써 사스때 감염자 절반이 넘어갔어 #어떡해 ㅠㅠ #에드먼튼 도 우한#lockdown 전후로 들어온 #중국인 모니터링 중이래요. 심지어는 뭐하고 돌아다니는지 사람들이 스토킹한다고 들었음#얼마나무서우면#스토킹#범죄 를 저지를정도 #ㅎㄷㄷㄷ 그래도 #스토킹 은 안했으면#캐나다
2231635621540310377; 0; False; 1580251718; :flushed_face: #virus #coronavirus
2231635603748044079; 7; False; 1580251716; :rolling_on_the_floor_laughing::grinning_squinting_face::man_facepalming_medium_skin_tone: Right now mi nuh care.. mi done with all Chinese restaurants till further notice. Lol #coronavirus #jamaica #bruhh #prayforchina #epidemic
2231635550389774931; 0; False; 1580251710; #gobiernodeanzoategui @barretosira @saludanzoficial Desliza :left_arrow: Hasta el momento en nuestro país y por tanto en nuestro estado #Anzoátegui No se ha detectado caso sospechoso de esta enfermedad, sin embargo, se mantiene la vigilancia epidemiológica activa en puertos y aeropuertos. . . De acuerdo con declaraciones ofrecidas por la Dra. Marisela Azocar, directora de Epidemiología de Saludanz, este virus se presenta como cualquier otro, no obstante, se considera sospechoso cuando el infectado es proveniente de China o ha estado en contacto con alguna persona que estuvo en el país asiático, lugar de origen del mismo. . . #coronavirus #prevencion #epidemiologia #SaludEnMovimiento #salvarvidas #anzoateguienmovimiento
2231635443737627890; 0; False; 1580251697; Can we make sure this gets around? #coronavirus
2231635381149600126; 2; False; 1580251690; Innalillahi.... Ngeri kek di film2 horor. . . . Burung Gagak berterbangan di atas langit Jinghzou, Hubei tempat asal #CoronaVirus . . . #farosback
2231635372088085632; 0; False; 1580251688; :microbe: Você já deve ter ouvido falar do Coronavírus, né? Saiba o que é, como se prevenir e quais os sintomas. Para mais informações, acesse o site do Instituto de Infectologia Emílio Ribas: www.emilioribas.sp.gov.br . . . . . . . #coronavirus #virus #emilioribas #institutoemilioribas #infectologia #saude #news #informacao #alerta #viruscorona #corona
2231634438947915221; 0; False; 1580251687; The fact that its all in january #ripkobebryant #ripkobe #australia #ww3 #coronavirus #2020 #newyear
2231635339433654596; 10; False; 1580251685; :folded_hands::folded_hands::folded_hands: #coronavirus . . Reposted from @minhacapital 18:30 ATUALIZANDO: Ao todo são 3 casos considerados suspeitos pelo Ministério da Saúde nos estados de Minas Gerais, Rio Grande do Sul e Paraná (os pacientes estão nas capitais dos estados: Belo Horizonte, Porto Alegre e Curitiba) . 10:30 AM >> Ministério da Saúde confirma caso suspeito de coronavírus em Minas Gerais. Paciente é uma estudante de 22 anos que esteve em Wuhan (cidade chinesa onde surgiu a epidemia) nos últimos dias . A paciente é uma estudante de 22 anos que chegou em território brasileiro no dia 24 de janeiro. Conforme o ministro, todas as 14 pessoas que tiveram contato com a estudante estão sendo monitoradas. . Com a suspeita confirmada, o Ministério da Saúde elevou a classificação de risco do Brasil para o nível 2, que significa "perigo iminente". Até segunda-feira (27), o país estava em nível 1 de alerta. . ÚLTIMAS ATUALIZAÇÕES: Alemanha confirma três novos casos, depois de França confirmar o quarto caso. . :police_car_light: ALERTA>> Na Alemanha :Germany: e no Japão :Japan: surgiram os primeiros casos de coronavírus em pessoas que não estiveram na China. . O especialista japonês, professor Mitsuo Kaku da Universidade de Medicina e Farmácia de Tohoku afirmou que será difícil controlar infecções e prevenir a disseminação do novo coronavírus . Ele insiste que as pessoas não encarem o vírus de forma branda, pois trata-se de uma nova linhagem que nunca antes havia infectado seres humanos. . #pandemia #oms #saude #virus #alerta #noticias #noticia #notícia #notícias #news #MinhaCapital #Brasília #Brasilia #BSB #MinasGerais #Coronavirus
2231635330482354755; 0; False; 1580251684; Mouth Face Mask Men & Women! Keep CoronaVirus Away:speaking_head:! For Only 14.99$ Link In Bio. #wish2smile #health&personalcare #coronavirus
2231635323695571495; 3; False; 1580251683; These hoes man:neutral_face::pleading_face: - Follow @stol3n.exe for daily post:alien::moai: - - - - #meme #memes #bestmemes #edgy #funny #funnymemes #doge#offensivememes #edgymemes #memepage #funniestmemes #WW3memes #memesdaily #jokes #stonermemes #Coronavirus #offensive #lmao #rickandmorty #lol #offencivememes #stoner #Goodpage #fuccXO #skating#funnyposts #sillymemes #dankmeme #dankmemes
2231635311105126116; 0; False; 1580251681; Eine übersicht über die ausbreitung des #coronavirus Stand 28.01.2020 Bestätigte Fälle; 4690 Bestätigte Todesopfer; 106 #wuhan #virus #deutschland #gesundheit
2231635215566485160; 0; False; 1580251670; 우환 폐렴의 여파로 온라인상에 중국인 혐오가 급속도로 번지고 있다고 합니다. 병을 미워해야지 사람을 미워하면 안되겠죠. 신속하고 알찬 뉴스들을 원하시면 아래 주소로 www.koreatimes.net . #canada #toronto #ontario #korean #wuhan #coronavirus #토론토 #토론토일상 #토론토맘 #토론토정보 #밴쿠버 #밴쿠버일상 #밴쿠버맘 #밴쿠버정보 #koreatimes #캐나다한국일보 #카드뉴스 #우한 #폐렴 #코로나바이러스
2231635212589556942; 0; False; 1580251669; tag the veteran plague Inc :face_with_tears_of_joy: #coronavirus #corona #infected #gamers #death #veteran
2231635051643386856; 0; False; 1580251650; Be careful guys :hundred_points: #Repost @sicklecell101 ・・・ Coronavirus is a respiratory infection that can cause severe lung disease, including pneumonia.⁠ ⁠ Here are the best ways, according to the World Health Organization, to reduce your risk of #coronavirus infection.⁠ ⁠ Please also be mindful of travel and make sure you are up-to-date on all vaccinations!⁠ ⁠ #sicklecell101 #sicklecell
2231635027267733949; 0; False; 1580251647; :face_with_raised_eyebrow::woozy_face: - - - Follow @coronavirus.meme #virusmeme #corona #virus #viruscorona #coronavirusoutbreak #coronavirus #coronameme #coronamemes #coronavirusmemes #memes #china #ww3 #ww3memes #fun #dankmemes
2231635006053239513; 0; False; 1580251645; Davant l'alarma generada pel coronavirus, us deixem informació sobre el virus i les recomanacions per evitar el contagi #coronavirus #prevencio #farmaconsells #farmaciacortiella #falset
2231635009423732393; 0; False; 1580251645; Ya valió vrga • • • • • • • • #coronavirusmemes #coronavirus #2020memes #yavaliomadre #china
2231634920724164004; 1; False; 1580251635; El panda gordo al que más quiero del mundo ●÷● • ● • ● • #panda #china #coronavirus #galaxy #galaxia #animal #peligrodeextincion #lamasguapa #space #espàcio #universo #universe #potato #patata #tequiero #amor #mio
2231634871710021101; 0; False; 1580251629; Recuerda que en Ecuador no hay casos confirmados de #Coronavirus. Conoce varios tips que tenemos preparados para que tu estadía sea segura y placentera en el país de los cuatro mundos. ¡El Gobierno Nacional trabaja por tu salud y la de los ciudadanos y la de todos los
2231634602359241764; 14; False; 1580251629; 2020 so far...Send this to your friends. :disappointed_face:Follow @coronavirusplague for more :skull: - - - - - - - Z - - Tags- #memes #dank #bruhmoment #wwz #dankmemes #ww3 #coronavirus #lmao #lol #meme #corona #yolo #china #disease #plagues #rofl #dead #explore #bruh #clown #clownmemes #w #haha #lmfao #memed #original #relatablememes #virus #plague #plaguememe
2231634777001670933; 1; False; 1580251626; None
2231634808349772016; 0; False; 1580251621; . . . .. . . #edgy #memes #dankmemes #edgymemes #meme #dank #funny #funnymemes #offensivememes #dankmeme #lol #memesdaily #lmao #anime #offensive #coronavirus #cringe #comedy #china #humor #follow #spicymemes #dailymemes #edgymeme #like #shitpost #tiktok #oof #triggered #kobebryant
2231634795724357762; 0; False; 1580251620; Novo coronavírus: três casos suspeitos são monitorados pelo Ministério da Saúde no Brasil O Ministério da Saúde informa que foi notificado, até às 17h desta terça-feira (28), de outros dois casos suspeitos do novo coronavírus no Brasil. Assim, no total, três casos suspeitos da doença são monitorados pelas autoridades de saúde brasileiras. Eles estão localizados em Porto Alegre (RS) e Curitiba (PR), além de Belo Horizonte (MG), noticiado na manhã desta terça-feira (28). Os pacientes se enquadraram na atual definição de caso suspeito para nCoV-2019 (o novo coronavírus), estabelecida pela Organização Mundial da Saúde (OMS), ou seja, apresentaram febre e, pelo menos um sinal ou sintoma respiratório, e viajaram para área de transmissão local nos últimos 14 dias. A OMS aumentou o nível de alerta para alto em relação ao risco global do novo coronavírus, por isso, o Ministério da Saúde orienta que viagens para a China devem ser realizadas em casos de extrema necessidade. Com quase três mil casos confirmados, segundo o boletim da OMS de 27 de janeiro, todo o território chinês passa a ser considerado área de transmissão ativa da doença. #china #coronavirus #saúde
2231634782614007751; 0; False; 1580251618; #coronavirus #coronovirusoutbreak
2231632230203895676; 0; False; 1580251617; ⁣⁣:hugging_face: Quando eu falo que estar ativo e treinando se alimentar bem diariamente, e captar vitamina D para a saúde e bem-estar..⠀⠀ ⠀⠀ E aqui se reforçou o conceito:⠀⠀ ⠀⠀ Quem tem IMUNIDADE ALTA tem menos preocupação neste surtos.⠀⠀ ⠀⠀ #Repost @doutorrondo⠀⠀ ・・・⠀⠀ Muitos estão pedindo minha opinião sobre prevenção ao Coronavírus e melhores formas de tratamento.⠀⠀ ⠀⠀⠀ Gravei um vídeo rápido explicando alguns pontos e mostrando como pode ser simples aumentar sua imunidade para se proteger do Coronavírus e também de muitos outros.⠀⠀ ⠀⠀⠀ Vamos ajudar as pessoas divulgando este vídeo :grinning_face:⠀ ⠀ #dsx #ctx #virus #coronavirus #saude #prevencao #bemestar #corrida #saudavel #imunidade #academia #edfisica #saudavel⠀
2231632098393230888; 5; False; 1580251612; I’m shining a light on the #coronavirus that is causing such a stir online. Please share so we can help ease the hearts and minds of mothers everywhere- this is NOT that big of a deal. #coronavirus #coronavirusoutbreak #coronavirusmemes #coronaviruses #coronaviruschina #healthanswers #epidemics #pandemic #coronavirus2020
2231634721820217874; 1; False; 1580251611; Today I announced further measures around novel #coronavirus including additional public health officials at airports and an information line to keep Canadians informed: 1-833-784-4397. Stay up-to-date at Canada.ca/coronavirus. / J’ai confirmé aujourd’hui que davantage de professionnels de la santé publique seront présents aux aéroports et qu’une ligne dédiée est disponible pour répondre aux questions sur le #coronavirus : 1-833-784-4397. Le site Canada.ca/coronavirus est aussi disponible.
2231634713851149805; 0; False; 1580251610; Drink up alkiss water 4L bottle to make yourself the ultimate N9500 super mask! Fight coronavirus!!!!!! #coronavirus #facemask #n95mask #yvr #vancouver #bc #canada #alkisswater #4l #emptybottle #fight #confirmedcase
2231634122664955013; 0; False; 1580251601; *GRAPHIC* Patient seen having heavy seizures caused by the coronavirus. Stay safe everyone. N95 Respirator Masks in bio. #coronavirus #wuhan #china #wuhanvirus #coronavirusleaks #wuhannews #coronavirusnews #virusleaks #coronaleaks #wuhanleaks #wuhanvirusleaks #fear #scary #seizures #chinanews
2231634574601806123; 27; False; 1580251593; Indonesia memang hebat gaes... . . #corona #coronavirus #OposisiIdeologis
2231634358519995580; 0; False; 1580251586; Inicia desarrollo de vacuna contra CoronaVirus │ @eltoquedelmediodia #canalamerica #optimum1014 #newyork #republicadominicana:Dominican_Republic: #deportes #leonesdelescogido #mundo #tendencia #top #five #noticias #news #vacuna #coronavirus #buenasnoticias www.canalamerica.tv
2231634488510100938; 0; False; 1580251583; Bout time for that incubation period to end, expect cases to start popping up in the UK. Don't worry, its like a slight cold . . . #wuhanchan #coronachan #coronavirus #wuhan #wuhancoronavirus #novelcoronavirus #wuhanchina #pol #4chan #ebolachan #nurgle #goodluck #China #winnietheflu #wuhanquarantine #wuhanflu #shtf #MAGA #anime #waifu #corona #makeanimegreatagain #batsoup #harborne #unitedkingdom
2231633284224397669; 0; False; 1580251582; People are collapsing from #coronavirus :exclamation_mark::microbe: • • • #virus #malware #windows #coronavirus #hiv #cybersecurity #bacteria #china #microbiology #hospital #science #wuhan #pediatr #cerrahginekoloq #program #ginekoloq #psixoloq #canli #sunimayalanma #ortoped #ginekoloqcerrah #qadinxestelikleri #erroziya #azerbaijan #urek #baku #travmatolo #xestexana #coronavirusoutbreak
2231634038972746138; 6; False; 1580251569; Meu Deus! De emocionar, mesmo no sofrimento, o patriotismo soa como um alento.. nesta hora esquecemos até que o comunismo impera por lá..:folded_hands::rose: . . Reposted from @minhacapital EMOCIONANTE: Vídeos mostram moradores de Wuhan (epicentro do surto do Coronavirus :microbe:) na varanda de seus apartamentos gritando pelas janelas e cantando canções patrióticas e o hino da China para se animarem. Os vídeos estão se propagando nas redes sociais. . Wuhan, com 11 milhões de habitantes está em quarentena. A cidade está isolada pelo Governo chinês desde quinta-feira (23). Ruas e aeroportos vazios, mas hospitais continuam lotados. . #pandemia #Wuhan #oms #saude #virus #alerta #noticias #noticia #notícia #notícias #news #MinhaCapital #Brasília #Brasilia #BSB #MinasGerais #Coronavirus Vídeo: reprodução
2231634303691577694; 4; False; 1580251561; Tus ojos son la galaxia en la que quiero sumergirme. • ● • ● • #panda #china #coronavirus #galaxy #galaxia #animal #peligrodeextincion #lamasguapa #space #espàcio #universo #universe #potato #patata #tequiero #amor #mio
2231634274758846655; 0; False; 1580251558; 현재 저는 중국 상해에 거주 중입니다. 코로나로 인해 지난주 저희 공동체는 문을 닫고 각 가정에서 모임을 가졌습니다. 앞으로 2주 더 그렇게 진행이 됩니다. 중국 땅의 많은 공동체들이 그런 상황입니다. 이 땅에 살아가는 한 사람으로 이 땅을 위해 기도하지 않을 수 없게 됩니다. 함께 우한과 중국땅, 교민들을 위해 기도해주세요. 2020.01.29일 (01:53기준) 확진 4633명 , 의심환자 6972명, 완치 73명, 사망 106명 입니다. 첫째, 중국 당국의 방역이 성공적으로 진행되어서 질병이 더 이상 확산되지 않고 2-3주 내에 소멸되게 하옵소서. 더불어 각 나라들의 방역이 잘 이루어져 질병으로 인한 공포가 더이상 확산되지 않도록 하여 주시옵소서. 둘째, 질병으로 고통받고 있는 이들을 긍휼히 여기시고, 속히 백신이 개발되어 환자들이 치료받을 수 있도록 하옵소서. 셋째, 병의 발생지인 우한시를 포함한 호북성에 갇혀 있는 이들에게 필요한 도움이 이뤄지게 하옵소서. 넷째, 중국 땅, 중국 민족을 긍휼히 여기시고 자비를 내려주셔서 치유와 구원의 은혜를 허락하여 주옵소서. 다섯째, 상해를 포함한 교민들이 안전하도록 인도하여 주옵소서. 특히, 우한에 고립되어 있는 교민들이 안전하게 전세기로 귀국할 수 있도록 인도하여 주옵소서. 여섯째, 흩어져있는 공동체들이 한 마음으로 기도할 때 역사하여 주시고 예배의 소중함을 깨닫게 하여 주시고 주님의 인도를 더욱 사모하고 바라게 하여 주옵소서. 일곱째, 불기둥과 구름기둥으로 공동체원 한사람 한사람을 보호해 주시고 깨어 두 손을 펴 중국 땅을 위해 중보하며 기도하는 공동체가 되게 하옵소서. #우한 #武汉#wuhan #신종코로나 #coronavirus #중국땅을위해 #손모아주세요
2231634272450968633; 0; False; 1580251557; "Oh shit, here we go again" #virus #coronavirus
2231634237832658283; 0; False; 1580251553; @coronavirusworldwide An elderly Chinese tourist in a "serious condition" in a Paris hospital is France's fourth confirmed case of the new coronavirus that has killed more than 100 people since it emerged in the Chinese city of Wuhan, France's top health official said Tuesday. . . Corona virus :microbe: #coronavirus #virus #germs #sanitation #health #california #worldwide #instagram #keepclean #2020#usa #kids #adults #china cdc#hawaii france24#illinois #texas #canada #virus
2231634207616387518; 0; False; 1580251550; #budlight #laugh #coronavirus
2231629390777612259; 0; False; 1580251547; A joint press conference was held today hosted by the Chinese American Medical Society (CAMS) and the Charles B. Wang Community Health Center (CBWCHC) where representatives from leading community health organizations and hospitals, along with physicians and local public health officials, shared the latest developments with the novel coronavirus. Dr. Perry Pong, Chief Medical Officer of the CBWCHC stated, “We have not seen anybody that meets the case definition of traveling to Wuhan and having respiratory illness.” Dr. Oxiris Barbot, the Health Commissioner for NYC Department of Health and Mental Hygiene shared that there are no confirmed cases in New York City. If you are unwell, see your doctor who can help you. #Coronavirus #Wuhan #ProtectYourself #2019nConV #2020nConV #CenterforDiseaseControl #CDC #NYCHealthy #NYCHealth #NYCDepartmentOfHealth #WeAreCBWCHC #QualityHealthCare @camsocietyorg @nychealthy
2231632988725163259; 0; False; 1580251539; 2020 is great so far T A G S #lmao #lmfao #dank #dankmemes #memes #memesdaily #dailymemes #lmfaomemes #bruh #corona #coronavirus #virus #2020 #january #january2020 #kms #kys #oh #ok #gn #gm #um
2231634077400046329; 2; False; 1580251534; #donaldtrump #donald #trump #presidenttrump #usa #uspresident #presidentdonaldtrump #fakenews #whitehouse #fake #makeamericagreatagain #donald #virus #impeachment #inquiry #america #cnn #corona #quidproquo #2020 #twitter #presidential #republicans #tweet #country #coronavirus #beer #impeachtrump #lime #whistleblower #undercontrol
2231634052721835625; 0; False; 1580251531; :warning: Información importante: Esto es lo que sabemos del #CoronaVirus de Wuhan, China. Si no has estado al tanto de lo ocurrido, estos son los datos más recientes | Somos #GlobalMexicoFresco #Mexico #Salud #Virus #Queretaro
2231633938980130027; 0; False; 1580251518; Gobiernos de Francia, España y Reino Unido repatrían a Pasajeros esperan en el aeropuerto francés de Charles de Gaulle en medio de la alerta global por la propagación del #coronavirus en una imagen del 26 de enero de 2020. Pasajeros esperan en el aeropuerto francés de Charles de Gaulle, Los evacuados llegarán a sus países de origen a mediados de esta semana y deberán pasar 14 días en cuarentena para evitar la propagación de la llamada 'neumonía de Wuhan'. Hasta ahora, Francia es el único país europeo que ha reguistrado casos de contagio en su territorio. El número de infectados supera los 2.700 y se ya registraron 81 muertes en el país asiático. A todo el que llega de china hay que aislarlos 21 días y luego de deja salir, esto es una isla un virus es difícil de entrar y de salir. Hay que estar chivo.
2231633874312568762; 0; False; 1580251515; With my construction focused posts for January, I am on a mission to find the fastest, simplest, cheapest, and most attainable systems, which can kick global construction shortages in the butt. With this being my focus, a story caught my attention in the media. While the fast 3D printing of buildings may one day become a reality, it is difficult to beat human response time during a catastrophe. I am fascinated with the results when people are forced to get creative in record time. I touched this topic in my Forbes article a few weeks ago; link in Bio. The article highlights a collapsed Minnesota bridge being rebuilt in record time, resulting in new business models. For this project value networks literally had to be created right on the spot in order to fix the situation. . . China is currently busy building a 1,000-bed hospital in response to the Wuhan coronavirus...in 5 days. Yes, you read it right. 5 days! At times like these, you gotta love the Chinese. . . People who know me, know how impatient I am in long meetings, contract details, regulatory nitty-gritty. While all of this is important, there is a moment where 80% perfection is good enough. When the common goal is crystal clear, the rest will get figured out on the job. . . I have a question for my construction experts here. How much of this Wuhan construction work is figured out as they go, how much is done according to particular building codes, union rules, environmental paperwork, etc? . . .. .. #jannekyttanen #3d #3dguy #3dprinting #3dconstruction #coronavirus #wuhanchina #hospital #china #civilengineering #construction #emergency #engineeringmarvel #fastconstruction #engineeringdesign #rapidconstruction #engineering
2231633864522975343; 0; False; 1580251509; #coronavirus
2231633850681693283; 0; False; 1580251507; #earthquake #msm #news #breaking #coronavirus #outbreak #china #caribbean
2231633826201830655; 0; False; 1580251504; Youpin in crash per l'elevata richiesta di mascherine chirurgiche Fa sempre un certo dispiacere raccontare di certe notizie, ma purtroppo il problema è di portata mondiale e quindi è giusto raccontare anche le piccole inerzie. Stiamo purtroppo parlando dell’ultimo coronavirus (2019-nCoV) che in questi ultimi giorni ha devastato la Cina, nella salute e nell’economia e che ad oggi rappresenta una minaccia per tutti noi, […] :information:Tutte le info sul nostro sito xiaomi.today #Coronavirus #Xiaomi #Youpin #mifans #xiaomiitalia
2231633796549554996; 0; False; 1580251501; Follow: @this_memes69 #worldwar3 #ww3 #ww3memes #iran #iranmemes #iranmeme #meme #dankmemesdaily #dankmemes #blackhumor #memes:face_with_tears_of_joy: #schwarzerhumor #memez #memepage #like4likes #followforfollowback #followforfollow #f4f #coronavirus #china #chinavirus #killerbug
2231633678270193641; 0; False; 1580251487; #coronavirus #corona
2231633632385543210; 35; False; 1580251481; No, no he venido de #asia... Pero no se siente nada chévere. #meagarró #unvirulito #histeriacolectiva #coronavirus #tapao #porsiacaso
2231633577497160737; 1; False; 1580251475; Goodbye old friend, you have helped me create so many memories while traveling, backpacking, & training! Visiting #pele in #Hawaii :airplane: a #ladyboy in #Thailand :airplane: overnighting #thegreatwall in #China miles long elevation gain during a trail run to visit “the old man” in :airplane:#Scotland :airplane: humping the #hochiminhtrail in #Vietnam plus all the crazy times here at home in the #UnitedStates Mad props to @alpineshop for the ability to purchase my upgrade and support a great local business. #shoplocal #shopsmall #coronavirus #upgrade #garminvivoactive #garminfenix6 #backpacking #trailrunning #memories #travel #training #fitforduty #overlanding #mountainbike
2231633425143302402; 0; False; 1580251456; En 40 días, esperan probar la vacuna contra el coronavirus. #Coronavirus
2231633411662367873; 0; False; 1580251455; Typical day in Europe #virus #coronavirus
2231633274836827652; 0; False; 1580251438; O Ministério da Saúde acaba de informar que investiga um caso suspeito do Novo #Coronavírus em Curitiba. NÃO HÁ MOTIVOS PARA PÂNICO. Importante lembrar que ainda é uma suspeita e que o caso ainda precisa ser confirmado laboratorialmente. O paciente se enquadrou na atual definição de caso suspeito para nCoV-2019 (o novo coronavírus), estabelecida pela Organização Mundial da Saúde (OMS), ou seja, apresentaram febre e, pelo menos um sinal ou sintoma respiratório, e viajaram para área de transmissão local nos últimos 14 dias. As autoridades de saúde estão acompanhando a situação e tomando todas as medidas para evitar possíveis transmissões. #coronavirus Veja mais informações em: https://michelecaputo.com.br/2020/01/28/curitiba-tem-caso-suspeito-de-novo-coronavirus/
2231630063812992309; 23; False; 1580251429; Creo que no tengo que aclarar que es comedia. Solo quería contarles cómo están las cosas en mi ciudad desde la noticia del #coronavirus Aunque para cuando terminé de grabar, ya habían puesto el uso de mascarilla obligatoriamente en toda la provincia :upside-down_face::upside-down_face: Gracias a mi nuevo amigo virtual @elyorchvzla por este vídeo y sus consejos, abierta siempre a sus comentarios y sugerencias, tenemos vídeo nuevo :zany_face::zany_face::zany_face: link en mi perfil • • • • #guangzhou #youtube #coronavirus
2231633192938242815; 0; False; 1580251429; Bateu a paranóia? @residentevil @residentevilbrasil @sonypictures @sonypicturesbr @screengemsproductions @psicogame_room @calabresadani @gamerbrasil_ #nerd #geek #residentevil #sonypictures #sony #games #coronavirus #memesbrasil #gamers #gamer #2020
2231633173998297259; 7; False; 1580251426; Whoomp! There it is! :rolling_on_the_floor_laughing: :rolling_on_the_floor_laughing: :rolling_on_the_floor_laughing:
2231633052472153493; 4; False; 1580251425; Elk Grove’s much anticipated Lunar New Year celebration was canceled due to concerns over the Coronavirus which has infected more than 4,000 people in China. · The city and its Diversity and Inclusion Commission said in a Facebook post on Monday, that the event was canceled “out of an abundance of caution” regarding the coronavirus. This was going to be the second year of the event, and the first time it was going to be held at District 56. · The Sacramento County Public Health office says the risk of Novel Coronavirus remains low in our area, but Elk Grove organizers said they are following the lead of similar events in Sacramento that were canceled. · Last year, more than 700 people attended the event at the Sacramento Asian Sports Foundation. But this year, news that the Coronavirus has infected thousands in China and killed 106, has leaders thinking twice. · · · #lunarfestival #coronavirus #publichealth #elkgrove #elkgroveca
2231632948529452295; 0; False; 1580251425; إعرف اكتر عن فيروس الكورونا واعراضه وطرق الوقاية من خلال التقرير التالي مع طالبتنا المتميزة من كلية الصيدلة في جامعة الشرق الاوسط "سارة حدادة". #MPharm #MEU #Strathclyde #coronavirus #Pharmacy #UKinJordan
2231633142095440217; 0; False; 1580251423; #prayforchina #coronavirus
2231633113272551970; 1; False; 1580251419; #repost :backhand_index_pointing_down::woman_health_worker::ambulance: :backhand_index_pointing_right: #coronavirus#enfermagem#enfermagemporamor#enfermagemavançada#tecenfermafem
2231633109094744557; 0; False; 1580251419; “RE: Virus Corona” :microbe: • • • #corona #coronavirusoutbreak #coronavirus #virus #outbreak #art #digitalillustration #painting #graphicdesign
2231633072923597148; 0; False; 1580251414; #gobiernodeanzoategui @barretosira @saludanzoficial • • • • • Desliza :left_arrow: Hasta el momento en nuestro país y por tanto en nuestro estado #Anzoátegui No se ha detectado caso sospechoso de esta enfermedad, sin embargo, se mantiene la vigilancia epidemiológica activa en puertos y aeropuertos. . . De acuerdo con declaraciones ofrecidas por la Dra. Marisela Azocar, directora de Epidemiología de Saludanz, este virus se presenta como cualquier otro, no obstante, se considera sospechoso cuando el infectado es proveniente de China o ha estado en contacto con alguna persona que estuvo en el país asiático, lugar de origen del mismo. . . #coronavirus #prevencion #epidemiologia #SaludEnMovimiento #salvarvidas #anzoateguienmovimiento
2231633058486275585; 3; False; 1580251413; A SOCIEDADE BRASILEIRA DE INFECTOLOGIA emitiu um informe sobre o novo CORONAVÍRUS com perguntas e respostas para profissionais de saúde e público em geral. Os coronavírus (CoV) compõem uma grande família de vírus, conhecidos desde meados da década de 1960. Trata-se de uma nova variante do CoV, denominada 2019-nCoV, até então não identificada em humanos. Investigações detalhadas descobriram que o SARS-CoV pode ser transmitido de animais para humanos. Alguns CoV podem ser transmitidos de pessoa a pessoa pelo ar (secreções aéreas do paciente infectado) ou por contato pessoal com secreções contaminadas. Na maior parte dos casos, a transmissão é limitada e se dá por contato próximo. Presume-se que o tempo de exposição ao vírus e o início dos sintomas seja de até duas semanas. Pode variar desde casos assintomáticos, infecções de vias aéreas superiores semelhante ao resfriado, até casos graves com pneumonia e insuficiência respiratória aguda, com dificuldade respiratória. Crianças de pouca idade, idosos e pacientes com baixa imunidade podem apresentar manifestações mais graves. No caso do 2019-nCov, ainda não há relato de infecção sintomática em crianças ou adolescentes. Quanto à gravidade, devemos acompanhar a evolução da epidemia. A estimativa é de que a letalidade seja em torno de 3%. O diagnóstico é confirmado com exames laboratoriais realizados por biologia molecular, que identificam o material genético do vírus em secreções respiratórias. Quanto ao tratamento, ainda não há um medicamento específico. Indica-se repouso e ingestão de líquidos, além de medidas para aliviar os sintomas, como analgésicos e antitérmicos. Nos casos de maior gravidade com pneumonia e insuficiência respiratória, suplemento de oxigênio e mesmo ventilação mecânica podem ser necessários. Os casos suspeitos apresentam febre acompanhada de sintomas respiratórios, além de atender a uma das duas seguintes situações: ter viajado nos últimos 14 dias antes do início dos sintomas para área de transmissão local (cidade de Wuhan) ou ter tido contato próximo com um caso suspeito ou confirmado. #FisioNeilaAndrade #coronavirus #Neurofuncional #TerapiaIntensiva #SSA
2231632831239615946; 0; False; 1580251405; Китай за неделю строит больницу для коронавируса На тысячу человек Для завершения проекта в срок мобилизовали 4 крупные строительные компании Когда наши научатся так строить? Без эпидемии никак? #coronavirus #china #армада#смотри#какнада
2231632980304771913; 0; False; 1580251403; Observasi Suspect Corona, RSHS Diagnosis Dua Pasien ISPA Rumah Sakit Hasan Sadikin Bandung belum bisa memastikan status dua pasien yang sedang mereka observasi terkait wabah Virus Corona. Namun, kondisi kedua pasien itu disebut membaik dengan diagnosis infeksi saluran pernapasan akut (ISPA). Diketahui, pada Minggu (26/1), RSHS Bandung merawat dua pasien yang dirujuk dari rumah sakit lain karena mengalami berbagai keluhan. Kedua pasien berada di ruang isolasi Ruangan Infeksi Khusus Kemuning (RIKK) RSHS Bandung untuk menjalani perawatan. Pasien pertama seorang laki-laki warga negara asing (WNA) asal China. Hasil observasi pasien ini mengalami infeksi pernapasan atas akut. Kemudian, pasien kedua merupakan warga Bandung yang sebelumnya pernah melakukan perjalanan ke Singapura. Hasil observasi dokter RSHS menyimpulkan pasien didiagnosis mengalami infeksi saluran pernapasan bawah akut. "Jadi tadi pagi kami sudah melakukan pertemuan klinis dan melihat pasiennya di RIKK. Kondisi terakhir pasien pertama dari China dalam kondisi baik. Jadi pagi ini sudah tidak ada keluhan baik demam maupun nyeri menelan juga sudah tidak ada," kata Ketua Tim Infeksi Khusus RSHS Bandung Yovita Hartantri di Bandung, Selasa (28/1). Selain itu, berdasarkan hasil pemeriksaan dokter tim, pasien asal Tiongkok itu tidak ditemukan keluhan lain. Hasil laboratorium pasien juga baik. "Mengenai hasil sampel pasien ini belum kami terima sampai tadi siang jam 11 dari Litbangkes. Begitu juga pasien yang kedua kami belum mendapatkan hasilnya," ujar dia. Yovita mengaku belum tahu teknis pemeriksaan sampel yang dilakukan Litbangkes Kementerian Kesehatan. Namun yang pasti pihaknya sudah mengirimkan spesimen dari hidung dan tenggorokan. "Di sana akan dicek dulu dan ada tahapan-tahapannya hingga dipastikan ini termasuk Novel Corona [Virus] atau tidak," ujarnya. Sementara, pasien kedua yang merupakan WNI juga dalam kondisi stabil meski masih dipasang alat bantu pernapasan. "Kondisi pasien sekarang sudah sadar, ada kontak, lalu dengan kondisi tekanan darah, pernapasan dan tidak ada demam(sumber Cnn) #coronavirus #viruscorona #viruscoronachina #coronavirusupdate #coronarovirus
2231632979256925239; 1; False; 1580251403; Esto no es broma señores... #coronavirus #latam #virus #nosfaltódecir #ayuda #sos #enfermedad
2231632420919023274; 2; False; 1580251399; İlaç almaya gelen Çinli adam ilaç bulamayınca maskeyi çıkartıp görevlilere öksürdü.buda demek oluyor ki virüs beyine zarar veriyor.(mal aq:face_with_tears_of_joy::face_blowing_a_kiss:) #koronavirüsü #koronavirus #çinvirüsü #sondakika #sondakika #önemli #china #news #breakingnews #breaking #haber #gündem #coronavirus#sondakika #önemli #haber #gündem #karantina #coronavirüsü #koronavirus #koronavirüsü #Wuhan kentindeki sağlık çalışmaları yetmiyor. Çin'de karantina altına alınan şehir sayısı yükseliyor. Daha fazlası için takip etmeyi unutmayın :red_heart: @saglikbakanligi Daha fazlası için takip etmeyi unutmayın :red_heart: #corona #coronavirus #türkiye #tsk #hastalik #istanbul:Turkey: #kolombiya #istanbul #saglikbakanligi #cin #çin #woman #coronavirus #abd #trump #salgın #virus #
2231632864777056893; 0; False; 1580251390; Test… 1, 2, 3 and here we go… :pirate_flag::face_screaming_in_fear::grinning_face_with_sweat: #eugenics #getfitorgetsick #getrightorgetleft #beawarriornotaworrier #fear #fearfactor #residentevil #racooncity #corona #coronavirus #virus #viral #depopulation #feartactics #maltesecross #crossofmalta #watchmen #doomsday #doomsdayclock #symbols #symbolism #unmatrix #unmatrixyourself #unmatrixyourselffirstthenothers
2231632828948743404; 1; False; 1580251385; Who needs one? #nCoV-2019 #coronavirus #notnecessary
2231632826162631765; 5; False; 1580251385; Siga : @umgusta . . . . . . . #eunavida #videosengracados #memesbr #memes #memesbrasil #copianaocomedia #memesengracados #zuera #engracados #zueirasemlimites #risos #likeforlikes #comedia #melhordohumor #southamericamemes #humorbrasil #risadas #humorbrasileiro #sdvtodos #memesbrasileiros #zueira #otariano #oemputecido #rindomuito #rindo #rindoalto #humorista #coronavirus #redegloboapoiaestupradores #alicesolteira
2231632785318584897; 0; False; 1580251380; coronavirus . . . #cafe #warm #colours #warmcolors #photography #exposure #composition #focus #capture #moment #photooftheday #studygram #fakeplant #fakefriend #coronavirus #chinaman
2231632781786559834; 0; False; 1580251380; :crown: Virus #coronavirus #lolhaunted #lol #leagueoflegends #xinzhao #torneolol #zed
2231631956785684059; 10; False; 1580251371; It’s a good thing i drink only Heineken :grinning_face_with_sweat: #coronavirus
2231509705448248250; 0; False; 1580251369; :woozy_face::zipper-mouth_face::zipper-mouth_face: - Follow @stol3n.exe for daily post:alien::moai: - - - - #meme #memes #bestmemes #edgy #funny #funnymemes #doge#offensivememes #edgymemes #memepage #funniestmemes #WW3memes #memesdaily #jokes #stonermemes #Coronavirus #offensive #lmao #rickandmorty #lol #offencivememes #stoner #Goodpage #fuccXO #skating#funnyposts #sillymemes #dankmeme #dankmemes
2231629744927677941; 3; False; 1580251366; YA SON 90 MIL CASOS CONFIRMADOS!! :face_screaming_in_fear: #dtodointeres #wuhan #pandemia #coronavirus #confidencial #chinos #china #virus #pulmonia #enfermedad #caracas #igtvchannel
2231632644055985338; 0; False; 1580251363; Desse jeito ahahhaha Créditos: @efrain_js.priv . . . . #memes:face_with_tears_of_joy: #coronavirus #atualidades #virus #memesbrasileiros #memesbrasil #zuerasemlimites #comecorda
2231632634174043075; 2; False; 1580251362; At least we have doomer memes...:grinning_face_with_sweat: #2020 #2020memes #dankmemes #billieeilish #goldenglobes #grammys #grammys2020 #grammy #arianagrande #selenagomez #memes #newmemes #dopememes
2231632179369305952; 0; False; 1580251359; People are collapsing from #coronavirus :exclamation_mark::microbe: • • • #virus #malware #windows #coronavirus #hiv #cybersecurity #bacteria #china #microbiology #hospital #science #wuhan #pediatr #cerrahginekoloq #program #ginekoloq #psixoloq #canli #sunimayalanma #ortoped #ginekoloqcerrah #qadinxestelikleri #erroziya #azerbaijan #urek #baku #travmatolo #xestexana #coronavirusoutbreak
2231632599250769237; 0; False; 1580251358; O Ministério da Saúde informa que foi notificado de outros dois casos suspeitos do novo coronavírus no Brasil. Assim, no total, três casos suspeitos da doença são monitorados pelas autoridades de saúde brasileiras. Eles estão localizados em Porto Alegre (RS) e Curitiba (PR), além de Belo Horizonte (MG), noticiado nesta manhã. Confira notícia completa no Portal Saúde. Acesse www.saude.gov.br #NovoCoronavírus #coronavirus
2231632540473466273; 0; False; 1580251351; #LMFAO That was fast... New Multi-Surface Cleaner Kills #Coronavirus & Sanitizes for 24 Hours — #fear #followthemoney
2231632508989114842; 1; False; 1580251347; #coronavirus
2231632480813759909; 0; False; 1580251344; Spread some #dankmemes #coronavirus #weneeda #coronavirus-chan
2231632470688550806; 0; False; 1580251343; Don't forget to wear your mask. #photography #coronavirus
2231632406004365935; 0; False; 1580251335; Unmöglich #coronavirus
2231632387884061320; 2; False; 1580251333; #coronavirus #sopademurcielago
2231632359942596373; 0; True; 1580251329; A nation who serves God will be kept from disease. China, if you repent from your many false gods and honor Adonai, only then will you be restored! Do not deny #God and do not persecute His people! #christians who share the #Holybible #china #hubei #hubeiprovince #coronavirus #coronavirusoutbreak #virusoutbreak #epidemic #pandemic
2231632348105670745; 0; False; 1580251328; #coronavirus #corona #virus #
2231632313587265411; 0; False; 1580251324; MTA Issues Update On Precautions Against Coronavirus #CDC #coronavirus #MTA The Metropolitan Transportation Authority (MTA) today announced that it is taking all appropriate precautions in response to the outbreak of a novel coronavirus in China. While there is no confirmed case in New York, the MTA stands ready to act in the best interest of our employees and our eight million daily customers across NYC Transit, Metro-North and Long Island Rail Road. The MTA is assessing contingency plans and materials used in the past to address health conditions should the Centers for Disease Control (CDC) recommend further action by transportation networks. The agency is also actively working with State and… Link: https://bronx.com/mta-issues-update-on-precautions-against-coronavirus/
2231632308644355352; 0; False; 1580251323; Voetbaltrainer Joop Gall ondervindt in China in steeds extremere mate de gevolgen van het snel om zich heen grijpende #coronavirus. De 56-jarige Muntendammer, die sinds begin december werkzaam is op een voetbalacademie in de miljoenenstad Zhengzhou, overweegt een tijdelijke terugkeer naar Nederland. Op DvhN.nl leidt hij je door de lege straten en vertelt hij over hoe hij alles beleeft.
2231632259664750005; 0; False; 1580251321; El presidente de la Asociación de Hoteles de Santo Domingo, Roberto Henríquez, revela que Salud Publica no lo ha llamado para tratar el tema del coronavirus #AsociacióndeHotelesdeSantoDomingo, #RobertoHenríquez #SaludPublica #coronavirus
2231632187873368184; 0; False; 1580251316; Excuse the poor editing :face_with_tears_of_joy::loudly_crying_face::loudly_crying_face: but I had to jump on the meme :skull: #corona #coronavirus #anime #oof #maisakurajima #sakutaazusagawa #bunnygirlsenpai #meme
2231632212871189394; 0; False; 1580251312; Lmao! Tag someone:fire: #retards #republicanmemes #republicans #rightwingism #republicanstrong #democrats #democratmemes #democratssuck #dankmemes #ww3memes #ww3 #ww3meme #ww3draft #babyyodamemes #babyyoda #babyyoda:green_heart: #coronavirus #caronavirusmemes
2231632188965949280; 0; False; 1580251309; O Corona vírus :microbe: já chegou no Brasil - MÁSCARA HOSPITALAR N95 - KSN #mascarahospitalar #produtoshospitalares #mascara #coronavirus #proteção #fratellisaude
2231631482526817515; 0; False; 1580251302; RSUD Arifin Achmad Siapkan 3 Ruangan Isolasi dan Tim Dokter #viruscorona #coronavirus #rsudarifinachmad #ruanganisolasi #timdokter #beritapekanbaru #infopku_ #beritariauhariini #beritariauterkini #inforiau
2231632045434982679; 0; False; 1580251292; En esta carta al editor se reportan el caso de un masculino infectado con el nuevo #coronavirus que obtuvo al estar en contacto con su padre (que había viajado previamente a #Wuhan). Por la evolución, es probable que este virus tenga un período de incubación de 3 días. NEJM: https://www.nejm.org/doi/full/10.1056/NEJMc2001272
2231631982622598459; 0; False; 1580251284; #coronavirus #liquidversion :copyright:opyright by @zkbarney
2231631831090676605; 1; False; 1580251266; 2020 Spring Festival haven't festival⋯ #coronavirus #kobe #2020 #doomsday
2231631822736301187; 0; False; 1580251265; @sebjitsu_3.0_ ##china villages barricading themselves in make shift checkpoints to stop the spread of #coronavirus #smh
2231630872885098157; 0; False; 1580251261; @sebjitsu_3.0_ ##china villages barricading themselves in make shift checkpoints to stop the spread of #coronavirus #smh
2231631741012200220; 17; False; 1580251256; 3 simultâneos Casos suspeitos de #coronavirus aqui no Brasil. Vamos ficar atentos :eyes: #biossegurança . G1 :backhand_index_pointing_down: O Ministério da Saúde anunciou na tarde desta terça-feira (28) dois novos casos suspeitos do coronavírus 2019-nCoV, um em São Leopoldo (RS) e outro em Curitiba (PR). Mais cedo, o governo havia noticiado a investigação de um caso em Belo Horizonte (MG). Inicialmente, o ministério disse que o possível caso no Rio Grande do Sul havia sido registrado em Porto Alegre, mas uma atualização mostra que ocorreu em São Leopoldo, região metropolitana. A notificação à pasta federal que foi feita pela Secretaria de Saúde da capital gaúcha. Fonte: G1
2231630840395488529; 0; False; 1580251245; Empty streets seen mid-day in China. Stay safe everyone. N95 Respirator Masks in bio. #coronavirus #wuhan #china #wuhanvirus #coronavirusleaks #wuhannews #coronavirusnews #virusleaks #coronaleaks #wuhanleaks #wuhanvirusleaks #scary
2231627304178509320; 4; False; 1580250727; :lemon:PREVENTIVE SUPPLEMENTATION:lemon: • The first step of building a rock solid Immune System is taking preventative measures! •⠀⠀ Antioxidant vitamins and minerals such as: • Vitamin C. • Zinc. • Vitamins E. • Elderberry. & • Glutathione. • Are a few example supplements that are known to have protective qualities against pathogens. •⠀⠀ And... •⠀⠀ Anti-Microbial foods such as: • Ginger. • Turmeric. & • Manuka honey. •⠀⠀ Which is exactly what this Golden Juice is made of! •⠀⠀ RECIPE In a juicer combine: • 1 full pineapple (chopped & including the core). • 4 peeled lemons. • 3 inch piece of ginger. • 3 inch piece of turmeric. & • 1-2 Tbsp of Manuka honey. (Be sure to chop or peel skins off of fruit). • This juice contains: • Antioxidants. • Antimicrobials. • Anti-inflammatories. & • Bromelain (an enzyme that helps break apart mucous). • You can drink this as a preventative measure or while you feel a cold coming on. This juice will store in your fridge for up to 3 days and is best to drink in the morning after a glass of distilled water :).⠀⠀ •⠀⠀ Remember to consistently be washing your hands and to keep your phalanges away from your mouth and eyes. • Stay tuned for more:sparkles:
2231625454396785530; 0; False; 1580250506; :face_with_thermometer: #humor #coronavirus #epidemia #residentevil #umbrella
2231621101992126999; 6; False; 1580250420; To all my patients asking my thoughts on the coronavirus this week, I couldn’t agree more with this journalist and he actually sums it up quite sensibly and helps put it into context
2231581039831006412; 11; False; 1580245212; Mmmhmm...:hot_beverage::hot_beverage::hot_beverage: #justsayin #cabrona #ponlevicks #sipstea #coronavirus
2231533238823142913; 0; False; 1580239513; Um esqueminha bom! #medicina #medstudents #medicine #prevencao #virus #china #mundo #world #onu #who #health #brasil #novocoronavirus #coronavirus
2231351758897260450; 0; False; 1580218127; Aku sedih liat orang-orang yang kena virus corona. Semoga Allah menyembuhkan nya Aamiin... #coronavirus
2231631634963191612; 0; False; 1580251243; “Fashion” #fashion #imnotnervous #coronavirus #coronavirusmemes #sars #birdflu #swineflu #captaintrips #thestand #superbug #superflu #pandemic #weareallgoingtodie #humansoflatecapitalism #fluseason #mask #medicalmask #outbreak
2231631597157544640; 0; False; 1580251238; This be true but my brother died from the #coronavirus :pensive_face: i be crippin doe:wheelchair_symbol::wheelchair_symbol::prohibited::billed_cap: . • • • #memes #memes:face_with_tears_of_joy: #memelord #memesdaily #memes #wholesomemes #wholesomememes #depressedmemes #offensivememes #dankmemes #deadmeme #memesthatkeepmealive #memegod #cancermemes #minecraftmemes #minecraft #fortnitememes #fortnite #gamingmemes #gaming #robloxmemes #edgymemes #memeteam #oof #shrek #shrekmemes
2231631567813642153; 0; False; 1580251235; O Ministério da Saúde confirmou mais dois casos suspeitos de coronavírus no Brasil. Com isso, já são três os possíveis registros de infecção pela nova doença em território nacional. Além do caso já divulgado de Belo Horizonte (MG), estão sendo investigadas suspeitas em Porto Alegre (RS) e em Curitiba (PR), de acordo com informe divulgado na noite desta terça-feira pelo Ministério da Saúde. De acordo com a pasta, os pacientes se enquadram na classificação por apresentarem sintomas, como febre, tosse e dificuldade de respirar e ter histórico de viagem à China nos últimos 14 dias. Os pacientes serão monitorados e ficarão isolados até que os resultados dos exames sejam divulgados, o que deve acontecer até o final da semana. O novo coronavírus já infectou mais 4,5 mil pessoas, das quais 106 morreram. Além da China, 14 países já confirmaram infecções pela doença. fonte - R7.com #coronavirus #brasil #noticias
2231631356235672902; 3; False; 1580251233; • • • • • • Wuhan, China EMOCIONANTE: Vídeos mostram moradores de Wuhan (epicentro do surto do Coronavirus :microbe:) na varanda de seus apartamentos gritando pelas janelas e cantando canções patrióticas e o hino da China para se animarem. Os vídeos estão se propagando nas redes sociais. . Wuhan, com 11 milhões de habitantes está em quarentena. A cidade está isolada pelo Governo chinês desde quinta-feira (23). Ruas e aeroportos vazios, mas hospitais continuam lotados. . #pandemia #Wuhan #oms #saude #virus #alerta #noticias #noticia #notícia #notícias #news #MinhaCapital #Brasília #Brasilia #BSB #MinasGerais #Coronavirus Vídeo: reprodução
2231631526609943106; 0; False; 1580251230; #Repost @fightdogmeat_dot_com with @get_repost ・・・ CHINA: Haven Dogs Running Out Of Food. The coronavirus epidemic is affecting the Haven Sanctuary. They can’t buy kibble and there’s no deliveries. They need to buy sacks of rice for 200+ dogs, while they can. Please help if you can: PAYPAL: Donate@FightDogMeat.com. Fight Dog Meat. Registered Charity. #fightdogmeat #dog #dogs #china #china:China: #coronavirus #coronavirusoutbreak
2231631498279961842; 0; False; 1580251227; Prá sua informação ... existem 3 casos suspeitos no Brasil... governo eleva o ALERTA DE CONTÁGIO ... iniciou na China e está contagiando a Europa !!! #coronavirus #sintomas #cuidados #alerta
2231631482811239757; 0; False; 1580251225; #Coronavirus, #Wuhan, #China 106 fallecidos y 4.515 casos confirmados. Ademas casos en Tailandia (14), Australia (6), Singapur (5), Taiwán (5), EEUU (5), Japón (4), Malasia (4), Corea del Sur (4), Francia (3), Vietnam (2) y 1 en Camboya, Canadá, Alemania, Costa de Marfil, Nepal y Sri Lanka.
2231631450473989455; 0; False; 1580251221; Stay safe #sesh kings and queens out there! @ketflixandpillsinc #coronavirus #beatthejanuaryblues
2231631432236135789; 0; False; 1580251219; Gimme that shirt! #virus #coronavirus
2231631359961497385; 0; False; 1580251210; Di MAIO FAI QUALCOSA!!! #dimaio #coronavirus #cina #italianmeme #italyminister
2231631342217751161; 0; True; 1580251208; #coronavirusbrasil #coronavírus #coronavirus @adrianorossi.premium
2231631317798391110; 0; False; 1580251205; #Digitalizados | Se suspende la Liga profesional de League of Legends en China. En plena emergencia de la enfermedad Coronavirus en China, Joe “Munchables” Fenny y el resto de los relatores en inglés de la LPL anunciaron que volverían a casa hasta que la situación de posible pandemia este un poco más bajo control. #Coronavirus #LPL #Casters #China #Emergencia
2231631294488902639; 0; False; 1580251202; Se juega #coronavirus #china
2231631210862822097; 0; False; 1580251192; As many of you know, Anina Net, is currently in China right now and the city is on lockdown. Some of our intern team decided to forgo their holiday time and keep working, as we are getting ready to launch our first kits. They are locked in their school complex and can not leave—not a fun holiday. Regardless of this Anina Net keeps diligently working and learning and preparing. It’s about mindset. Most of the stuff you are worrying about won't happen. I don't know if everyone does this but some of us tend to overthink about what is going to happen next: “Did I do the right thing, was there something I missed? Did I forget something? Was I wrong and more overthinking matters?” But did you notice? Most of the stuff that we always worry about to happen, most of the time doesn't happen? Sometimes overthinking and worrying is ok but not all the time. It is already 2020 and this year is going to be a great year! We have to claim this year to be our year. Let us not let negative things enter our minds as much as possible - not worry on things that might never happen. Trust and believe in yourself in everything you do. Mind sharing with me what you are often worrying about in the comments below? #creativelifehappylife #smallbiz #mycreativebiz #makeithappen #instantboss #sayyestosuccess #instabossmob #girlboss #getsocial #socialmedia #growth #exposure #socialmediatips #instatip #inspiration #motivation #success #brandlove #branding #agencylife #createalifeyoulove #staymotivated #thetimeisnow #powerfulwomen #professional #positive #confidence #coronavirus #coronavirusoutbreak #coronavirusmemes
2231631164499111963; 0; False; 1580251187; Informazioni utili! #farmacia #salute #regionecampania #coronavirus #virus #informazioniutili
2231631166234239848; 19; False; 1580251187; Theo overheard me cancelling the annual trip to China :China: making plans for Japan :Japan: instead. While I was on the phone I noticed he was busy at his desk working with scissors and tape. He’d fashioned himself a mask :face_with_medical_mask: like he saw in the newspaper this morning & began vacuuming around his desk to protect our home against viruses. “We’re going to clean this place up Japanese-style” he announced grandly. Now he’s going from room to room, corner to corner, humming “America the Beautiful” #coronavirus #japanesestyle #kidprojects #emergencypreparednessday #lucasarruda #buckley
2231631118359091341; 0; False; 1580251181; No encuentro fallas en su lógica #firulais:dog_face: :grinning_face_with_sweat:suele suceder.:grinning_face_with_sweat:. . . . . @elbarbasofficial . . . #firulais #memefirulais #firulaisve #firulaicostero #notibarbas #maracaibo #cartagenacolombia #colombia #venezolanosencartagenacolombia #venezolanosenvenezuela #elbarbasofficial #locoencer #humorespañol #humorvenezolano #memeinfluencer #loco #notibarbas #coronavirus #parvovirus
2231631103335086112; 0; False; 1580251180; Aktuelle Informationen zum Coronavirus. | 28. Januar 2020 - 23:37 Uhr | #coronavirus #coronaviren #china #deutschland #krankheit #gesundheit #nachrichten
2231597311659028289; 20; False; 1580251168; Conoce como son los mercados portadores del popular y altamente peligroso #virus #coronavirus . Se encuentran en el medio oriente específicamente #china ¡COMPARTE Y MUÉSTRALE AL MUNDO LO QUE ESTA DETRÁS DE ESTE TERRIBLE VIRUS! :face_screaming_in_fear::face_with_medical_mask:
2231630930665280603; 0; False; 1580251159; The cat who got the..... ...coronavirus :crying_cat_face: #cat #catsofinstagram #cream #coronavirus #smol
2231630902681041545; 0; False; 1580251156; O ministro da Saúde, Luiz Henrique Mandetta, informou nesta terça-feira que foi identificado em Minas Gerais o primeiro caso suspeito de coronavírus no Brasil, de uma paciente que esteve na cidade chinesa de Wuhan, o epicentro do surto do vírus. . . . . . #minasgerais #minas #mineiros #minasgeraisoficial #minasgerais:red_triangle_pointed_up: #turismomineiro #turismominasgerais #turismoemminasgerais #turismointernacional #china #chineses #coronavirus #coronavirusnobrasil #governobolsonaro #anonovochines #saopaulocity #belohorizonte #curitiba #jornale #noticiascuritiba #brasileirospelomundo #parana #paranaenses #brasilia #politica #noticias #brasileiros #fozdoiguaçu #maringá #paranagua
2231630767977775787; 3; False; 1580251148; Síguenos para mas contenido :blue_heart: - - - - #memesdaily #elgoth #meme #memesgraciosos #memesenespañol #memesespañol #memes:face_with_tears_of_joy: #memes #goth #siguemeytesigo #gothjaidefinichon #chileanmemes #jaidefinichongoth #china #coronavirus #gatitos #kakarot #dylantero #instagram #instamemes #dylanteromeme
2231630447581153496; 0; False; 1580251139; “The line to pay fruits & vegetables today.”⁣ ⁣ ‪From wheretogooncein on Twitter.‬⁣ ⁣ #news #breakingnews⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣ #worldnews⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣ #coronavirus #wuhanvirus #wuhancoronavirusoutbreak #WuhanCoronavirus⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣ #coronavirusoutbreak #corona #ncov2019 #ncov⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣ #武漢肺炎 #武汉疫情⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣ #China #Wuhan⁣⁣⁣⁣⁣ #StandWithWuhan⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣ #LunarNewYear #NewYear #SpringFestival⁣⁣
2231630744898563438; 2; False; 1580251137; :construction::construction: WARNING GRAPHIC :warning: :warning: please share to raise awareness. #china is cracking down on the #wildlife food trade which Chinese authorities have linked to the #coronavirus outbreak. The same market was linked to the 2003 #SARS outbreak #virus #disease #batsoup #animal #cat #dog #wshh
2231630706361037914; 3; False; 1580251132; Run b**ch run :person_running_dark_skin_tone::woman_running_light_skin_tone::person_running_light_skin_tone: :face_with_tears_of_joy::face_with_tears_of_joy::face_with_tears_of_joy::face_with_tears_of_joy: ================== #IamCalvinKing ================== #VerifiytheKing ================== If you #Like this #post. #follow me here on #Instagram and I’ll give you a #shoutout on my IG Story. ================== Also on #Twitter: www.twitter.com/iamcalvinking And on #Facebook: www.facebook.com/iamcalvinking #pettypost #pettyastheycome #straightclownin #hegotjokes #jokesfordays #itsjustjokespeople #itsfunnytome #funnyisfunny #randomhumor #china #coronavirus
2231630666013817730; 1; False; 1580251127; #coronavirus #corona #brasil #french #france #usa:United_States: #algeriennes #china #makeup
2231630213171486579; 6; False; 1580251127; Crikey m8, this #coronavirus got ya crew lookin nervous :face_with_medical_mask::face_with_tears_of_joy:
2231630665291914808; 0; False; 1580251127; We are doomed. #meme #memes #memez #dailymemea #dankmemes #helpme #ragnar #simpsons #kobe #kobebryant #ripkobe #basketball #corona #coronavirus #coronado #colorado #usa #australians #2020 #badthings #fly
2231630620261735026; 2; False; 1580251122; 2020 tá de parabéns.... Não bastando a baixíssima qualidade do ar ( equiparado a fumar 40 cigarros por dia), agora havemos de lidar com o Corona Virus (4 casos confirmados no Estado e mais 6 em análise). Ah, e a mixaria de 40 avioes oriundos da China diariamente! Ficamos sem opção, sem ar e praticamente incapacitados de enxergar :woman_shrugging:#coronavirus #tafacilnao #aussielife #2020
2231630556316396085; 0; False; 1580251114; Les comparto las recomendaciones de la @acorlco y la OMS para la infección de las enfermedades respiratorias tipo #coronavirus. #julianmolanootorrino #otorrino #medellin #infeccionrespiratoria #prevencion
2231630492719935290; 0; False; 1580251107; #residentevil #umbrellacorporation #coronavirus #matchinglogos both companies related to #biologicalsciences and #engineers #conspiracies #meme #liveinchina at the same #citylife #GirlsFrontline #epicseven #blackdesertmobile #crossingvoid #saoars #biology #research #vaccine #fda #outbreak Its spreading symptoms are : coughing, coughing liquid in lungs, pneumonia, touch based, physical transfers residual, #coronabeer #corona
2231630477260506695; 0; False; 1580251105; Prá sua informação ... existem 3 casos suspeitos no Brasil... governo eleva o ALERTA DE CONTÁGIO ... iniciou na China e está contagiando a Europa !!! #coronavirus #sintomas
2231630479130593525; 0; False; 1580251105; Let's do it #coronavirus
2231629355420132260; 1; False; 1580251089; Esto ya está disponible en el canal de YouTube :heavy_large_circle: #HotGyalRemix @japanesepty @mrsaikofficial @realphantominattack :hot_pepper::fire: . . #panama #viral #pty507 #posterhits #coronavirus #japanese #latino
2231630297609744705; 0; False; 1580251084; By now you have heard about the coronavirus, the respiratory illness that was first detected in Wuhan, China. Understandably, there is some anxiety about this virus. Here is what you need to know: - If you have not traveled to an area where the virus has been detected or had close contact with a patient who tested positive for this type of coronavirus, the risk of infection is very low. - Symptoms include fever, cough, shortness of breath, occurring 2-14 days after exposure - Prevention includes good hand washing, avoiding people who are sick, staying home when sick, regular disinfection of objects, and covering your cough or sneeze. #healthy #healthyfamily #healthykids #coronavirus #cpcmg
2231630285682551754; 0; False; 1580251082; #memeintelligenceagency #memesofinstagram #meme #funny #yourmom #triggered #comedy #memes #edgy #edgymemes #dank #dankmemes #memes #funnymemes #coronavirus
2231630042824066735; 0; False; 1580251072; China :China: . #coronavirus #coronavirusoutbreak #virus #wuhan #wuhanvirus #coronaviruschina #wuhanchina #corona #coronovirus
2231630182050241727; 0; False; 1580251070; Espalhando rápido no Brasil. Total atenção! #coronavirus
2231630115133913295; 0; False; 1580251062; Reposted from @josi10.73 Reposted from @v_eganforanimals Posted @withregram • @mirrornow_in The #UnitedStates has confirmed the first case of #Coronavirus. Health authorities said that the victim is in his thirties & had travelled to the United States from China's Wuhan. The man is currently hospitalized as a precaution. Death toll in #China's Coronavirus goes up to 9, total cases rise to 440. #Indian Civil Aviation Ministry has directed 7 airports to screen passengers arriving from China. 189 passengers were tested for the virus in last 5-days at Mumbai International Airport, all test results came back negative. The World Health Organization, which is holding an emergency meeting on Wednesday, will consider declaring an international public health emergency over the virus, as it did with swine flu and Ebola. . . . . #ncov #ncov2019 #wuhan #wuhanvirus #wuhancoronavirus #coronavirus #coronavirusoutbreak #cdc #worldhealthorganization #coronavirus #virus #infection #awareness #thailand #japan #southkorea #300people #infected #deathtollrising #worldhealthorganization #emergency #publicheath #coronavirusoutbreak #coronavirusalert #coronavirusprotection #mirrornow - #regrann - #regrann
2231630099781116987; 0; False; 1580251060; Cover your mouth and nose especially if you live in downtown. You don’t want to catch that #coronavirus #bettersafethansorry #sorrynotsorry #face #mask #mouthmask #nosemask #sick #letsnot #getsick
2231630074766063193; 0; False; 1580251057; Time to get turnt. #curecorona #corona #coronavirus #coronavirusmemes #memes #meme #saucysantana #saucymemes #spicymemes
2231630043973737106; 0; False; 1580251053; Источником возникновения вируса мог быть не рынок морепродуктов в Ухани. И тогда остается вопрос - откуда появился вирус. Уже есть "шпионская" версия. #coronavirus #коронавирус #китай #ухань
2231630034886884472; 1; False; 1580251052; Las mascarillas se volvieron un accesorio indispensable en los aeropuertos, se venden como pan caliente al punto que están agotadas ..@noticiastelemundo #coronavirus #lax
2231630012749436395; 0; False; 1580251050; #Coronavirus #AlertaMundial 𝗡𝘂𝗲𝘀𝘁𝗿𝗼 𝗽𝗮𝗶́𝘀 𝗲𝘀𝘁𝗮́ 𝗲𝗻 𝗮𝗹𝗲𝗿𝘁𝗮 𝘁𝗿𝗮𝘀 𝗹𝗮 𝗮𝗺𝗲𝗻𝗮𝘇𝗮 𝗱𝗲𝗹 𝗖𝗼𝗿𝗼𝗻𝗮𝘃𝗶𝗿𝘂𝘀. La Clínica San Judas Tadeo preocupándose por tu bienestar y salud, te informa y enseña diferentes formas de prevención que debemos seguir para evitar ser contagiados; asimismo recomienda estar atentos a los mínimos síntomas que puedan sentir. 𝗦𝗶𝗲𝗺𝗽𝗿𝗲 𝗰𝘂𝗶𝗱𝗮𝗻𝗱𝗼 𝘁𝘂 𝘀𝗮𝗹𝘂𝗱. Para mayor información :telephone:Teléfono de informes / citas: (01) 219 1100. :round_pushpin:Dirección: Calle Manuel Raygada 170, San Miguel. :globe_with_meridians:Pagina web: http://www.clinicasanjudastadeo.com.pe/ :small_orange_diamond:Instagram: @clinica_sanjudastadeo
2231629654263800258; 0; False; 1580251044; #Repost @japenmalaysia (@get_repost) ・・・ Fakta-fakta mengenai virus 2019-nCoV yang anda perlu tahu. Hentikan sebar berita palsu! . Sumber : @bernamaofficial . #coronavirus #semaksebelumsebar #takpastijangankongsi #JabatanPenerangan #SayangiMalaysiaku #MalaysiaBersih #KemakmuranBersama #SharedProsperity #Makmur2030 #KitaMalaysia #Malaysia
2231628363456552712; 1; False; 1580251042; Wtf Follow @acedmeme_v2 for more posts
2231629943217092152; 0; False; 1580251041; How I’m gonna inoculate against the dreaded #coronavirus
2231629919962549825; 1; False; 1580251039; Building that immunity to coronavirus. Not today pandemic, not today. #coronavirus #coronavirusmemes #immunityboost #immunitysupport #immunityboosting #virus
2231629850488462611; 0; False; 1580251030; What do Respiratory Therapists need to know about the Coronavius. View CSRT resources at https://www.csrt.com/csrt-novel-coronavirus-resources/ . #bcsrt #coronavirus #csrt #coronavirusoutbreak
2231629796583217094; 0; False; 1580251024; So it's the first day back at school today and this whole #coronavirus has been freaking me out a little. It's not so much me being afraid of getting infected but it's being a mother and worrying for the younger generation. I hate that #motherhood makes you care more. This quote is a reminder to myself as well as all you fellow worriers out there. Whether it be worrying about the outbreak, worrying about the environment, worrying about your financial future or whatever it may be. Do what you can and obviously don't make dumb decisions but also don't let the worries steal away life's special moments. . . . #motivationalquotes #morningmotivation #motivationboost #motivationquotes #positivethinking #positivethoughts #mindsetcoach #positivevibes #hustle #hustlequotes #entrepreneurship #success #successquotes #successtip #makeanimpact #legacy #intentionalliving #minimalism
2231629780000139971; 0; False; 1580251022; #truth #funny #coronavirus #wish #tuesday
2231629350973669826; 1; False; 1580251021; Kit untuk mendeteksi viruscorona sedang dibuat secara besar-besaran di china . . #corona #coronavirus #farmasi #apoteker #farmasis #farmasidruggist #penyakit #virus #indonesia #obat #rumahsakit #klinik #puskesmas #apotek #farmasimuda #iai #pafi #ismafarsi #aomki #farmakologi
2231629769504671813; 0; False; 1580251021; Sera? :face_with_tears_of_joy:. #coronavirus #meme #memes #parareir #sonrie #sefeliz #chuygonzalezmx
2231629678591290089; 0; False; 1580251010; #Repost @fightdogmeat_dot_com with @get_repost ・・・ CHINA: Heilongjiang To Cull All Stray Animals. Dogs and cats do NOT spread coronavirus! The city of Neha in Heilongjiang Province has issued a notice to commence killing all stray animals in the entire city. How many more cities across China will copy their example and cull all their animals too? Coronavirus is spread by contact with INFECTED HUMANS, not animals. It was NOT CAUSED by people eating animals. Read more on our FDM website: www.FightDogMeat.com. Fight Dog Meat. Registered Charity. #china #chinatown #china:China: #chinatravel #dog #dogs #cat #cats #stopanimalabuse #stopanimalcruelty #coronavirus #coronavirusoutbreak #coronaviruschina
2231629637134290509; 0; False; 1580251005; —who y’all got?— Coronavirus (death toll 126 this year) VS Influenza (8200 death 2019-2020 flu season). #coronavirus #coronavirusoutbreak #influenza #sick #flu #zombieapocalypse #armageddon
2231629559849303839; 0; False; 1580250996; Scary images from china #coronavirus #wuhan #china #wuhanvirus #coronavirusleaks #wuhannews #coronavirusnews #virusleaks #coronaleaks #wuhanleaks #wuhanvirusleaks #warning
2231629496271686135; 0; False; 1580250988; Prá sua informação ... existem 3 casos suspeitos no Brasil... governo eleva o ALERTA DE CONTÁGIO ... iniciou na China e está contagiando a Europa !!! #coronavirus
2231629270374032948; 1; False; 1580250984; Part 2 taxi driver corona virus passeger #WuhanSARS #WuhanOutbreak #CCPChina #chinazi #SARS2020 #武漢肺炎 #武汉疫情 #ChinaVirus #CoronavirusOutbreak at #Wuhan #china #武漢疫情 #冠狀病毒 #武漢肺炎 #新型肺炎 #新型コロナウィルス #武漢 #武漢市新型冠狀病毒肺炎 #武漢市 #chinanews #becausechina #faceofchina #massmigration #springfestival #coronavirus #WuhanCoronavirus #WuhanPneumonia #wuhanvirus
2231629466576449756; 2; False; 1580250984; O presidente Jair Bolsonaro se manifestou nesta terça-feira contra trazer de volta ao Brasil uma família brasileira que foi colocada em isolamento nas Filipinas por suspeita de contaminação pelo coronavírus da China, alegando que repatriá-la poderia colocar o Brasil em risco. . . “Pelo que parece, tem uma família na região onde o vírus está atuando. Não seria oportuno retirar de lá, com todo respeito, pelo contrário. Agora, não vamos colocar em risco nós aqui por uma família apenas”, disse Bolsonaro em entrevista a jornalistas no Palácio da Alvorada nesta manhã, após desembarcar de viagem à Índia. . . . . #brasil #turismointernacional #minasgerais #anvisa #saudepublica #curitiba #mortes #saude #saúde #ministrosergiomoro #segurançapública #segurancapublica #bolsonaromito #governobolsonaro #ministeriopublico #ministeriopúblico #policiamilitar #brasileiros #ministeriodasaude #coronavirus #turismo #bolsonaropresidente2018 #coronavirusnobrasil #bolsonaropresidente #brasileirospelomundo #saopaulocity #bolsonaro17 #bolsonaro2022 #bolsonaronão #elenão
2231629388446148655; 10; False; 1580250975; Prevenir antes que lamentar :rolling_on_the_floor_laughing: #coronavirus
2231629224899791953; 0; False; 1580250974; Run bitch ruuuun #humor #meme #coronavirus #comedia #video #run
2231621295031501218; 0; False; 1580250968; “Wuhan, Jiāyóu!”(¡Arriba #Wuhan!) Así es el grito de ánimo de los residentes en cuarentena por el #coronavirus
2231629323216104537; 4; False; 1580250967; Dont mind me, be back in 20.
2231629322544500265; 0; False; 1580250967; Is this too soon? #funny #meme #dankmeme #funnymeme #coronavirus #movies #monstersinc #Disney #news #comedy
2231629306681322423; 0; False; 1580250965; How are the olympics going to be affected by the coronavirus?:face_with_medical_mask:This is probably golfs last shot to impress people and stay in the olympics, with the recent comment by @djohnsonpga and @bkoepka saying they do not know how the Olympics will fit in to there schedule. Is golf in the olympics doomed?:thinking_face::face_with_hand_over_mouth: #coronavirus #golf #olympics #olympicgolf #pgatour #pga #liveunderpar #2020 #coronavirus2020 #chicagogolf Discuss below :down_arrow::down_arrow::down_arrow:
2231629252322468066; 0; False; 1580250959; AL MAL TIEMPO BUENA CARA Y esa #coronavirus se le ve muy feliz #jejejejeje #:smirking_face::smirking_face::smirking_face::smirking_face::smirking_face::smirking_face::smirking_face::smirking_face::smirking_face::smirking_face::smirking_face::smirking_face::smirking_face::smirking_face::smirking_face::smirking_face::smirking_face::smirking_face::smirking_face::smirking_face::smirking_face::smirking_face::smirking_face::smirking_face::smirking_face::smirking_face::smirking_face::smirking_face::smirking_face::smirking_face::smirking_face::smirking_face::smirking_face::smirking_face::smirking_face::smirking_face::smirking_face::smirking_face::smirking_face::smirking_face::smirking_face::smirking_face::smirking_face::smirking_face::smirking_face::smirking_face::smirking_face::smirking_face::smirking_face::smirking_face::smirking_face::smirking_face::smirking_face::smirking_face::smirking_face::smirking_face::smirking_face::smirking_face::smirking_face::smirking_face::smirking_face::smirking_face::smirking_face::smirking_face::smirking_face::smirking_face::smirking_face::smirking_face::smirking_face::smirking_face::smirking_face::smirking_face::smirking_face::smirking_face::smirking_face::smirking_face::smirking_face::smirking_face::smirking_face::smirking_face::smirking_face::smirking_face::smirking_face::smirking_face::smirking_face::smirking_face::smirking_face::smirking_face::smirking_face::smirking_face::smirking_face::smirking_face::smirking_face::smirking_face::smirking_face::smirking_face::smirking_face::smirking_face::smirking_face::smirking_face::smirking_face::smirking_face::smirking_face::smirking_face::smirking_face::smirking_face::smirking_face::smirking_face::smirking_face::smirking_face::smirking_face::smirking_face::smirking_face::smirking_face::smirking_face::smirking_face::smirking_face::smirking_face::smirking_face::smirking_face::smirking_face::smirking_face::smirking_face::smirking_face::smirking_face::smirking_face::smirking_face::smirking_face::smirking_face::smirking_face::smirking_face::smirking_face::smirking_face::smirking_face::smirking_face::smirking_face::smirking_face::smirking_face::smirking_face::smirking_face::smirking_face::smirking_face::smirking_face::smirking_face::smirking_face::smirking_face::smirking_face::smirking_face::smirking_face::smirking_face: #virus #:ghost: #:alien_monster: #:clown_face: #sonrie #:face_savoring_food::thumbs_up:
2231629183033227909; 0; False; 1580250951; . CONTINUAÇÃO (POST 02 de 03)...:microbe::stethoscope::hospital::heavy_check_mark::petri_dish:!!! . :black_small_square:Qual é o período de incubação desta nova variante do coronavírus? . Ainda não há uma informação exata. Presume-se que o tempo de exposição ao vírus e o início dos sintomas seja de até duas semanas. . :black_small_square:Quais são os sintomas de uma pessoa infectada por um coronavírus? . Pode variar desde casos assintomáticos, casos de infecções de vias aéreas superiores semelhante ao resfriado, até casos graves com pneumonia e insuficiência respiratória aguda, com dificuldade respiratória. . :black_small_square:Como ocorre o contágio e qual é a gravidade do novo coronavírus? . Não se sabe até o momento. Alguns vírus de transmissão aérea são altamente contagiosos, como o sarampo, enquanto outros são menos. Ainda não está claro com que facilidade o 2019-nCoV é transmitido de pessoa para pessoa. . :black_small_square:Como é feita a confirmação do diagnóstico do novo coronavírus? . Exames laboratoriais realizados por biologia molecular identificam o material genético do vírus em secreções respiratórias. . :black_small_square:Existe um tratamento para o novo coronavírus? . Não há um medicamento específico. Indica-se repouso e ingestão de líquidos, além de medidas de suporte de acordo com cada caso...(aguarde o post 03)...:face_with_medical_mask::books::hospital::microbe::stethoscope:!!! . Fonte: Sociedade Brasileira de Infectologia. #medicina #odontologia #farmacia #enfermagem #coronavirus #nutricao #fisioterapia #fonoaudiologia #med #doctors #hospital #hospitallife #internatomedico #residenciamedica #guiabasicodeplantao #medufjf #meduftm #medufpr #medufrgs #medufrn #medufac #medunifesp #medunaerp #medfaminas #medufsc #medufscar #medpuccamp #medunesc #meduss
2231629109214281530; 16; False; 1580250942; #JeNeSuisPasUnVirus . . Hashtag lancé par une jeune femme pour dénoncer les discriminations subies par des français d'origine asiatique depuis la crise sanitaire du coronavirus. Évidemment, je soutiens et je fais tourner. . #RacismeAntiAsiatique et plus largement #AntiRacisme. . #TropFacile #Coronavirus #RacismeOrdinaire . . #Autoportrait #SelfPortrait #Selfie #Cellphonephotography #MobilePhotography #Photographie #Photography #IAmNotAVirus #AntiAsianRacism #AntiRacism #PhotoDuJour #PicOfTheDay #RunnerLife #Photographe #Photographer
2231628972721415742; 0; False; 1580250942; :flushed_face: - Follow @dankshetz for more:hundred_points: - Send this to a friend! - - - - Ignore the tags: #meme #edgymemes #dankmemes #dank #woah #coronavirus #explore #memeoverview #funniest #memed #memereview #memelord #memedaily #dankvideos #dankdank #dankmemez #edgyhumor
2231628986782370602; 0; False; 1580250927; Tout se perd :face_with_tears_of_joy::face_with_tears_of_joy::face_with_tears_of_joy: #viedemerde #coronavirus #virus #grippe #humour #china #asianfood #madeinfrance
2231628955852844743; 1; False; 1580250924; The amount of infected people is probably in the thousands but China’s government have a habit of covering stuff up . . . . . #dank #memes #meme #dankmemes #relatablememes #spicymemes #decentmemes #memesdaily #hilariousmemes #originalmemes #bestmemes #funnymemes #funny #lmao #lol #memefarm #mememaker #memepage #memelord #memegod #memer #memeaccount #corona #coronavirus #coronavirusmemes #chinamemes #chinesememes #darkmemes #darkhumor #darkhumormemes
2231628949779606364; 0; False; 1580250923; #coronavirus #wuhan #china #wuhanvirus #coronavirusleaks #wuhannews #coronavirusnews #virusleaks #coronaleaks #wuhanleaks #wuhanvirusleaks
2231628218770939553; 0; False; 1580250905; Sekdaprov dan Diskes Riau Periksa Ruangan Isolasi #viruscorona #coronavirus #ruangisolasi #sekdaprovriau #diskesriau #riausiaga #beritapekanbaru #infopku_ #beritariauhariini #beritariauterkini #inforiau_
2231628725846261062; 0; False; 1580250896; . . Repost dari :right_arrow: @green.flotilla Ternyata Virus corona ini sangat Dahsyat Menular cepat sampai lebih dari 100rb orang Tapi Cina Dengan segala caranya mencoba menyembunyikan informasi yang sesungguhnya terjadi di WUHAN - Dengar kesaksian seorang dokter dan warga China yang meminta tolong agar dunia tau tentang keadaan sebenarnya "Dia hanya berharap semua yang menyaksikan ini bisa menyampaikan pada dunia Walaupun hanya lewat jari jemari nya. _ Simak juga cara menggunakan masker yang benar GESER !!! _ Video : Eracom _ Simak informasi terbaru lainnya, klik :backhand_index_pointing_right: @indotoday . . #CoronaVirus #greenflotilla
2231628725090604140; 2; False; 1580250896; Harbiden öyle akallalsllsldl :face_with_tears_of_joy: #kadir #temizlik #temizlikavcıları #corona #coronavirus
2231628637605764841; 1; False; 1580250886; Earthquakes, Coronavirus, volcanos... 2020 folks...enjoy it while it lasts. #endofdays #theendisnigh #jamaicaearthquake #coronavirus
2231628603010762567; 0; False; 1580250882; Leyendo Mí Sagrada Biblia, con mi gran amigo Fito Hurtado dice: que no se debe comer murciélago. "Y de las aves, éstas tendréis en abominación; no se comerán, serán abominación: el águila, el quebrantahuesos, el azor, el gallinazo, el avestruz, la lechuza, la gaviota, el gavilán según su especie; el buho, el somormujo, el ibis, el calamón, el pelícano, el buitre, la cigüeña, la garza según su especie, la abubilla y el murciélago. Levítico 11:13-19. Si lo dice Dios, allí están las consecuencias. Amen. Escrito y enviado por www.montedgardoradio.com #labiblia #abomination #abominacion #biblia #findelmundo #pecado #pecados #cristianoronaldo #diosito #diosa #celestial #elcielo #amén #montedgardoradio #virus #coronavirus
2231628600537454853; 0; False; 1580250881; #Repost @medicadoo • • • • • • :face_with_medical_mask: No lo iba a colgar hasta mañana... pero viendo que la cosa esta que arde... va a tocar hablar hoy del Coronavirus este que tiene a los chinos tela de preocupados⁣ ⁣⁣ Lo primero... este tipo de virus ya ocasiono dos epidemias anteriores, el síndrome respiratorio de Oriente Medio (MERS) y el el síndrome respiratorio agudo severo (SARS), con unas tasas de mortalidad nada desdeñables del 35% y 18% respectivamente.⁣⁣ ⁣⁣ Al lío... se trata de una nueva cepa de coronavirus que, hasta entonces no se había encontrado en el ser humano que tiene su origen en China, más concretamente en la ciudad de Wuhan, y cuya existencia se comunico a la OMS el 31 de Diciembre de 2019. ⁣⁣ ⁣⁣ Los síntomas, las vías de contagio y las medidas a tomar te las cuento en la infografía y tienes mucha más información en el blog www.medicadoo.es ⁣⁣ ⁣⁣ Solo deciros que no cunda el pánico, al menos en España... que a pesar de que muchas veces los medios de comunicación tratan estos temas de una manera un tanto alarmista, mostrando imágenes que parecen sacadas de películas de apocalipsis zombies y fin del mundo, todo esto parece que por ahora nos queda un poco lejos y si conviene saber que es bastante poco probable que en España suframos un número significativo de casos y las autoridades nos dicen que el riesgo para la salud publica es muy bajo.⁣ ⁣ Aunque eso si... si vas a viajar a China extrema las precauciones y sobre todo... lavado de manos, solución hidroalcoholica a go go y la mascarilla si es necesaria (del tipo FFPII)⁣ ⁣ #consejofarmacéutico #farmacia #salud #virus #coronavirus #viruschino #higiene #farmaciagorgoll
2231628599446653326; 0; False; 1580250881; Saiba mais em www.mikaelsampaio.com #segue #coronavirus #blogdomikaelsampaio
2231628529200972434; 0; False; 1580250873; Atención ciudadanos del :globe_showing_Americas:!!! :airplane::airplane: Si vas a viajar, sigue los siguientes consejos del Ministerio de Salud Chile :backhand_index_pointing_right: #CoronaVirus
2231628523395571056; 0; False; 1580250872; :butterfly: 𝖕𝖗𝖎𝖒𝖊𝖗 𝖕𝖔𝖘𝖙 :butterfly: Espero les guste y ojalá que apoyen a la cuenta... • • • • • • • • • #likeforlikes #posts #tumblrgirls #girl #likeforlikes #like4likes #yelow #amarillo #verde #green #selfcaredeck #azulruso #post #selfcare #mascarilla #posts #tumblrgirls #coronavirus #coronavirusoutbreak #selfcarethreads #selfcaresunday #selfcareespañol #español #primerpost #2020goals #likeforlikeback #instafollow #followforfollowback #likeforlikes #posts #tumblrgirls #girl #likeforlikes #like4likes #yelow #amarillo #verde #green #selfcaredeck #azulruso #fly
2231628153927004558; 2; False; 1580250867; He delivers 500 masks for the population #coronavirus at a police station in #Anhui Province #China ... and the police thank him...greeting him with respect:thumbs_up::thumbs_up:
2231626954111586104; 1; False; 1580250859; We explore the science behind the #coronavirus. Click the link in the bio to learn more! — #slayflexlit #sflfam #coronavirusoutbreak #coronaviruschina #huwan #virus #cdc #pandemic #coronavirus2020 #science #diseaseprevention #infectiousdisease #fluseason
2231628322244067258; 1; False; 1580250852; Simple Green Pro 5:registered: es un desinfectante de grado hospitalario registrado por la EPA, conocido por su alto rendimiento. Es desinfectante, fungicida, virucida y desodorizante, todo en un solo paso. - Elimina patógenos transmitidos por la sangre, VIH-1, Hepatitis B y C, AMP, coronavirus asociados con síndrome respiratorio agudo severo (SRAS), Estafilococo, virus del Ébola, MRSA, virus de la viruela, Salmonella, E. Coli, Norovirus, Influenza, Hongos y más. - Ayuda a prevenir la propagación de enfermedades contagiosas en escuelas, guarderías, edificios de oficinas, hoteles, tiendas de conveniencia, prisiones y otras instalaciones con mucho tráfico. - Elimina el virus del moquillo canino y el calicivirus felino para uso en oficinas veterinarias, tiendas de mascotas, granjas y otras instalaciones de cuidado de animales. Para más información: https://cdn.simplegreen.com/downloads/TDS_EN-US_SimpleGreendPro5.pdf #rocayolsafety #rocayol #safety #coronavirus #seguridadindustrial #saludocupacional #panamá
2231628236746601013; 0; False; 1580250838; #corona #beer #coronavirus #ebola
2231628129877464907; 0; False; 1580250825; Dear my friends,Does anyone has any family or friend can contact the dealer who is selling this N95 Mask. Please let me know! A lot of the Wuhan’s hospitals need your help! Please!#coronavirus #redcross #redcrossvolunteer #usaredcross
2231627174112470233; 0; False; 1580250825; :eyes::face_with_monocle::thinking_face: ⠀⠀ ⠀⠀⠀⠀⠀⠀ ⠀⠀⠀⠀⠀⠀ ⠀⠀⠀⠀⠀⠀ ⠀⠀ #28Ene #coronavirus No es la Guerra Mundial Z. Así se encuentra la frontera terrestre desde Hong Kong las personas están intentando huir todo esto después que #HongKong anunciará restricciones por la cantidad casos confirmados de #coronavirus. ⠀⠀⠀⠀⠀ ⠀⠀⠀ ⠀⠀⠀⠀⠀⠀ ⠀⠀⠀⠀⠀⠀ ⠀⠀⠀⠀⠀⠀ ⠀⠀⠀ ⠀⠀⠀⠀⠀⠀ ⠀⠀⠀ ⠀⠀⠀⠀⠀⠀ ⠀⠀⠀⠀⠀⠀ ⠀⠀⠀⠀⠀⠀ ⠀⠀⠀ ⠀⠀⠀⠀⠀⠀ ⠀⠀⠀⠀⠀⠀ ⠀⠀⠀ ••••••••••••••••••••••••••••••••••••••••••••••••••••••••••••••• ⠀ @doblemoralrd noticias #actualidad #internacional #republicadominicana #view #alerta #novedad #viral #rd #dominicannetflix #doblemoralrd #dominicana #jamaica #japon #jamaica #japon #franklinmirabal #haiti #toros #faride #miami #angelestevez #hanley #bonilla #ericfilia #delacruz #pelucho #brito #pujeazul #seriefinallidom2020
2231627779602873639; 0; False; 1580250818; Wuhan, China :China::exclamation_mark: A person who cannot take medicine at the hospital took off his mask and coughed over the hospital staff! :anguished_face: . #coronavirus #coronavirusoutbreak #virus #wuhan #wuhanvirus #coronaviruschina #wuhanchina #corona #coronovirus
2231628043532036315; 0; False; 1580250815; #dollyparton #dollypartonchallenge #realité #coronavirus
2231628046887311440; 11; False; 1580250815; Işık Hızında... . . Takip etmeyi unutma :backhand_index_pointing_left: . . Daha fazlasi için takip et . Hiçbir haberimiz %100 netlik taşımamakta . #corona #virus #hastalik #çin #abd #tayland #ölüm #virüs #türkiye #sondakika #haber #newspaper #flaşhaber #deepweb #coronado #coronavirus #video #fotograf #gt #takipcikazan #nursing #hospital #Wuhan #wuhanvirus
2231626354042194026; 0; False; 1580250809; #coronavirus #2019-nCoV Jangan sebarkan berita palsu, dapatkan maklumat yang tepat dan jangan gebang seperti anda seorang yang pakar. Tak penat ke kompang kaw2 kat MedSoc tapi hang kluar pun tak pakai topeng muka? makan pun tak basuh tangan??? Simpan je semangat pahlawan MedSoc tu n jom kongsi video ni.
2231627949899938492; 0; False; 1580250804; #coronavirus #corona #brasil #french #france #usa
2231627937155946537; 0; False; 1580250802; #PrayforChina #coronavirus #healing #cure #wisdom #Godwillturnitaround
2231627894021820794; 0; False; 1580250797; #ApodérateEc #Urgente #ÚltimaHora #Quito #Ecuador #Coronavirus El Ministerio de Salud Pública del Ecuador informó que el estado del paciente chino que está siendo atendido en Quito por un posible caso de coronavirus es crítico. Aquí el comunicado oficial :backhand_index_pointing_down_light_skin_tone:
2231627858042984236; 0; False; 1580250793; No saluden a sus amigos chinos * #china #coronavirus #coronavirusmemes #Spider #spiderman #spidermanmemes #venom2 #venom
2231627791529847512; 0; False; 1580250785; #coronavirusmemes #corona #coronavirus
2231627734244033567; 0; False; 1580250778; Coronavírus - Perguntas e respostas Sociedade Brasileira de Infectologia - Acesse www.oalfinete.com #jornaloalfinete #coronavirus #utilidadepublica
2231627038047917537; 0; False; 1580250754; Os moradores de Wuhan na China (epicentro do surto do coronavírus) foram para as varandas de seus apartamentos cantar canções patriotas e o hino da China para se fortalecerem juntos. A cidade de Wuhan foi isolada pelo governo chinês desde quinta (23). Os hospitais estão lotados e as ruas vazias. _ :movie_camera: Reprodução/Instagram _ #coronavirus #pandemia #wuhan #oms #saude #china
2231627398506486212; 0; False; 1580250738; • ιnflυєnzα • This pragmatic clinical trial was conducted in the Brazilian Public Health System in Petrópolis (BPHSP) with children aged from 1 to 5 years old. The medications used were mainly selected based on in vitro experiments (InfluBio), and in successful qualitative clinical experiences (Homeopathic Complex). Following informed parental consent, subjects were randomly distributed, in a blind manner, to three experimental groups: Homeopathic Complex, Placebo, and InfluBio. BPHSP health agents collected flu and acute respiratory infection symptomatic episodes monthly following the established protocol. The number of these episodes was registered in one year (2009-2010).⁣ ⁣ RESULTS: Out of the 600 children recruited, 445 (74.17%) completed the study (149: Homeopathic complex; 151: Placebo; 145: InfluBio). The number of flu and acute respiratory infection symptomatic episodes detected in this clinical trial was low; however, it was different between homeopathic groups and placebo (p < 0.001). In the first year post-intervention, 46/151 (30.5%) of children in the placebo group developed 3 or more flu and acute respiratory infection episodes, while there was no episode in the group of 149 children who used Homeopathic Complex, and only 1 episode in the group of 145 (1%) children who received InfluBio.⁣ ⁣ CONCLUSION: These results suggested that the use of homeopathic medicines minimized the number of flu and acute respiratory infection symptomatic episodes in children, signalizing that the homeopathic prophylactic potential should be investigated in further studies.⁣ .⁣ .⁣ .⁣ .⁣ .⁣ ⁣ #influenza #influenzavirus #influenza2019 #influenzatime #flu #health #china #corona #coronavirus #virus #fluseason #influenzasucks #coronavirus #homeopathy #science #sick #immunity #immunizations #flumedicine #fluprevention #virusprevention #truth #pubmed #immunesytem #autoimmunedisease
2231627321683846035; 0; False; 1580250729; Akhir - akhir ini sedang heboh mengenai jangkitan virus korona yang terjadi di Wuhan China. Sebenernya apa virus korona, ciri dan dampak apa yang bisa terjadi jika terjangkit virus tersebut, yuk kita bahas!:smiling_face: . Sambil berdoa, semoga Indonesiaku aman:smiling_face_with_halo: . Amiin..... Pic by @gadismagz _________ #viruskorona #coronavirus
2231627272073662718; 1; False; 1580250723; Northwestern microbiologist Karla Satchell, PhD, is leading an effort to investigate the structure biology of coronavirus to ultimately understand how to stop it from replicating in humans. // Tap our stories to hear more on the status of her center’s work. :headphone:
2231627257529733169; 0; False; 1580250721; Mehr wissen wir nicht #coronavirus
2231627243368967690; 0; False; 1580250719; Sheeesh, whos trynna take a Fat L this January ? #coronavirus #meme #funnyvideos #funny #haha #memesespañol
2231626948106541791; 0; False; 1580250715; #korona #koronavirüsü #corona #coronavirus
2231627207187390866; 0; False; 1580250715; Bat soup :drooling_face::pot_of_food: #corona #coronavirus #ironicmemes #irony #ironymemes #edgy #edgymemes #edgymemesforedgyteens #china #chinese #okbuddyretard #bruh #bruhmoment #bruhmemes #playboicarti #nolie #thewatch #laugh #laughnow #funnymemes #funny #funnyshit #memer #corona:beer_mug: #virus #batsoup #soup #delicious #tasty #tastyfood
2231626767190472615; 0; False; 1580250698; #önemli #china #breaking #haber #gündem #coronavirus#sondakika #önemli #karantina #Wuhan #coronavirus #türkiye #tsk #hastalik #istanbul #cin #çin #coronavirus #salgın #virus #woman
2231627059859814906; 15; False; 1580250698; #LoÚltimo Panamá adelantará el regreso de estudiantes que se encuentran en China y habían culminado estudios, el 4 y 7 de febrero, ante el brote del nuevo #coronavirus. #TReporta
2231627034048874781; 0; False; 1580250694; No mames qué asco #ozzyosbourne #coronavirus #china
2231627025374621490; 0; False; 1580250693; Looks like my upcoming China trip will be called off. And I’m quite alright with that. No thank you #coronavirus Not worth it, no matter how exciting the project is. :face_with_medical_mask:.
2231627016415833313; 0; False; 1580250692; Allgemeines über Coronavirus, die Übertragungswege sowohl als die Symptome. #coronavirus #wuhan #coronavirusdeutschland #virus #gesundheit
2231626802890949874; 0; False; 1580250690; Атмосфера в китайском госпитале. Эпидемия принимает масштаб национальной катастрофы, просачиваются сведения о занижении реального количества больных китайскими властями!!!! #вирускитай#коронавирус#коронавирускитай#симптомыкоронавируса#эпидемиякитай#вводвойсккитай#блокировкагородов#эпидемиякоронавирусакитай#коронавирусшанхай#коронавирусухань#коронавирус2020#вирус2020китай#coronavirus#viruschina#coronaviruschina#coronavirus2020#viruschina#нетуедывкитае#сдаютнервыиззавируса#едынетувухани#пустойгородвирускитай#стройкабольницыухань#вкитаенельзябезмасок
2231626961620798988; 0; False; 1580250686; So much conflicting information out there. Here is the latest government information https://www.gov.uk/foreign-travel-advice/china #notjusttravellorrainerobinson #china #coronavirus #travel #advice #travelconsultant #travelagent
2231626933854803160; 4; False; 1580250683; NOT TODAY #coronavirus :oncoming_fist_light_skin_tone: Stay safe out there fam. Wash your hands and DON’T TOUCH YOUR FRESH PIERCINGS! @sacred_arts_tattoo_bradenton @coronavirusplague #coronavirus #coronavirusmemes #dankmemes #stayfrosty #sarasotaflorida #bradentonflorida #memesdaily #corona:beer_mug: #memelords
2231626868757819875; 0; False; 1580250675; #ncov2019 #coronavirus #mask #coronachan #ncov #vihan
2231626853350047927; 0; False; 1580250673; IcH wEiSs GaR nIcHt WaS aLlE hAbEn?! . . . #jura #juramemes #memes #goodlife #law #lawlife #uni #rechtsanwalt #rechtswissenschaften #bib #seminar #memegod #instalife #coronavirus #coronavirusmemes #coronavirusoutbreak #uzk #universitätzuköln #jurastudium
2231626826909127950; 1; False; 1580250670; Saat 01:32 29 Ocak Çarşamba 2020 . . . . . #corona #coronavirus #coronavirüsü #coronavirüs #coronavírus #coronavirusmemes #coronavirusoutbreak
2231626804274476231; 1; False; 1580250667; Xiaomi bueno y barato. #xiaomi #coronavirus #coronavirusmemes #datoscuriosos #dato
2231626573906212423; 0; False; 1580250662; Çinin uhan şəhərində həkimlərin şəhəri kütləvi tərk etməsi hıkim tibb işçisi çatışmamazlığına gətirib çıxarib və orduya əmr verilib ki tibbi persanal seferber edilsin #cin #çin #aztagram #baku #azerbaycan:Azerbaijan: #koronavirus #coronavirus
2231626755278381453; 2; False; 1580250661; Голь на выдумки хитра :flushed_face: Из-за дефицита масок в Китае люди включают фантазию. Годный лайфхак для тех, кто оказался в тяжелой ситуации, а выйти вынуждает необходимость...#coronavirus #коронавирус
2231626681641098164; 0; False; 1580250652; Coronavirus survival kit for women . . . #coronavirus #corona #survivalpack #doomsday #zombies #lololl #lol
2231616967004273720; 0; False; 1580250648; U.S. markets tumble as a flu-like virus in China kills over 80, infects thousands, and spreads to over 10 countires. https://tmsnrt.rs/2O1N6l5 #markets #tradingatnoon #coronavirus
2231626599642810216; 0; False; 1580250643; O #ministériodasaúde tem até o momento 03 casos suspeitos de #coronavirus. Os casos estão em investigação #enfermagem:red_heart: #enfermeiro #tecnicoemenfermagem #medicina #epidemiologia #oms #saudepublica #saudedafamilia #saudecoletiva #prevenção
2231626393249295035; 1; False; 1580250642; Ways to stop Pneumonia before it starts! ⁠ ⁠ Since most pneumonia's are related to viruses and bacteria, a big part of preventing pneumonia involves washing your hands regularly and keeping a distance from those who are ill.⁠ ⁠ Pneumonia feels terrible: intense coughing, fever and often chills, difficulty breathing and coughing up of phlegm. ⁠ ⁠ Pneumonia can develop from many causes but each type involves inflammation of the lungs which leads to fluid accumulation. ⁠ ⁠ Click the link in our bio to read more about how you can stop pneumonia before it starts! #BellLifestyle⁠ ⁠
2231626441954109507; 1; False; 1580250624; More and more cases racists against Chinese or Asian guys in Europe, because of the virus. Stop the racisme ! #jenesuispasunvirus #virus #coronavirus #racist #china #france
2231626361372595740; 0; False; 1580250623; Strange images continue to come from Wuhan, China, where the Corona Virus first appeared! A Chinese riding on the elevator spits on the keys of the elevator! #china #wuhan #changzhou #beijing #coronavirus #Corona #spread #quarantine #hubei #beijing #spread#hospital
2231626432216286901; 0; False; 1580250623; #Virus #coronavirus #corona
2231626407620760145; 0; False; 1580250620; I will survive :face_with_medical_mask::face_with_medical_mask::face_with_medical_mask::face_with_medical_mask: #coronavirusoutbreak #coronavirus
2231626311276540640; 0; False; 1580250612; Joint statement on first case of novel coronavirus in B.C.⠀ Letter to the Editor⠀ ⠀ Adrian Dix, Minister of Health, and Dr. Bonnie Henry, B.C.’s provincial health officer (PHO), have issued the following joint statement regarding a case of a novel #coronavirus (2019-nCoV).⠀ ⠀ Late yesterday (Jan. 27), our BC Centre for Disease Control public health lab confirmed a positive test for 2019-nCoV.⠀ ⠀ The person is a male in his forties and a resident in the Vancouver Coastal Health region. He travels regularly to China for work and was in Wuhan city on his most recent trip. He returned to Vancouver last week and had an onset of symptoms after his return.⠀ ⠀ On Sunday, Jan. 26, he followed public health messaging, contacted a primary health-care provider to notify them that he had travelled to Wuhan city, was experiencing symptoms and would be coming for assessment and care.⠀ ⠀ Following established protocols, the primary-care provider notified the Vancouver Coastal Health medical health officer and administered the diagnostic test.⠀ ⠀ Late last night, the test came back positive.⠀ ⠀ Public health officials are in regular contact with the individual and a small number of close contacts. He is in isolation at home.⠀ ⠀ ⠀ The risk of spread of this virus within British Columbia remains low at this time. All necessary precautions are being taken to prevent the spread of infection. We have multiple systems in place to prepare for, detect and respond, in order to prevent the spread of serious infectious diseases in the province.⠀ ⠀ The BC Centre for Disease Control has a team of experts that support the province’s operations in monitoring and controlling communicable and vaccine-preventable diseases. The team has developed a diagnostic test for this new coronavirus and is co-ordinating staff and supplies to ensure potential cases can be detected quickly and accurately.⠀ ⠀ For the full story go to our bio link @eknow.ca and link to our webpage or copy and paste link below⠀ ⠀ Adrian Dix, Minister of Health,⠀ ⠀ Dr. Bonnie Henry, B.C. Provincial Health Officer⠀ https://buff.ly/38JD9Aw
2231625934509957755; 0; False; 1580250605; O koronavirusu olmuş bir qadindir o virusla mübarizə aparir #cin #çin #aztagram #baku #azerbaycan:Azerbaijan: #koronavirus #coronavirus
2231626284367412019; 0; False; 1580250605; Matéria no site...Link na BIO #coronavirus #saúde #perigoasaude #novovirus
2231626252966875266; 1; False; 1580250601; Praying :folded_hands_medium_skin_tone: my Chinese food :takeout_box: doesn’t have #CoronaVirus :microbe:
2231625092287461793; 0; False; 1580250599; Personas que recorren las calles vestidas de blanco, ayudando a las personas ante la terrible afectación que ha causado el #Coronavirus . . . #NotiBien #NoticiasALoBien
2231624962044949595; 4; False; 1580250484; Corona virus :microbe: has spread everywhere. The agencies want to suppress the news to come out to avoid unnecessary public panic . According to the experts the number of infected people have reached around 90,000. Wait a week-2 the news will be out. #coronaviruses #virus #coronavirus #china #wuhan #china:China:
2231624042453078344; 1; False; 1580250338; in queste ore i giocatori hanno trovato delle connessioni "inquietanti" riguardanti Resident Evil ed il virus. Oltre all'ovvio collegamento della trama di Resident Evil che ruota generalmente attorno a epidemie virali, si è parlato della presunta esistenza di un laboratorio di ricerca biologica a Wuhan, in Cina, con un logo che assomiglia esattamente a quello dell'Umbrella Corporation, solo con un colore diverso. Per coloro che non hanno seguito la notizia, Wuhan è una delle città che è stata messa in quarantena dal governo cinese nel tentativo di evitare che la situazione del coronavirus diventi un'epidemia in piena regola. È una strana coincidenza che una società con il logo di Umbrella si troverebbe a Wuhan quando si considera ciò a cui la Umbrella Corporation è associata nell'universo di Resident Evil. I simpson hanno il simbolo della Massoneria nel cartone , e loro sapevano già come andava la storia !!!!Purtroppo anche di Kobe!!! Davvero sconvolgente tutto ciò c’è qualcosa di molto più grande di noi , e pericoloso !!!!
2231622797339965333; 1; False; 1580250189; Eu avisei. Já faz praticamente um mês do ocorrido entre EUA x Irã e — pasme — a terceira guerra mundial não aconteceu. O mundo não acabou. Bombas atômicas não explodiram. O céu não rompeu em chamas. A bolsa não derreteu. Não aconteceu absolutamente nada com o mundo ou com a economia. Mas algo trágico aconteceu no meio daquela confusão de notícias e discussões. Algo foi perdido. Algo que nunca mais poderá ser recuperado. Seu tempo. Quanto tempo e energia você desperdiçou logo nos primeiros dias do ano, discutindo o futuro do mundo como conhecemos? Quantas matérias com tons apocalípticos você leu no G1, na Folha ou na Exame? Quantos comentários fez a respeito sem entender — desculpe a sinceridade — merda nenhuma sobre geopolítica? Agora, por que estou falando isso? Só pelo prazer de esfregar na sua cara? Claro que não é (só) por isso. É para lhe advertir. Por que? Porque você está fazendo exatamente a mesma coisa agora, com o tal Coronavírus Chinês. Faça um favor a si mesmo: Pare com isso e vá fazer o que deve ser feito. O mundo não vai acabar. Aproveite melhor o seu tempo. Me agradeça depois.
2231601798053651113; 0; False; 1580247686; Virus ini bisa menyebabkan penyakit ringan (common cold, pilek) sampai berat (MERS & SARS). Lalu apa gejalanya? . . Demam >38 derajat celcius, batuk & sesak napas. Pada kasus yg lebih parah, infeksi dpt menyebabkan pneumonia, sindrom pernapasan akut, gagal ginjal, bahkan kematian. . . #corona #coronavirus #farmasi #apoteker #farmasis #farmasidruggist #penyakit #virus #indonesia #obat #rumahsakit #klinik #puskesmas #apotek #farmasimuda #iai #pafi #ismafarsi #aomki #farmakologi
2231601517546989282; 0; False; 1580247653; Hi #Healthies, Taukah kamu Novel Coronavirus (2019-nCoV) merupakan virus jenis baru yg masih satu keluarga dengan SARS & MERS. Virus ini menjadi penyebab wabah Penumonia di Tiongkok, belum diketahui secara jelas bagaimana penularannya namun diduga berasal dari pasar hewan Huanan. . #corona #coronavirus #farmasi #apoteker #farmasis #farmasidruggist #penyakit #virus #indonesia #obat #rumahsakit #klinik #puskesmas #apotek #farmasimuda #iai #pafi #ismafarsi #aomki #farmakologi
2231591422737536989; 0; False; 1580246449; #wilmingtonnc #news #coronavirus #pigs #butterfly
2231587624469262518; 0; False; 1580245997; . . . . . #memes #funny #meme #lustig #witzig #funnymemes #dankmemes #schwarzerhumor #blackhumor #coronavirus
2231439271416214484; 3; False; 1580228340; Vídeo completo disponível no IG @karinekkoller • • • • • • :right_arrow: TRANSCRIÇÃO :down_arrow: . . "Bom dia! Estou aproveitando a visita do Dr. Renato Slomka aqui no consultório para passar uma mensagem de grande utilidade pública relativa à questão dessa epidemia do coronavirus que surgiu na China e está se espalhando rapidamente pelo globo terrestre. . Por que essa epidemia, e outras que a antecederam, como o ebola, H1N1, recentemente no Brasil a epidemia do sarampo, por que essas epidemias estão se alastrando rapidamente, rapidamente se transformam em epidemia? Porque a população mundial está deficiente de uma substância extremamente importante para o nosso organismo, que é chamada infelizmente de vitamina, e por isso é pouco valorizada, que é a vitamina D, e que na realidade é muito mais do que uma vitamina. Ela não é uma vitamina. Ela, na realidade, tem a estrutura e o poder de um hormônio, mas ao contrário de um hormônio ela tem 80 funções diferentes no nosso organismo. Ao contrário do que acontece com as vitaminas, ela é produzida no nosso organismo quando a nossa pele entra em contato direto com o sol sem interferência de vidros, sem interferência de filtro solar ou de roupas, e bastam poucos minutos de exposição solar sob sol forte, que em geral é o período desaconselhado pelos dermatologistas. . Uma das mais importantes funções da assim chamada vitamina D no nosso organismo é a de potencializar a nossa imunidade, é de regular e potencializar a nossa imunidade, impedindo que o nosso sistema imunológico faça o que não deve, que é agredir a nós mesmos, e deixe de fazer o que deve, que é defender a nós mesmos. Ela é a grande potencializadora da chamada imunidade inata. Imunidade inata é a que já está presente e em atividade no bebê, no momento em que ele nasce. Por isso é chamada de inata. A vitamina D potencializa de uma forma extremamente eficaz a imunidade inata. . Nós não temos vacina contra o coronavirus. Nós só contamos com a imunidade inata. E a única forma que nós temos (forma eficiente) de potencializar a imunidade inata é através da correção da deficiência da vitamina D, que é uma pandemia mundial. :down_arrow: CONTINUA :down_arrow::down_arrow::down_arrow:
2230945215942084242; 0; False; 1580169415; 8========3 . . . . #fckit #focc #die #coronavirus e #meme #broccolibutts #slutelf #porn #ceo #lyfe #eee #foryou #edit #femboy
2231626246507309957; 0; False; 1580250601; Literal los Colombianos . . . #poker #cervezapoker #amigosputos #amigos #memes4life #memes #momos #momos4k #colombianas #colombia #colombia:Colombia: #findesemana #cerveza #bavaria #quegonorrea #borrachos #chistes #amigosborrachos #conanimodeofender #corona #coronavirus
2231624722097782036; 1; False; 1580250597; Ahora, un video muestra cadáveres amontonados en un hospital de China a causa del coronavirus, o al menos eso dice la narración. El clip, verificado por Storyful, una agencia de inteligencia de social media, ha sido difundido en redes sociales y en algunos medios de comunicación. . De acuerdo con el New York Post, las imágenes fueron captadas en el hospital de la Cruz Roja de Wuhan, la ciudad china donde el brote comenzó. Mientras una mujer no identificada hace la narración, se observan cuerpos inertes en los pasillos de las instalaciones. . Debido a la facilidad con que el virus se ha diseminado en Wuhan, las autoridades chinas anunciaron la construcción de un hospital de mil camas para atender a los infectados por esta nueva versión de coronavirus. El brote causa una especie de neumonía viral y ya ha cobrado casi 30 vidas. . Video: Cortesía . Para conocer esta y otras noticias ingresa a nuestro sitio web www.cnve24.com.ve :mobile_phone_with_arrow: #28Ene #China #Coronavirus
2231626127389295451; 1; False; 1580250595; #coronavirus #asians #tasty
2231626182250862471; 0; False; 1580250593; :newspaper: Coronavírus: Miami International Airport vai ganhar um posto do Centers for Disease Control and Prevention (CDC) para conter o avanço do vírus no País. No posto, serão avaliados pacientes com suspeita da doença, bem como encaminhados para exames e tratamento. Até o momento, cinco casos de coronavírus foram identificados nos EUA, nenhum na Flórida. :newspaper: Saiba mais acessando o site do jornal, www.acheiusa.com (link na bio) ou nos stories. . #AcheiUSA #PontodeEncontro dos #BrasileirosnaAmerica #JornalnosEUA #NoticiasdosEUA #RadioAcheiUSA #AcheiUSAtv #GuiaBrasileironosEUA #DicasEUA #AcheinosEUA #Coronavirus #MIA #MiamiInternationalAirport #MiamiAirport #AeroportodeMiami #CentersforDiseaseControl #ViajarParaosEUA #BrasileirosemMiami #BrasileirosemNY #BrasileirosnaCalifornia #BrasileirosnaFlorida #BrasileirosnosEUA #BrasileirosnoMundo #BrasileirosnoExterior
2231626177519779612; 4; False; 1580250592; Keep your germ carrying kids at home only when a vaccine is available. :squinting_face_with_tongue: #coronavirus #vaccinelogic
2231626090951374557; 0; False; 1580250582; In recent news, the #coronavirus outbreak is spreading to other countries. The death toll has risen to 106 in China, with more than 4,500 cases of infection. Germany reported 3 new cases late Tuesday, and stated that they’re all connected to the country’s first patient, A 33 year-old man who was most likely infected by a Chinese business visitor from Shanghai. Several countries such as the United States, France, Canada, Britain, and South Korea, are implementing plans to evacuate their citizens from the #coronavirus outbreak epicenter in #wuhan . Follow for more updates about the coronavirus and daily news content!
2231626085247068344; 0; False; 1580250581; La vitamina c es la ayuda ideal para prevenir el #coronavirus Los coronavirus son una extensa familia de virus, algunos de los cuales puede ser causa de diversas enfermedades humanas, que van desde el resfriado común hasta el SRAS (síndrome respiratorio agudo severo). Definición sacada de la OMS #coronavirus #coronavirusmemes #saludmedellín #prevencion #vitaminac #sueroterapia
2231626033755582714; 0; False; 1580250575; 2021 will be their year #2020 #fire #australia #flood #coronavirus #landdownunder
2231625945232522449; 0; False; 1580250565; #coronavirus #VirBiotechnologies #Charts #Whuan Companies heavily affected by the coronavirus. Nice trade by Lym. Better stay away from these loose mines.
2231625928354009892; 0; False; 1580250563; Seorang sopir wisata di Jepang positif terkena virus Corona pdhl ia tdk prnh berkunjung ke Wuhan, China. Awal blm ini ia menjadi pemandu wisata bagi wisatawan dr China apakah ini membuktikan bahwa virus Corona bisa tertular dr manusia ke manusia? Kalau iya benar2 mengerikan. Bahkan pakar dr China menyebutkan virus Corona bisa menular melalui kontak mata. Sementara pakar dr AS mengatakan jika virus Corona menjadi pandemi akan mengakibatkan 65 juta orang tewas hny dlm 18 bln saja. Korban tewas akibat virus ini terus bertambah menjadi 106 jiwa dan ribuan lainnya semakin bnyk yg terinfeksi. Negara yg tertular jg semakin bertambah total menjadi 16 negara. Bagaimana dgn Indonesia? Suspect (diduga) virus Corona bertambah stlh sblmnya Jakarta, Jambi dan Manado kali ini Bandung dgn 2 suspect virus Corona salah satunya warga China sama seperti suspect yg di Jambi warga China jg, kemudian Tasikmalaya, Sidoarjo dan Lombok. Di Lombok pun seorang balita warga negara China. Wajar jika Indonesia perlu menolak untuk sementara kedatangan wisatawan/warga/pekerja dr China ke Indonesia guna mengantisipasi penyebaran virus Corona di Indonesia bkn seperti di Sumbar mereka di sambut meriah seperti kedatangan kepala negara mskpn Pemda Sumbar berdalih bahwa wisatawan China tsb tlh dijamin bebas dr virus Corona tp masa inkubasi virus ini terjadi bbrp hr bahkan bbrp Minggu. Bisa jd hari ini sdh tertular virus namun blm terlihat gejalanya tp virusnya sdh menyebar tanpa disadari. #viruscorona #coronavirus
2231625033533374107; 0; False; 1580250562; #health #coronavirus #chine #santé #protection #takecareofyourself #siwaradvices #صحة# فيروس
2231625924008611690; 0; False; 1580250562; #hazmat #wuhan #coronavirus
2231623903025604345; 2; False; 1580250561; . . .لطفاً اطلاع رسانى كنيد . . . . . :red_circle:اینجا ارزانتر ماشین بخر:red_circle: . . . آگهى خودرو هاى داخلى در استورى درج ميشود! و همچنين اطلاعات عمومى مربوط به بازار خودرو نيز در استورى درج ميشود! پس استورى ها را چك كنيد. . . . . . . . :red_triangle_pointed_up:در صورتى كه درخواست خريد خودرو داريد مشخصات خودرو مورد نظر و شماره خودتون رو در دايركت و ارسال كنيد تا با شماره خودتان آگهى خريد درج كنيم:red_triangle_pointed_up: . . . . :red_triangle_pointed_up: همچنين كليه خودرو هاى موجود در صفحه ما ،در صورت تمايل مشترى،توسط كارشناسان مجموعه ما كارشناسى خواهد شد و سپس تاييديه خريد، با ارائه برگه كارشناسى،خدمت شما داده خواهد شد:red_triangle_pointed_up: مارا دنبال كنيد:folded_hands: تماس:٠٩١٢١٥٠٨١٦٠ .. . . #كرونا # چين #corona #china #ويروس_كرونا #coronavirus #کرونا پست_موقت #بيمارى #درمان #مرگ #مريضى #پيشگيرى #دارو #بيمار #قرنطينه #sick #chinesecorona #chinesenewyear #chinese #iran #prayforiran
2231625915662528541; 0; False; 1580250561; Alguém mais preocupado? #coronavirus #medo #brasil #china #epidemia #preocupado #assustador #jairbolsonaro #brasilia #distritofederal
2231625880271138135; 0; False; 1580250557; In seguito all’aumento di casi di persone colpite da #coronavirus, la Francia ha richiesto l’attivazione del Meccanismo europeo di Protezione civile. Due aerei verranno mobilitati per il rimpatrio di cittadini europei che si trovano nell’area di Wuhan :backhand_index_pointing_right: https://t.co/AQsTVqnTok Tratto da: Commissione europea - Rappresentanza in Italia.
2231625813480183499; 0; False; 1580250557; People are not just barricading themselves inside #Wuhan, they are also trying to escape the quarantine zone, in this video they are repelled by police. How many have made it out? #biohazard #virus #ww3 #iranvsusa #donaldtrump #coronavirus #viruskorona #indonesia #china #wuhan
2231625866126144128; 0; False; 1580250555; At least have some consistent beliefs :smirking_face::face_with_tears_of_joy: #coronavirus #hongkong #hongkongers #coronavirusmemes Art cred: jake-clark.tumblr
2231625854490806343; 12; False; 1580250554; Appeared on @cbc @pnpcbc to discuss #coronavirus 2020 vs. #SARS in 2003
2231625580135350843; 3; False; 1580250554; The situation in instead of #wuhan escalates more and more among the residents ... . . #china #coronavirus . . @dali.islam @dali.islam
2231625797238777657; 3; False; 1580250553; The Chinese are doing everything they can to infect the Corona Virus, a Courier in Wuhan spits it in before they deliver the order! #china #wuhan #changzhou #beijing #coronavirus #Corona #spread #quarantine #hubei #beijing #spread#hospital
2231625821492345356; 0; False; 1580250550; La principal exportación del país cedió nuevamente, pese a una recuperación de los mercados. Incertidumbre en China por coronavirus sigue impactando en su precio. ⠀ #chile #coronavirus #cobre #exportaciones #economia #incertidumbre #inversiones #negocios #empresarios #chileanentrepreneur #emprendedores #emprende
2231625789807716410; 3; False; 1580250546; The Miami OH at Central Michigan game at 7:00 PM EST tonight has been postponed due to concerns about two potential coronavirus infections at Miami University. The Miami women’s team was also scheduled to play today, and their game is postponed as well. #collegefootball #collegebasketball #highschoolfootball #ncaafootball #ncaabasketball #nfl #football #basketball #nba #cfb #ncaa #cfbnews #cfbplayoff #marchmadness #cbb #finalfour #sportsnews #breakingnews #coronavirus #miamiuniversity
2231625773668024032; 1; False; 1580250544; Coronavírus: o vírus penetra no organismo através do nariz e da boca e atinge o sistema respiratório. Há transmissão de pessoa a pessoa pelas gotículas de saliva. Os sintomas são tosse, nariz escorrendo, dor de garganta e febre. Na evolução da doença há dificuldade para respirar e falta de ar porque esse vírus causa uma pneumonia e edema pulmonar, ou seja, acúmulo de líquido nos pulmões dificultando a chegada de oxigênio no sangue. Em casos suspeitos consultem seu médico o mais breve possível #coronavirus #imunidade #alergiacuritiba #pneumonia
2231624878897008122; 1; False; 1580250541; Un taxista chino echa a un pasajero que tosía dentro de su coche y llama a la Policía para denunciarle. ⠀⠀⠀⠀⠀⠀ ⠀⠀⠀ ⠀⠀⠀⠀⠀⠀ ⠀⠀⠀⠀⠀⠀ ⠀⠀⠀⠀⠀⠀ ⠀⠀⠀ ⠀⠀⠀⠀⠀⠀ ⠀⠀⠀ ⠀⠀⠀⠀⠀⠀ ⠀⠀⠀⠀⠀⠀ ⠀⠀⠀⠀⠀⠀ ⠀⠀⠀ ⠀⠀⠀⠀⠀⠀ ⠀⠀⠀⠀⠀⠀ ⠀⠀⠀ ••••••••••••••••••••••••••••••••••••••••••••••••••••••••••••••• ⠀ @doblemoralrd noticias #actualidad #internacional #republicadominicana #view #alerta #novedad #viral #rd #dominicannetflix #doblemoralrd #dominicana #jamaica #japon #jamaica #japon #franklinmirabal #licey #cuba #haiti #toros #faride #miami #angelestevez #hanley #bonilla #pujeazul #seriefinallidom2020 #coronavirus #wuhan #china #eñidemia
2231625712935062815; 0; False; 1580250537; If only people would leave animals alone... #coronavirus #govegan
2231625689405330049; 0; False; 1580250534; Another picture of the GOAT setup?!?!? @powellperaltadh @aeratrucks @conegloves @riptidesports #powellperaltadh #powellperalta #aeratrucks #aerak5 #downhill #skateboard #longboard #goskate #santabarbara #california #hashtag #vroom #skrrt #liluzi #SoundCloud #conegloves #samurai #coronavirus
2231625687845061757; 0; False; 1580250534; #preventivecheckup #flir #coronavirus #bier
2231625661563133226; 2; False; 1580250531; It's over. Hide yo kids, hide yo wife. #baruch #nyc #overheardbaruch #coronavirus #nottheothercorona #welovecorona
2231625664833615573; 0; False; 1580250531; Rah and the first mutation was pneumonia it’s a sign #coronavirus #coronavirusoutbreak #meme #deadmemes #plagueincmemes also is it too soon to start posting memes about Kobe :broken_heart:
2231623869848093390; 0; False; 1580250530; Credit to @therightpolitics.uk Stay tuned:medical_symbol: J:man_guard_light_skin_tone: #coronavirus #wuhan #cdc #disaster #prepper #shtf #Ebola #aids #meme #china #un #news #disease #health #medicine #doctor #china #zombieoutbreak #virus #nurse #pandemic #plague #epidemic #outbreak #zombie #disaster #trump #maga #kag2020 #china #virus #medschool #doomer
2231624756170673525; 0; False; 1580250525; What you need to know about the coronavirus. #health #coronavirus #wkyc #wkyc3 #3news
2231625601677041153; 0; False; 1580250524; I hate drawing hands :grinning_face_with_sweat: #hand #corona #coronavirus #mindcontrol #marionette #puppeteer #blackandwhite #art #fancy #illustration #followforfollowback #likeifyoulike
2231625570723397380; 0; False; 1580250520; Going to the movies be like "this style is so hot I'm gonna rock it all 2020" #coronavirus
2231625452317102067; 0; False; 1580250506; #Repost @cienciausp • • • • • • Coronavirus: conversamos com um virologista da USP especialista neste grupo. Acesse as stories do @cienciausp para ter respostas sobre as principais dúvidas: de onde ele veio, o que causa, quão mortal ele é de verdade, se há tratamento, quanto falta para uma vacina. ⠀ Fique de olho :eyes: que vamos continuar a trazer informações atualizadas. E confiáveis! ⠀ Na imagem, Paulo Brandão/FMVZ, primeiro entrevistado da série. ⠀ Foto e reportagem: Luiza Caires ⠀ #usp #pesquisa #ciência #ciências #ciencia #ciencias #coronavirus #epidemia #virose #saúde #doenca #virus #china #FMVZ #vacina #genetica #genética #genoma #morcego #biologia
2231625417228504128; 0; False; 1580250502; #munich #bayern @coronaviruss #coronavirus
2231625296784635133; 0; False; 1580250500; RUN :face_with_tears_of_joy::face_with_tears_of_joy::face_with_tears_of_joy::face_with_tears_of_joy::face_with_tears_of_joy: #weebmemes #wholesomememes #oof #nicememes #normiememes #memes #funny #stupidmemes #qualitymemes #funnymemes #memesdaily #memes:face_with_tears_of_joy: #memestagram #dankmemes#memes:face_with_tears_of_joy: #memes #memesdaily #funnymemes #funny #funnyvideos #follow #followtrain #followforfollowback #followforfollowback #followbackinstantly #followfollow #follow4followback #dankmemes #dankmemesdaily #cancerousmemesforautisticmemes #canceroursmemes #deepfriedmemes #coronavirusmemes #coronavirus #tiktokmemes #explore #viral
2231625404266074287; 0; False; 1580250500; :mouse: #coronavirus #memes #memes:face_with_tears_of_joy:
2231623520245095689; 0; False; 1580250490; Damn the mosquitos also getting affected by the Corona virus . . . . . . #mosquito#corona#coronavirus#feeling#lol#lmao#memez#meme#memes#wtf#2020ishorrible
2231625294646000969; 0; False; 1580250487; Coronaviruses, TEM Coronaviruses are among the largest RNA viruses. They have a viral single-stranded RNA molecule that forms the protein complex together with a capsid protein. Coronaviruses produce respiratory and gastrointestinal diseases in humans and animals. About 25% of banal respiratory diseases in humans are caused by coronaviruses. The novel coronavirus (2019-nCoV), like the SARS virus, belongs to the beta-coronaviruses. Transmission electron micrograph. Magnification: 24,000x (when 15cm wide). :copyright: Eye of Science / Science Source #eyeofscience #coronavirus #virus #viral #china #chinavirus #chinanews #virology #biology #infection #outbreak #outbreaks #disease #sars #commoncold #gastroenteritis #microbiology #microscopy #tem #ncov #trypophobia #transmissionelectronmicroscopy #sciart #scienceart #stockphoto #stockphotography #wuhanvirus #wuhanvirusoutbreak #wuhancoronavirus
2231625200877819847; 2; False; 1580250476; You might be next.... Major oof . . . #bigalcoholexposed #dankmemes #dankmemesdaily #alcohol #bigmemes #nicememes #snacc #pornmeme #pandemic #china #wtf #coronavirus
2231625158364466323; 0; False; 1580250471; #coronavirus #Novavax #Charts #tradingCompanies heavily affected by the coronavirus. Nice trade by Lym. Better stay away from these loose mines.
2231625158573352865; 0; False; 1580250471; Olha onde começou esse vírus ... . . . . #coronavirus #viruschina #chinavirus
2231625121278667485; 5; False; 1580250466; #coronavirus
2231624959543906674; 1; False; 1580250456; Strange images continue to come from the city of Wuhan, China. A person who cannot take medicine at the hospital he goes to takes off his mask and coughs over the hospital staff! #china #wuhan #changzhou #beijing #coronavirus #Corona #spread #quarantine #hubei #beijing #spread#hospital
2231625014096823116; 3; False; 1580250454; Oh no. . . . #memesargentina #memesargentinos #memes #meme #polandball #countryball #countryballs #history #historymemes #countryhumans #polandball #geography #politics #politicalmemes #iran #iranmemes #china #coronavirus #school #schoolmemes
2231624926928930743; 0; False; 1580250443; Key questions answered on #coronavirus
2231624911302783499; 1; False; 1580250441; The truth https://youtu.be/7OEqybiGdaA #coronachan #corona #coronavirus #coronavirusoutbreak
2231624860274378512; 0; False; 1580250435; :United_States: :China:Estados Unidos le pide a China más transparencia sobre el #coronavirus pero insiste en que el riesgo es bajo. El secretario de Salud, Alex Azar, anunció que de momento no ha habido contagio en los cinco casos de coronavirus registrados en Estados Unidos y pidió a China más cooperación y transparencia sobre el nivel de propagación para que se pueda determinar el grado de gravedad de la epidemia después de que se disparara el número de muertos. "Es importante que el país sepa que es una amenaza potencial grave para la salud pero aún no conocemos lo que tenemos que saber del virus, pero eso no quita que no nos tengamos que preparar", señaló el secretario de salud, quien recomendó a los estadounidenses que eviten los viajes no esenciales a China. Azar señaló que el hecho de que haya más de 100 muertos en China es "grave" pero recalcó que la mayoría de las víctimas eran personas de edad y con su salud comprometida. #SoyPuntoCero #SiempreConLaVerdad!
2231624621115799374; 0; False; 1580250433; #sanitize #coronavirus #aintgottimetobesick
2231624843093491694; 0; False; 1580250433; #NoticiaNeI . Las afectaciones económicas del coronavirus . El coronavirus no solo amenaza la salud de cientos de asiáticos y de otras partes de la población, sino, la economía mundial al atacar a una de las más grandes potencias mundiales. Aunque es muy pronto para dar una evaluación final sobre las afectaciones que el virus tendría en China, se prevé una fragilidad en cuanto en la primera fase de lo que sería el acuerdo entre Estados Unidos y China, y las señales de un cambio tecnológico. Según el diario Portafolio, las industrias en esta zona, también se verían seriamente afectadas, cuando las fábricas normalmente volverían a las plenas operaciones después las ferias del Año Nuevo Lunar, pues los dueños de estas industrias están protegiendo a sus empleados para evitar el contagio. Otros de los puntos a analizar es el impacto que de igual manera tendrían los países que dependen de la demanda del país asiático. Bloomberg Economis dice que los países vecinos en Asia y los exportadores de productos básicos se enfrentan al mayor impacto. Grandes empresas como Honda Motor Co; Nissan Motor Co. Son algunas de las que más están evacuando a sus empleados, para protegerlos del virus. Mientras otras empresas más pequeñas de comercio, como restaurantes, cines y demás, toman la decisión de cerrar y suspender su operación para evitar transmisiones del coronavirus. Los comerciantes de este tipo de empresas, grandes o pequeñas se muestran preocupados por los impactos que pueda llegar a generar la llegada de esta epidemia a las zonas de su país, ya que el 60% de los contagios se centran en China. Aunque esperan que pueda ser controlado y exista una disminución ante su rápido crecimiento. . Lea la nota completa, ingresando a nuestro sitio web. . . #noticias #actualidad #informacion #coronavirus #china #enfermedad #economía #afectacion
2231624817912332763; 0; False; 1580250430; #coronavirus #coronovirusoutbreak
2231624691496317682; 73; False; 1580250415; Ich weiß, das hier will keiner sehen, keiner hören. Die freudigen, lustigen Posts und Ablenkungen hier sind durchaus willkommener. Und das kann ich verstehen. In dieser verrückten Welt wird man ja bald wahnsinnig, wenn man sich wirklich mit der nackten Realität beschäftigt. Ich bin kurz vorm Wahnsinn. Es macht mir Angst, zu sehen dass wir alle vor uns hinleben, Geld immer noch mehr wert ist als jedes Menschenleben und erst recht als jedes Tierleben. Wir haben nichts gelernt. Es wiederholt sich so Vieles, ich bekomme Gänsehaut. Wann wird der Mensch aus seinen Fehlern lernen? So viele lebensbedrohende Viren konnten sich nur verbreiten, weil der Mensch achtlos und arrogant durch die Welt marschiert und alles niedermetzelt, was ihm über den Weg läuft. Weil er eine Neugierde hat auf alles, was exotisch und anders ist. Und anstatt sich dieser Vielfalt und Exotic zu ergötzen, sie zu genießen, zerstören wir sie! Täglich, unachtsam, barbarisch! Der Coronavirus verbreitet sich gerade rasend schnell in Asien und sowohl in Europa als auch in den USA sind inzwischen Fälle bekannt. Wenn ihr wissen möchtet wo der Virus herkommt, macht euch bitte schlau. Es ist die Perversität der Menschen, die für dieses Unheil verantwortlich ist. Und es ist nicht das erste Mal! Das kann doch so nicht weitergehen!!! Bitte lasst uns was ändern und laut werden! Wir richten uns selbst zu Grunde! Warum????? Ich habe Angst um die Zukunft meiner Kinder und fühle mich manchmal schuldig, weil ich sie in diese verrückte Welt geboren habe. Und das ist traurig, denn diese Welt hat so viel Schönes zu bieten! Es fällt mir allerdings inzwischen oft schwer, diese Schönheit zu genießen. Schaut ruhig mal auf @karmagawa vorbei. Ich weiß, dass dieser Post nicht jedem schmecken wird, aber ich muss meine Gedanken teilen. Sonst werde ich verrückt. Es macht Angst und ich bin kein Fan von Angstmacherei, aber wir können unsere Augen nicht verschließen:loudly_crying_face::loudly_crying_face: #why #whenwillwelearn #sad #traurig #verwirrt #wütend #sad #mad #confused #coronavirus.
2231624327280027239; 1; False; 1580250415; #Repost @protocolocoimbra_brasil (@get_repost) ・・・ UTILIDADE PÚBLICA: Mensagem do Dr. Cícero Coimbra sobre o CORONAVÍRUS.- #protocolocoimbra #coronavirus #vitaminad #protocolocoimbrabrasil #protocolocoimbra #esclerosemúltipla #esclerosemultipla #vitaminad #vitaminad3 #altasdosesvitaminad #altasdosesdevitaminad #autoimunidade #doencasautoimunes #livroesclerosemultiplaemuitavitaminad #artritereumatoide #lupus #dermatiteatopica #doencadelyme #neuromieliteoptica #miasteniagravis #miosite #esclerosemultiplabrasil #psoriase #medicinapreventiva #protocolocoimbrabrasil #virus
2231624626022994073; 0; False; 1580250407; Scripps Ranch Mercy Hospital Arizona and 4 other places in the U.S with cases of the virus ,y'all better get supplements stop making bad health decisions eat yo damn greens ,use home remedies ,make an escape plan but DO NOT be in fear ,feel empowered in fact that you know what's going :raised_fist_medium-light_skin_tone: So take action ,tell your peeps to be careful ,stay inside eat from home don't get no new flu vaccine or any vaccine if you eat right you won't get sick . Remember don't fear it .Just prepare and be Aware . #scrippsranch #sandiego #california #wuhan #china #coronavirus #sandiegouniontribune #kobebryanthelicoptercrash #distraction
2231624595858171572; 0; False; 1580250404; What are yinz so worried about?! :man_shrugging_medium_skin_tone:#4theluvofmemes #memes #coronavirus #influenza #fluseason #dankmemes #crudehumor
2231624577637146941; 0; False; 1580250402; Different views around China, the effects of pandemic prevention obvious. No actual curfew, but travelling to work is a lonely journey on what is typically a very crowded bus, and the parks that are usually bustling with crowds exercising in the evening are abandoned. #publichealth #pandemic #coronavirus #signofthetimes #prevention
2231624472134155485; 3; False; 1580250401; #virus #coronavirus
2231624557553376016; 0; False; 1580250399; Shock Monkey Radio is live at 6pm Eastern on fxbgpublicradio.com !!! #podcast #podcasts #podcaster #breakup #badbreakup #kobebryant #helicopter #joerogan #powerfuljre #oprah #newsworthknowing #coronavirus #antisemitism #baconpatch #tinder #serialpooper #moose
2231624518119845086; 0; False; 1580250395; El coronavirus de Wuhan, China :face_with_medical_mask::globe_showing_Europe-Africa: Si no has estado al tanto de lo ocurrido en la última semana, estos son los datos más recientes: Repost from @pictoline #coronavirus #wuhan #china #salud #virus
2231624502364948240; 0; False; 1580250393; O CORONAVÍRUS na China vem causando doença pulmonar grave em centenas de pessoas, e já foi detectado em outro cinco países. O vírus causa febre, tosse, falta de ar e dificuldade em respirar. Pesquisadores de Londres calculam que a taxa de transmissão da doença de uma pessoa infectada é de infectar mais 3 pessoas. Prevenção: Evitar contato com pessoas que apresentam infecções respiratórias, lavar bem as mãos, higienizar as mãos com álcool, evite compartilhamento de objetos pessoais, evite contato com animais doentes, cozinhe bem ovos e carnes. Fonte: G1 e Brasil Escola Uol #coronavirus #doencarespiratoria #arapongas #alcool #alcoolemgel #mascaradescartavel #cuidese #previnase #saude #bemestar
2231624492658996084; 0; False; 1580250392; 𝐈𝐍𝐅𝐎́𝐑𝐌𝐀𝐓𝐄 | Te invitamos a conocer más sobre el #Coronavirus y a mantenerte informado por los canales oficiales. No extiendas rumores, no existen hasta ahora casos confirmados en Ecuador. #QuitoSaludableOtraVez
2231624441759277116; 0; False; 1580250385; #önemli #china #breaking #haber #gündem #coronavirus#sondakika #önemli #karantina #Wuhan #coronavirus #türkiye #tsk #hastalik #istanbul #cin #çin #coronavirus #salgın #virus #woman
2231624427213202662; 0; False; 1580250384; #coronavirus #Inovio #Whuan #Charts Companies heavily affected by the coronavirus. Nice trade by Lym. Better stay away from these loose mines.
2231624393155326923; 8; False; 1580250380; CORRIDA CONTRA O TEMPO. As biofarmacêuticas americanas estão correndo contra o tempo para desenvolver um tratamento contra o coronavírus — que já contaminou quase cinco mil pessoas em 15 países e matou mais de 100. Pelo menos quatro empresas listadas na Nasdaq anunciaram publicamente que estão trabalhando em vacinas ou tratamentos para os pacientes já infectados pela nova cepa do vírus, que está sendo chamada de ‘2019-nCoV’. A que parece estar em estágio mais avançado é a Moderna, uma empresa de biotecnologia de Massachusetts. Mais detalhes, no Brazil Journal. Link na bio. #coronavirus #saude #biotecnologia #braziljournal #china
2231623632309421520; 0; False; 1580250374; :film_projector: Video #ANSA . . :globe_showing_Europe-Africa: #Coronavirus, le immagini della citta' fantasma di #Wuhan . . Un drone mostra come la citta' cinese sia quasi completamente deserta . . :pushpin: Segui gli aggiornamenti sul canale #telegram @notizieansa (https://ift.tt/2Qn3PSO) . . #telegiornale #news #notizie #videogiornale #italia #notizia #quotidiano #articolo #video #spettacolo #like #giornalismo #stampa #giornaleonline #videospettacolari
2231623410671677035; 1; False; 1580250374; Con la participación de un conglomerado grupo de asistentes a la charla sobre “Coronavirus” el Dr. José Manuel Barboza, especialista en el área de Inmunología, compartió información de importante valor, acerca de dicha patología, resaltando aspectos generales cómo su procedencia, síntomas, comparaciones con el H1N1 y mecanismos a tener en cuenta para la prevención del mismo. Recordamos a todo nuestro personal IAHULA lo importante que resulta la prevención y cuidado a la hora de atender pacientes, lavar bien las manos y utilizar tapa bocas siempre y cuando tengamos contacto directo con pacientes que presentes algún síntoma cómo: · Secreción y goteo nasal. · Tos. · Fatiga. · Dolor de garganta y de cabeza. · Fiebre. · Escalofríos y malestar general. · Dificultad para respirar (disnea). Desde el Instituto Autónomo Hospital Universitario De Los Andes estamos atentos ante cualquier eventualidad y siempre listos para atender de la mejor manera posible los casos que puedan presentarse. Gracias a todos los asistentes, continuemos trabajando por la formación y preparación de la población merideña y personal del hospital. #iahula #venezuela #meridave #merida #coronavirus
2231624343979524476; 0; False; 1580250374; Trying to catch the coronavirus out on my walk today...but all I caught were these pics :man_shrugging: #tempe #asu #tempetownlake #coronavirus #bridges #millave #purdyday #lunchbreak #walks
2231624085207824731; 5; False; 1580250358; #Coronavirus yüzünden ağır nöbetler geçiren bir hasta. . . . . #corona #vuhan #wuhan #çin #china #virus #wuhancoronavirus
2231624165740474184; 0; False; 1580250353; Désolé mais tout le monde parle de #coronavirus c pas de leur faute #stop #:stop_sign: mtn chaque #jour jvois des #asiatique je traine avec eux sont comme nous ils ont leur goût on a le notre mtn arrêter de dire les #chinois chez pas quoi :face_without_mouth: la jvois des gens qui les regarde bizarrement dans les #transports et tt, et #aussi pour les gens qui disent #bienfaits pour #eux sa #hagar les #musulman #allah les #punit mais c pas de leur faute c l’état qui font ça c t’es d’accord :thumbs_up: avec moi #partage ce #message #et cette #video
2231624127135618368; 0; False; 1580250348; #ugh #sore #sick #sickness #fever #throat #coronavirus #virus #pigeons #trump #presidentrump #ticker #type #tv #foxnews #streetphoto #streetphotography #streetphotographers #nyc
2231624087944561429; 0; False; 1580250343; As the Flu continues to rapidly spread, many of our clients have opted to use our solutions, CALL NOW FOR DETAILS. #healthylifestyle #health #healthyliving #healthtips #tipoftheday #healthyeating #flu #coronavirus #virus #cdc #protectyourself #insta #la #lalifestyle #cleaneating #crossfit #stayhealthy #
2231624064347492640; 0; False; 1580250340; the world is dying from the deadly virus :skull: coronavirus :microbe: that has five symptoms and is very contagious. The common flu roughly kills 35 000 people a day and hospitalises 20 000 in the United States alone. The coronavirus- affected people in Australia are very low,but don’t have big hopes on you not getting it and touch things or surfaces before washing your hands,touch your nose, touch your mouth, touch your ear or wipe your eyes. The coronavirus has killed 106 people and infected 4515 people. To stay away from this deadly virus that kills you, try not going out and eat at restaurants (people might be affected), always take hand sanitizers with you (to decrease chance of getting virus). If you use lifts , avoid touching the buttons with your bare hands and use gloves. Hopefully everyone that views this is safe from coronavirus #foryou #coronavirus
2231623960678758940; 1; False; 1580250328; When movies become reality.. I cant be the only one thinking its strange that this lab has the same logo as Umbrella from Resident Evil #umbrellacorporation #residentevil #billandmelindagatesfoundation #coronavirus
2231623869880587418; 3; False; 1580250317; Fica o ALERTA!!!!#coronavirus #china#surto
2231623773092642580; 0; False; 1580250310; The spread of infectious disease – it all about maths. The number of people who become infected by any infectious disease initially starts off with exponential growth. For example, if the first person infects 4 others (the infection rate), then each of them infect another 4 and so on. So the growth in this case is 4, 16, 256, 65,536 etc. If it was that simple, then if you had even a moderately infectious disease like the common cold, you would spread it across the whole world in a few days. There are a few other things to bring into the calculation, such as – how long is the incubation period, how deadly is the disease, the fact that the population will be split into those already infected (who have either survived or died), those who may be immune (e.g. through vaccination), and the rest (those who haven’t yet been infected). And these days, the other essential element is that people travel widely, so multiple outbreak points are likely. The equations for all this were put together about 60 years ago and are well tested against various diseases, including SARS and Ebola, and one commonly used model is the SEIR model. The key parameter is R-naught (R0), the infection rate – the higher that is the more rapid the spread. Examples of R-naught values are measles=12 to 18 (which is EXTREMELY contagious), influenza=1.4 - 1.6 (moderate), ebola=1.5 - 2. The coronavirus mutation which is currently spreading in China & other countries is estimated as 1.4 - 2.5, with an incubation period of 10 days and (so far) mortality rate of 3%, limited to the elderly or people with existing health issues. An R-naught value can also be used to determine the ‘herd immunity’ level, which is the percentage of people who need to be vaccinated for a particular disease in to prevent it spreading. For measles, this is 90-95% and Australia is currently tracking at 91% across one to five year olds. #LabRats #epidemic #coronavirus
2231623774915352174; 0; False; 1580250306; :parrot:Salvem o meme :parrot: Mencionem a essa publicação no story, comentem / marquem amigos :parrot: Sejam ativos . . . . . . #umbrella #coronavirus #coronavírus #residentevil #zumbi
2231623710616665816; 0; False; 1580250298; El subsecretario de Prevención y Promoción de la Salud de México, Hugo López-Gatell Ramírez, dijo este martes que un mexicano está siendo repatriado desde Wuhan, lugar donde surgió el coronavirus, y que vuelve al país “en perfectas condiciones”. “Entiendo que ya está en camino”, dijo el funcionario. “No es una situación de un traslado en urgencia”, agregó. ¿Lo Viste? :eyes: Síguenos! @informate_oficial #informatedigital #RepublicaRominicana :backhand_index_pointing_left: https://informatedigital.com/ Más en nuestro canal de youtube :backhand_index_pointing_left: #china #coronavirus
2231623688218175298; 0; False; 1580250296; #共匪 #官方 #数字 #武汉肺炎 #coronavirus #fake #death #toll by #ccp 你们 #骚逼 #央妈 #央媒 #造假 都它妈懒得动脑 #愚民 怎么办？
2231623079245828391; 0; False; 1580250284; Otel işçisi koronavirusa yoluxub öldü @cin #çin #aztagram #baku #azerbaycan:Azerbaijan: #koronavirus #coronavirus
2231623563270480154; 0; False; 1580250281; Das Coronavirus, das offenbar Ende 2019 zuerst in der chinesischen Millionenstadt Wuhan ausgebrochen ist und sich von dort weiterverbreitet, ist seit Anfang 2020 ein immer größeres Thema (Newsticker zum Coronavirus). Was hat es mit dem neuen Virus auf sich? Ein Überblick. Was ist das Coronavirus? Coronaviren sind nicht neu: Sie wurden nach Angaben des Robert-Koch-Instituts (RKI) erstmals Mitte der 1960er Jahre identifiziert. Sie wurden so benannt, weil sie von zackenartigen Strukturen umgeben sind, die einer Krone ähneln. Das Coronavirus kann Menschen und verschiedene Tiere infizieren. Beim Menschen verursacht es verschiedene Krankheiten – von ungefährlichen Erkältungen bis hin zu potenziell tödlich verlaufenden Krankheiten wie MERS (Middle East Respiratory Syndrome) und SARS (Severe Acute Respiratory Syndrome). Wie das RKI schreibt, waren durch Coronaviren verursachte Krankheiten wie MERS und SARS in der Vergangenheit weniger leicht übertragbar als die Grippe, aber sie haben zu großen Ausbrüchen geführt. Das neuartige Coronavirus, das in China ausgebrochen ist, heißt offiziell 2019 #coronavirus #bayern #munich #weltkatastrophe #virus
2231623557046171983; 1; False; 1580250280; #corona #coronavirus #coronavirusmemes #china #wuhan #wuhanvirus #wuhanchina #memes #humor #tiktok #2020 #virus #ufc #ufc246 #mma
2231623558302320572; 0; False; 1580250280; . #rezeki #rezekigakketuker #silaturahmi #timjuara #sahabatsurga #lagiviral #InspirasiPagi #instagram #smarthafiz #mpasi #motivasipagi #formatorder #kirana0lshopbaby #RktimByAmih #happysharing #virus #coronavirus #lagiviral
2231623539270636502; 0; False; 1580250278; Follow: @this_memes69 #worldwar3 #ww3 #ww3memes #iran #iranmemes #iranmeme #meme #dankmemesdaily #dankmemes #blackhumor #memes:face_with_tears_of_joy: #schwarzerhumor #memez #memepage #like4likes #followforfollowback #followforfollow #f4f #coronavirus #china #chinavirus #killerbug
2231622806836100361; 1; False; 1580250268; #corona #coronavirus #coronavirusmemes #china #wuhan #wuhanvirus #wuhanchina #memes #humor #tiktok #2020 #virus #who #tiktok #ww3 #ww3memes
2231623401100014590; 63; False; 1580250261; Datos más recientes sobre el coronavirus. Like comenta y comparte . . Ilustraciones de @pictoline . .. #doctorisiima #tips #salud #medicina #Coronavirus #virus #gripe #neumonia #saludybienestar #enfermedad #epidemia #oms . .
2231623389181028571; 0; False; 1580250260; #взаимнаяподписка #взаимныелайки #взаимнаяподписка #взаимныйпиар #взаимныеподписки #ufs #coronavirus #russia #ukraine #china #japan #usa #canada #france #holland #instagram #instagood #instafollow #instalike #instamood #paris #moscow #losangeles #dubai #football #mersedes #goodmorning #tiktok #travel #girls #followforfollowback
2231623367420954316; 0; False; 1580250257; #взаимнаяподписка #взаимныелайки #взаимнаяподписка #взаимныйпиар #взаимныеподписки #ufs #coronavirus #russia #ukraine #china #japan #usa #canada #france #holland #instagram #instagood #instafollow #instalike #instamood #paris #moscow #losangeles #dubai #football #mersedes #goodmorning #tiktok #travel #girls #followforfollowback
2231623365347514634; 0; False; 1580250257; . #rezeki #rezekigakketuker #silaturahmi #timjuara #sahabatsurga #lagiviral #InspirasiPagi #instagram #smarthafiz #mpasi #motivasipagi #formatorder #kirana0lshopbaby #RktimByAmih #happysharing #virus #coronavirus
2231623329495442937; 0; False; 1580250253; #взаимнаяподписка #взаимныелайки #взаимнаяподписка #взаимныйпиар #взаимныеподписки #ufs #coronavirus #russia #ukraine #china #japan #usa #canada #france #holland #instagram #instagood #instafollow #instalike #instamood #paris #moscow #losangeles #dubai #football #mersedes #goodmorning #tiktok #travel #girls #followforfollowback
2231622690528449814; 0; False; 1580250252; Sizde dikkat edin AJDKSLFKSKFNDMS #coronavirus #corona #komedi
2231623311646237394; 0; False; 1580250251; Да что мне этот ваш коронавирус? :white_small_square: :white_small_square: :white_small_square: :white_small_square: :white_small_square: :white_small_square: :white_small_square: :white_small_square: :white_small_square: :white_small_square: :white_small_square: #coronavirus #коронавирус #вирус #virus #crimea #china #yalta #simferopol #usa #norway #iceland #australia #memes #tiktok #instagram #facebook #ялта #крым #россия #украина #крим #russia #ukraine #world #earth #end
2231623300773349548; 0; False; 1580250249; #humor #coronavirus
2231621736935065150; 2; False; 1580250248; Des Sénégalais Souffre en Chine Il ne mange pas Il ne Sont pas en sécurité à cause du virus #coronavirus nous demandons à Monsieur @macky_sall d'envoyer des Personnes Spéciales Pour Le sauvetage De ces Gens Là:folded_hands::folded_hands::folded_hands::folded_hands: Max de Partage Les Gars:folded_hands::folded_hands::folded_hands: @affichepubsenegal
2231623276757600426; 0; False; 1580250247; Recuerden taparse la boca al toser para no contagiar el #coronavirus
2231623041943496195; 0; False; 1580250245; CORONA VİRÜSÜ BİR PLAN MI? Perde arkasında birilerinin İnsanlığı hiçe sayarak onun üzerinde deneyler yapması ve bununla prim yaparak aşısını ürettik diyerek satış yapıp para kazanması sizce de bir plan değilmi? takip :backhand_index_pointing_down: lütfen @mr_hcmt CORONA VİRÜS İST EİN PLAN? İst es nicht ein Plan für jemanden hinter den Kulissen, die Menschheit zu ignorieren und damit zu experimentieren, Umsatz zu machen und Geld zu verdienen, indem wir sagen, dass wir den Impfstoff mit einer Prämie hergestellt haben? folgen :backhand_index_pointing_down: bitte @mr_hcmt #hacamat, #hacamatolunşifabulun, #sülük, #schröpfen, #tedavi, #cuppingtherapy, #cupping, #cuppingmassage, #bağışıklıksistemi, #immunesystem, #coronavirus, #virus, #virusvideo, #salzburg, #salzburgaustria, #austria, #türkiye, #ankara, #istanbul, #europe, #world, #europa, #gesund, #sağlık, #gesundheit, #gesundleben, #welt, #turkiye, #avrupa, #krank,
2231622990026418383; 0; False; 1580250243; Wash you hands, and your ass. #coronavirus
2231623243175847282; 0; False; 1580250243; MAS CALMA QUE NÃO TEM A VER! :face_with_tears_of_joy: LINK NA BIO #Corona #Cerveja #coronavirus
2231623233623213561; 1; False; 1580250241; From #WashTimes reporter Bill Gertz: China’s government stood silent Monday in the face of growing scientific reports that the source of the deadly Wuhan virus outbreak did not originate solely from a seafood market in the city. President Xi Jinping faced mounting criticism on Chinese social media sites for failing to travel to the affected city in Hubei province. Chinese Premier Li Keqiang instead arrived in Wuhan on Monday and is heading efforts to confront the epidemic. Wuhan’s mayor and the Communist Party secretary for the city of 11 million offered to resign amid criticism of their regional government’s mishandling of the deadly outbreak. • ➤ Tap the link in our bio to read more #china #communist #wuhan #coronavirus #warfare #biology #medical #health #news #realnews #washingtontimes #xijingping #outbreak
2231623214806051942; 2; False; 1580250239; Amigos, o mundo inteiro está assustado com o coronavírus e os riscos de uma nova epidemia global. No Brasil, há três caso suspeito sob investigação, em Belo Horizonte, Curitiba e Porto Alegre, mas ainda não confirmados. Apesar disso, não é momento de pânico. Fato é que todos nós devemos nos preparar para o caso e haver uma proliferação do vírus que saia do controle das autoridades sanitárias. Pequenos cuidados, como estes na imagem, divulgados pela Organização Mundial da Saúde (OMS), fazem muito a diferença. Permanecemos em alerta e vigilantes! #coronavirus #saude #mg #belohorizonte #bh #oms #juliodelgado
2231623195596093941; 0; False; 1580250237; An unknown virus has appeared in central China and is causing the spread of a new, worrying epidemic. China has taken drastic quarantine measures affecting more than 56 million people while the first cases are reported around the world. :globe_showing_Europe-Africa::folded_hands_medium-dark_skin_tone: ~~~~~~~~~~~~~~~ #coronavirus #coronavirusmemes #coronavirusoutbreak #coronaviruses #coronavírus #coronaviruschina #coronavirüsü #world #worldtraveler #worldtour #worldstar #chinesefood #china #planetearth #nature #virus #symptoms #instagram #instagramers #instagramer #instagrammers #catsofinstagram #dogsofinstagram #boy #girl
2231623159518623294; 1; False; 1580250233; So basically we’re facing a possible new #blackplague that is the #coronavirus because Chinese people like to eat weird not edible things...That’s unfair (We are to die because Chinese eat :bat: bats?)
2231622691526236868; 5; False; 1580250229; Via @marko Menciona a toda tu familia 1 Dale repost, mientras más personas sepan mejor 2 Énvialo a tus grupos de Wsp 3 #coronavirus
2231623004169491832; 0; False; 1580250214; a flashback card for james? . . . . #pacybits19 #pacybitssbc #pacybitsandroid #pacybits #pacybitstrading #pacybitsallstars #pacybitsicon #pacybitsgiveaway #pacybitspacks #pacybits20 #fifa20 #fifa19 #ultimateteam #realmadridcf #jamesrodrigues #colombia:Colombia: #sudamerica #conmebol #coronavirus #ww3
2231622974153953962; 0; False; 1580250211; Flowers are showy for a reason. They communicate both health and vulnerability. A plant may flower because of good conditions like an abundance of water, or it may be a sign of stress in challenging ones. . . As global health concerns increase, the data consistently shows that masks are most effective in preventing the spread of illness when worn by those that are sick. If you are sick, tell that story. Speak in flowers and keep your community safe. If you have health concerns, communicate that vulnerability and stay strong. . . So happy to see ‘ō‘hia lehua communicating their happy growth in the back of the valley, still telling their story of love's steadfast resilience. #ohialehua #manoavalley . . . #speakinflowers #flowerspeak #coronavirus #publichealth #pua #healthyboundaries #pm25mask #n95mask #fluseason #healthyconditions #madeinhawaii #sustainabledesign #sustainableclothing #nativeintelligence #manoa #honolulu #oahu #hawaii #pelerules
2231622888774815997; 0; False; 1580250200; JACKFRUIT z DM. Sice trošku dražší sranda, ale kurevsky dobrá. Marinoval jsem to v oleji a gyros koření. Rozmačkal jsem avokádo s česnekovým granulátem a namazal na housku, nebo žemli, jak se říká... jebat. Pak jakesyk zelene pičoviny a hotovo. Flex #vegan #veganjidlo #veganfood #veganig #hamburger #coronavirus
2231622888010856635; 3; False; 1580250200; Taco :taco: Tuesday or bust #coronavirus #corona #readyornot #beprepared #cheaglesrock
2231622238977734666; 0; False; 1580250199; #china #france #epidemie #coronavirus #wuhan #virus #prevoyance #protection #controle #2020 #chine #usa
2231622455637944405; 3; False; 1580250194; . Los habitantes de la ciudad de Wuhan, salen a los balcones a gritar y a darse aliento! . Conmovedor. Tremendo. Gritan "Jia You, Wuhan!" (Vamos, Wuhan!) . #Coronavirus
2231622826415595644; 0; True; 1580250193; Baarakallahufiykum #obat #coronavirus #viruscorona
2231622795350160394; 0; False; 1580250189; Después de publicar el aviso de la demanda de mascarillas en China hace 2 días, recibimos varias informaciones efectivas de diferentes países latinoamericanos, muchas gracias por su apoyo poderoso y acción rápida. Muchas veces, la sensación de pánico en sí es peor que la epidemia. La prevención y preparación superan cualquier temor. Acá tienen los datos sobre la difusión del virus y la preparación de los países. Que la epidemia esté bajo control pronto. 两天前，我们发布了国内对医疗物资，尤其是医用口罩和N95口罩的需求。两天内我们收到了来自南美不同国家的很多有效信息。感谢大家的强力支持和闪电行动力。很多时候，比疫情更糟糕的是恐慌本身。因此，预防和准备显得尤其重要。这里是关于此次疫情全球范围内的传播和各个国家的准备数据。仅供参考。 After publishing the notice of the demand for masks in China 2 days ago, we received some effective information from different Latin American countries, thanks very much for your powerful support and quick action. Many times, the feeling of panic itself is worse than the epidemic. Prevention and preparation can overcome any fear. Here are the data on the spread of the virus and the preparation of the countries. May the epidemic be under control soon! #linacuzaintercultural #范丘跨文化管理 #跨文化管理 #comunciaciónintercultural #gestiónintercultural #comerciointernacional #negociointernacional #china #coronavirus #coaching #crossculturalcommunication #crossculturalmanagement #中拉合作
2231622543315743867; 0; False; 1580250185; She belongs to the streets :black_small_square: :white_small_square: :black_small_square: :white_small_square: ~~~~~~~~~~~~~~~~~~~~~~ #dankmemes #memes #funnyvideos #offensivememes #meme #dankmemes #dank #dankmeme #meme #anime #twittermemes #edits #anime #animememes #weeb #coronavirus #coronavirusmemes #kobe #kobememes #kobedeath #kobememe #ripkobe
2231622729885776955; 0; False; 1580250181; Si es que ya está todo inventado... #coronavirus #bacillus #asterix #obelix
2231622689544748775; 0; False; 1580250177; #coronavirus #chinaspecial #outbreak #outofmask #talent
2231622580400638713; 1; False; 1580250164; Cause i’m a massive germaphobe here ya go - - - #germs #germaphobe #ocd #clean #cleaning #virus #china #corona #corona:beer_mug: #coronavirus #breakout #hospital #usa #disease #plague #plaguememes #meme #memes #mentalhealth #health #hospital #hospitals #doctor #protect #essentialoils #vaccine #essentialoils101 #essentialoillove #essentialoillife #younglivingessentialoils #youngliving
2231616635588790383; 1; False; 1580250156; Pray for Hong Kong | 為香港禱告 When the situation is out of control and there is nothing we can do, all we need is to kneel down and ask for God's mercy and salvation 當事情不能在控制的範圍內, 我們唯一可以做的就是謙卑尋找神的憐憫和救贖 一一一一一一一一一一一一一 Tags: #coronavirus #coronavirusoutbreak #praytogod #praytogether #savehongkong #webcomicartist #gif #illustration #webcomics #dailycomic #digitalcartoon #couplecartoon #animationvideo #himhimchubbies #イラスト #コミックエッセイ #삽화 #코믹 #武漢肺炎 #流感 #謙卑 #禱告 #插畫 #漫畫 #動畫 #插圖 #插圖畫家 #電繪 #香港插圖 #謙謙有肉
2231622504282826900; 0; False; 1580250155; #coronavirus #china #memes #rpm #preppertalk #bronchitis #bacterialvaginosis #aids #dallas #repost #urbansurvival #beready #preppernation #virus #doomsdaypreppers #candidiasis #pandemic #preparedness #virologia #paragrafando #studygram #med #biomedicas #brucellosis #chikungunya #chickenpox #flu #hepb #hepatitise #bhfyp
2231621963445956637; 0; False; 1580250142; #coronavirus #china #memes #rpm #preppertalk #bronchitis #bacterialvaginosis #aids #dallas #repost #urbansurvival #beready #preppernation #virus #doomsdaypreppers #candidiasis #pandemic #preparedness #virologia #paragrafando #studygram #med #biomedicas #brucellosis #chikungunya #chickenpox #flu #hepb #hepatitise #bhfyp
2231622386893881766; 1; False; 1580250141; #coronavirus #scheisschina #chinakatze #winkemietze #winkekatze #maneki #manekineko #glücksbringer #scheissaufhashtags
2231622197948759395; 0; False; 1580250140; Je vois un #chinois atteint de #coronavirus
2231622093626391401; 6; False; 1580250140; ALL THE WAY UP BOYZ | | | #cod #callofduty #modernwarfare #clipit #opticgaming #faze #fazeclan #qs #quickscope #game #gamimg #snipe #sniper #fortnite #dog #cat #shit #omg #crazy #coronavirus
2231622354236479806; 0; False; 1580250137; El ciudadano chino, de 49 años, quien es sospechoso de portar coronavirus es crítica, aseguraba un comunicado del Ministerio de Salud... #Coronavirus #Wuhan http://bit.ly/2GygA5G
2231622310347987764; 0; False; 1580250131; Shibou News #1 The Coronavirus EN : The post common symptoms of coronavirus disease are fever above 38°C, cough, unusual tiredness, or myalgie, dyspnea. Don't go to tour doctor or the emergency room to avoid infecting others. Wear a surgical mask in case of contact with other people. Use disposable tissues. Wash your hands regularly. Understanding the mechanism by which an animal virus asquires the ability to transmit to humans is an important subject, several ANSES laboratories are working on this issue. Don't panic, just try to be more attentive to what surrounds you. FR : Les symptômes les plus courants de la maladie sont une fièvre supérieure à 38°C, une toux, une fatigue inhabituelle ou une myalgie, une dyspnée. Ne vous rendez pas chez votre médecin traitant ou aux urgences pour éviter de contaminer les autres. Porter un masque chirurgical en cas de contact avec d'autres personnes. Utilisez des mouchoirs jetable et lavez vous régulièrement les mains. La compréhension des mécanismes permettant à un virus animal d'acquérir la capacité de se transmettre a l'homme est un sujet important, plusieurs laboratoires de l'Anses travaillent sur cette question. Ne paniquez pas pour autant, tâchez juste d'être plus attentif à ce qui vous entoure. #coronavirus #virus #asia #asie #shiba #shibainu #doge #dog #discover #montage #picture #news #information #actu #prevention
2231622268721849329; 1; False; 1580250126; #coronavirus #aliexpress #verkouden #huisarts #zorgen #verzorgendeig:syringe::pill: #verpleegkundige #verpleegkundigeinopleiding
2231622078663382300; 0; False; 1580250120; Sebuah rekaman video memperlihatkan seorang turis asal China meradang lantaran harus menjalani serangkaian tes untuk mencegah masuknya virus Corona dari Wuhan di Bandara Senai, Malaysia. . Dilansir dari World of Buzz, Senin (27/1/2020), turis tersebut tampak ditempatkan di sebuah ruang. Kemungkinan besar untuk menjalani screening dari otoritas bandara. Terlihat di video itu, dia menggedor dinding kaca yang 'mengurungnya'. . Bukan cuma itu, dia bahkan mencoba untuk memanjat dinding kaca tersebut guna menarik perhatian otoritas Bandara Senai, Distrik Kulai, Johor, Malaysia. Tak pelak, polah turis tersebut membuat geger bandara. . Sekadar informasi, Malaysia kini berada di tengah kekhawatiran besar masuknya wabah virus Corona dari Wuhan, China. Alhasil, sejumlah alat screening ditempatkan untuk menyasar turis-turis yang datang dari negara tersebut. Artikel: Suara.com #instagramersmediajakarta #jakartainformasi #jakarta #malaysia #coronavirus
2231621437488068178; 5; False; 1580250119; Via #nuriapiera ・・・ A propósito de la epidemia del nuevo virus coronavirus, que se establece comenzó por la ingesta de culebras y murciélagos por parte de los seres humanos, este vídeo que circuló en el 2018 muestra otra tradición de China, comer renacuajos. Esta práctica es muy habitual en algunas áreas rurales del país asiático y los médicos del país han alertado de los riesgos. El año pasado, la Fundación Nacional de Ciencias Naturales publicó un informe en el que advertía de las posibles consecuencias para la salud. Según otro estudio, el 11,93% de los renacuajos de la provincia de Henan están infectados con plerocercoides, la forma larvaria de ciertas tenias. Cuando estas criaturas se comen crudas, pueden provocar una peligrosa infección parasitaria. #coronavirus #renacuajos #china #parasitos
2231622155930239292; 0; False; 1580250113; O Ministério da Saúde informou, na tarde desta terça-feira (28), dois novos pacientes com suspeita de estarem infectados com coronavírus 2019-nCoV no Brasil. Eles estão em Porto Alegre e Curitiba. Com isso, chega a três o número de casos investigados. Pela manhã, o órgão já havia comunicado uma suspeita em Belo Horizonte. #coronavirus #saude #brasil
2231622114641567561; 1; False; 1580250108; Our company Just Wish Foundation is helping family who need help. We do it by action. :growing_heart::growing_heart::growing_heart: . 我們公司的公益組織Just Wish Foundation捐了五萬個口罩給中國。 目的不在於宣傳，而在於用實際行動先幫助自己的家庭，再幫助更多需要的家庭。 心，不會因為錢的多少而改變。 但有錢，才有能力幫助更多的人。 #WuhanSari #Masks #china #charity #coronavirus #n95mask #donation #helpingothers #sari #wuhan #wuhanvirus #justwishfoundation #jwsuccessedge
2231622036015450359; 0; False; 1580250099; #coronavirus #2 . follow @pr0grammy :upside-down_face: follow @pr0grammy :upside-down_face: follow @pr0grammy :upside-down_face: . . . Please ignore text & hashtags below (: . I only use #parentingmemes and #engineeringmemes on my insta page #pr0grammy to post #memerelateable stuff here. These are #chilememes and for everyone whos still reading also #funmemes dont get fooled #memeslayer by this text which i wrote between the #funnypage because this is all #funnyedits for the mechanic of the page #memesfunny i found a new way to post #trumpmemes and #newfunnymemes to support #feminism and get some jokes about #funnymom out for you guys. All this stuff is #selfcreated because im a #memester and everything on this page is #funnyisfunny and I also post only #truethings if you are still reading this #believeit #voidmemes you really have to much time i guess #memessad you should really stop reading this #indianmemesdaily and for all #niggermemes thank you #gfmemes that you support my page #memestore got nothing left to say as a #memedealer with some #funnycomics but atleast i wasted #newmeme some time and hope you enjoy the content
2231622013500080470; 4; False; 1580250096; Ministério da Saúde investiga casos suspeitos do coronavírus em Curitiba e Porto Alegre⠀ ⠀ Subiu pra três o número de casos sob investigação por suspeita de contaminação pelo coronavírus. A informação é do Ministério da Saúde e foi divulgada pela Globo News. ⠀ ⠀ Os dois novos pacientes estão em Porto Alegre, no Rio Grande do Sul, e em Curitiba, no Paraná. Os dois se enquadram na atual definição de caso suspeito estabelecido pela OMS, tiveram sintoma respiratório e estiveram na região de contato ou com pessoa contaminada.⠀ ⠀ Além dessas duas novas suspeitas, outra paciente já tem o caso em investigação desde esta segunda-feira (28) em Minas Gerais.⠀ ⠀ SAIBA MAIS: http://bit.ly/2S18KXC (o link clicável está disponível na descrição do perfil @gazetadopovo)⠀⠀ ⠀ ⠀ FOTO: Divulgação / Herney Gómez / Pixabay⠀
2231621364605873651; 0; False; 1580250085; Çinin vuhan şəhərində 17 yaşlı gənc yoldaca koronavirusunnan öldü #cin #çin #aztagram #baku #azerbaycan:Azerbaijan: #koronavirus #coronavirus
2231621764860078708; 20; False; 1580250082; Coronavirus⁠ ⁠ “The coming days and weeks are likely to bring more cases including the possibility of person-to-person spread,” but “right now, there is no spread of this virus in our communities at home.” That’s what the head of the Centers for Disease Control and Prevention said at a news conference today.⁠ ⁠ Background: An outbreak of an especially deadly form of a coronavirus led to a lockdown in China and scares across the globe. What is it and what should you know?⁠ ⁠ Symptoms: include fever and shortness of breath. Severe cases can lead to pneumonia, cause kidney failure. Some people have died from it.⁠ ⁠ Treatment: Antibiotics don’t work against this virus, nor do existing antivrial medications.⁠ ⁠ Known cases: At of posting, there are at least 4500 known cases and more than 100 deaths in China. The number of infected people increased 60% overnight (source: CDC)⁠ ⁠ US Patients: 5 people tested positive in the US. 70+ others are pending. Cities with infected individuals: LA (Orange County), Arizona (Maricopa County), Washington & Chicago.⁠ ⁠ What is it: There are 7 known coronaviruses. Other deadly coronaviruses include SARs and MERs. (CDC)⁠ ⁠ China: To contain the virus china has locked down at least 12 cities, impacting more than 50 million people. US health officials are warning Americans to avoid non-essential travel to China, and avoid visiting Hubei Province.⁠ ⁠ Why you don’t need to panic: CDC official Dr. Nancy Messonnier on the US: “we continue to believe that the immediate health risk from the new virus to the general public is low at this time."⁠ ⁠ I’m posting a video from @Guardian to stories – if you want to know more check stories shortly!⁠ ⁠ #news #newsnotnoise #china #coronavirus #health # #virusintl #science #healthcare #CDC
2231621749273827677; 0; False; 1580250064; It was a good day today- back on track!! Couple days was rough due to #coronavirus :thumbs_down_medium-light_skin_tone: it affected the whole world:face_with_medical_mask: #letslive • Your free stock is waiting for you! Join Robinhood and we'll both get a stock like Apple, Ford, or Facebook for free. Sign up with my link. https://join.robinhood.com/gregr374
2231621701014949030; 3; False; 1580250059; stay healthy and be strong #coronavirus
2231621608480815314; 0; False; 1580250057; #meme #memes #memesbrasil #anime #animebrasil #animesmemes #video #videosmemes #videosengracados #tiktokmemes #zombie #animes #aleatorio #wtfmemes #darkmemes #memehut #nea #neaki #otaku #humor #funny #weeb #asian #coronavirus
2231621614194636797; 20; False; 1580250048; ¿Es el coronavirus una real amenaza mundial? ¡Descúbrelo en nuestro nuevo video! Link en la biografía :grinning_face_with_smiling_eyes: #dankev #youtube #youtuber #coronavirus
2231621589362660507; 3; False; 1580250045; Who remembers Resident Evil? #residentevil #coronavirus #industrypartybumrusher #blackfranciswhite #crooklynsfinest #hiphop #turntables #dj #basementparty #houseparty #oldschool #rap #rapmusic #oldschoolhiphop #hiphopculture #diggininthecrates #music #nyc #queens #brooklyn #bronx #statenisland #longisland #7TRAIN #graffitti #thesethingshappen
2231621312288495633; 0; False; 1580250012; 현재 코로나 바이러스 확진자 상황#코로나 바이러스#coronavirus
2231620924849797732; 0; False; 1580250010; Çində küçələrdə koronavirusunnan yoluxmuş ölü insanlar #cin #çin #aztagram #baku #azerbaycan:Azerbaijan: #koronavirus #coronavirus
2231617901932924887; 2; False; 1580249819; That’s @jockowillink talking about ACCOUNTABILITY. Do you hold yourself accountable or do you rely on someone else to do it for you? #DisciplineEqualsFreedom
2231608790143312363; 6; False; 1580248532; Кек Слежу за короновирусом со всех сторон . #coronavirus #memes #9gag #trend
2231600161132716061; 0; False; 1580247834; @raesremmurd ft. @laflare1017 𝓑𝓵𝓪𝓬𝓴 𝓫𝓮𝓪𝓽𝓵𝓮𝓼 :cigarette: ~𝓗 𝓓~ • • • • •𝓣𝓪𝓰𝓼 #raesremmurd #guccimane #blackbeatles #blackbeatles:fire::headphone: #raeblackbeatles #it #kobebryant #kobebryant24 #kobebrayant #coronavirus #coronavirusoutbreak #coronavirüsü #coronaviruses #elazığ #deprem #elazığdeprem #elazığdepremi #strangerthings #strangerthingsedit #strangerthings3 #strangerthings2 #strangerthingsedits #strangerthings2
2231439635675157496; 8; False; 1580228355; FOI ASSIM QUE ESPALHOU-SE O CORONA VIRUS!:face_with_tears_of_joy: #virus#coronavirus#lulaladrão#foralula#gorapt#esquerdanuncamais#esquerdismoédoença#esquerdadoente#foraesquerda#virusmortal#china#putin#kinjongun
2231414452402455739; 19; False; 1580225353; Essa zorra tá matando gente:face_with_rolling_eyes: . #caronavirus #coronavirus
2230824563089276112; 7; False; 1580155033; Assholes using coronavirus as an excuse to be racist against Chinese people, I SEE YOU . . #china #chinese #asia #asian #travelgram #chengdu #chengducity #chengdulife #wushu #kungfu #成都 #中国 #wuhanvirus #coronavirus #wuhan
2231621384195268839; 0; False; 1580250045; Un pasajero lleva gafas de natación y una mascarilla mientras espera dentro de la estación de tren de alta velocidad que conecta Hong Kong con la China continental durante un día festivo para celebrar el Año Nuevo Lunar en Hong Kong el 28 de enero de 2020, como medida preventiva tras un brote de virus que comenzó en la ciudad china de Wuhan. (Foto de ANTHONY WALLACE/AFP a través de Getty Images)⁠ ⁠ Hong Kong anunció el 28 de enero que reducirá drásticamente los viajes transfronterizos desde el continente en un esfuerzo por frenar la propagación del coronavirus al centro financiero asiático.⁠ ⁠ Todos los enlaces ferroviarios con el continente se cortarán a partir del viernes con el cierre tanto de la estación de alta velocidad como de la estación de tren regular, dijo la directora ejecutiva Carrie Lam en una conferencia de prensa el martes.⁠ ⁠ Los vuelos hacia y desde el continente también se reducirán a la mitad, los autobuses turísticos transfronterizos se reducirán y las embarcaciones transfronterizas se detendrán. Beijing también dejará de emitir visados de turista para los habitantes del continente. Las regulaciones entrarán en vigor el jueves a medianoche.⁠ ⁠ Lee más en el link en Bio @epochtimeses⁠ ⁠ #Wuhan #WuhanCoronavirus #WuhanSARS #WuhanOutbreak #WuhanPneumonia #WuhanVirus #SARSvirus #SARS2020 #SarsCov #CoronaVirus #Pneumonia #China #nuevocoronavirus ⁠#neumonia #virus #spanisnews #noticias ⁠#HongKong ⁠
2231621575379460988; 1; False; 1580250044; Mau celebrate CNY (Tahun Baru Imlek) diluar negeri, jadi parno karena #Coronavirus? . Tetap tenang dan waspada ya sob. Jangan lupa dibaca dulu nih penjelasan soal corona virus dari mimin. Biar kamu dapat melakukan pencegahan penularan sedini mungkin. . Jangan lupa jaga kesehatan ya sob. Mimin gak mau kamu sampai sakit. Biar hati mimin aja yang ambyar, kesehatan mu jangan ikut ambyar ya. @smapasundan8bdg #sehat #sehatalami #sehatselalu #makanansehat #dietsehat #sehatcantik #sehatisejiwa #sehatitumahal #sehati #sehatituaset
2231621011965505847; 27; False; 1580250031; Como no van a contraer virus, si los chinos comen gatos, perros, murciélagos, culebras y esto también #coronavirus #Wuhan #regrann Reposted from @paolucci40 (@get_regrann) -
2231621403875061106; 0; False; 1580250023; ??!! Bewusst werden #coronavirus
2231620865183169091; 0; False; 1580250022; Küba'da 7.7 Şiddetinde deprem oldu Sona Yaklaştık artık :crying_face: #corona #coronarvirus #koronavirus #virüs #deprem #çin #Wuhan #türkiye #almanya #istanbul #izmir #adana #gaziantep #salgın #hastalık #coronavirues #CoronaVirus #takipçikazan #gt #antalya #trabzon #afad #haber #SonDakika #aztagram #followme #likeme #video #mizah #çin . Dünya'da Olan En Güncel Olay ve Gelişmelerden herkesten önce haberdar olmak istemezmisiniz? @reflexhaber Bizi Takip Edebilirsiniz.
2231621363098166057; 0; False; 1580250018; Pop a cold Corona boys #memes #corona #coronavirusmemes #coronavirus #stolen #plagueinc #china #cough
2231621340281379982; 0; False; 1580250016; En caso de tener neumonía a causa del coronavirus , se puede acercar a cualquiera de estos hospitales nivel 3 en el país. #fluimucil #coronavirus #neumonia
2231621247475857151; 4; False; 1580250008; You may have recently heard of the new coronavirus out of Wuhan, China. While it may seem scary because so much is unknown, remember that right now there is a greater chance of your family catching the flu, which can also be dangerous. Keep your family healthy by washing hands often and keep your kids home if they are ill. More info about the coronavirus and prevention tips can be found in the :link:link in bio.:link: . . . . #HealthyChildren #Parents #Parent #Parenthood #Parenting #InstaParenting #ParentingTips #coronavirus
2231621243836554648; 1; False; 1580250004; #Repost @minsaude with @get_repost ・・・ #NovoCoronavírus | O Brasil tem grande capacidade técnica para apoiar o mundo na produção de vacinas. Hoje, o ministro da Saúde, @henriquemandetta, garantiu que o país será parte do movimento mundial em busca de vacina contra o novo coronavírus. Saiba mais sobre a doença em saude.gov.br/novo-coronavirus #coronavirus #sus #vigilância
2231621198546376771; 0; False; 1580249999; @MNNTeam: :globe_with_meridians: Go around the world in 60 seconds: https://bit.ly/2uAQ4pR :headphone: Today’s headlines feature #CoronaVirus and #persecution #AsianAccess
2231621181434523064; 0; False; 1580249997; The rapid spread of the deadly coronavirus had put health authorities both in Australia and overseas on alert and sparked a global panic. Bridging Translation recently noticed that the Communicable Disease Control Branch hotline lacks professional Chinese interpreters who have medical interpreting experience and the computer recording at the beginning is all in English. As a professional Chinese translation company, Bridging Translation decided to provide FREE telephone interpreting services to all Chinese people living in Australia. This service is only for the Communicable Disease Control Branch hotline against Coronavirus. If you have relevant symptoms, don't panic. Our medical translating and interpreting team will be your strong backup. For more information, please visit - https://lnkd.in/gp9rkiF #BridgingTranslation #MedicalInterpreting #TelephoneInterpreting #Coronavirus
2231621175183972565; 0; False; 1580249996; #coronavirus #virus #chinacoronavirus #ncov2019 #epidemiacoronavirus #pandemia
2231621174713698018; 2; False; 1580249996; Bora lutar contra o coronavírus.⠀ .⠀ Valeu, @igor.mp4, por isso.⠀ .⠀ #coronavirus #corona #virus #dengue #aids #camisinha #carnaval #carnaval2020 #segurança #prevenção
2231621065361536231; 0; False; 1580249983; A argentina no te asomas coronavirus :smiling_face_with_sunglasses: #shitpost #shitposting #meme #memesespañol #shitpostespañol #coronavirus
2231620932953442715; 3; False; 1580249967; I just wanted to know the best way to prepare sweet potatoes... #coronavirus#pandemic
2231620912839262550; 0; False; 1580249965; The bottom part says they don't do this for a flu. #coronavirus #canada #coronavirusoutbreak
2231620904121963925; 0; False; 1580249964; INFÓRMATE | Te invitamos a conocer más sobre el #Coronavirus y a mantenerte informado por los canales oficiales. No extiendas rumores, aún no existen casos confirmados en Ecuador. #QuitoSaludableOtraVez
2231620842332477758; 0; False; 1580249956; Corona virus is here people. Stay safe out there. #medicine #medicaldoctor #clinic #nurse #doctor #hospital #coronavirus #virus #medicalstudent #nursestudent #epidemic #pandemic
2231620822005821145; 1; False; 1580249954; Ando con un poco de fiebre #coronavirus #cuidense #osoradioactivo #ecologia #desastreambiental #cuidemoselplaneta
2231620819732251690; 0; False; 1580249954; Informationen zum Coronavirus. | 28. Januar 2020 - 23:00 Uhr | #coronavirus #coronaviren #china #deutschland #krankheit #gesundheit #nachrichten
2231620803719611459; 0; False; 1580249952; Trabajadores de la construcción usan excavadoras en el lugar de la construcción de un hospital con capacidad para 1,000 camas cuya construcción servirá para acomodar el creciente número de pacientes de #coronavirus el 24 de enero en #Wuhan, provincia de Hubei, China. El hospital será completado el 3 de febrero de 2020. (Foto de Getty Images)
2231620794390519925; 0; False; 1580249951; #coronavirus #who #public #advice
2231620786002065774; 0; False; 1580249950; Lista de países y regiones con casos confirmados del #Coronavirus :globe_showing_Europe-Africa:China :globe_showing_Europe-Africa:Estados Unidos :globe_showing_Europe-Africa: Francia :globe_showing_Europe-Africa:Alemania :globe_showing_Europe-Africa:Australia :globe_showing_Europe-Africa:Japón :globe_showing_Europe-Africa:Malasia :globe_showing_Europe-Africa:Singapur :globe_showing_Europe-Africa:Corea del Sur :globe_showing_Europe-Africa:Taiwán :globe_showing_Europe-Africa:Tailandia :globe_showing_Europe-Africa:Vietnam :globe_showing_Europe-Africa:Nepal :globe_showing_Europe-Africa:Canadá :globe_showing_Europe-Africa:Camboya :globe_showing_Europe-Africa:Sri Lanka #NacionalFmDigital
2231620784190107587; 3; False; 1580249949; Be safe everyone!! Make sure you wash your paws:face_with_medical_mask:
2231620761844883232; 7; False; 1580249947; Please let's repost this, so that we can save a life. Allah ya kare mu ameen. #lassafever #lassaisreal #coronavirus precautions Reposted from @drzus ZAZZABIN LASSA/ LASSA FEVER - #regrann
2231620538000825206; 1; False; 1580249945; Joker has corona virus :flushed_face::flushed_face::flushed_face: _______________________________________ /______•_________•___•_________•______\ \____••__________•••••__________••____/ / __•••••••••••••••••••••••••••••••___\ \_••••••••••••••••••••••••••••••••••_/ /__••••••••••••••••••••••••••••••••__\ \ ___•••_________••••••_________•••___/ /_____••__________•••• _________••____\ \_______•__________••__________•______/ Bat Tags: #Batman #BruceWayne #Robin #Nightwing #RedHood #DickGrayson #TimDrake #JasonTodd #TheJoker #Joker #KevinConroy #MarkHamill #AlfredPennyworth #BatmanMemes #BatmanMeme #DCComics #DCMeme #DCMemes #DCAU #DCEU #DCAnimatedUniverse #BatmanTheAnimatedSeries #BTAS #BewareTheBatman #TheBatman #BatmanTheBraveAndTheBold #TheNewBatmanAdventures #JusticeLeague #JusticeLeagueUnlimited #Coronavirus
2231620741803812573; 0; False; 1580249944; Pastel de ""Flango"" . . . . . . . . . . . . . . #filme #filmes #caxiasdosul #memes #memesbr #southamericamemes #memesbrasil #rock #escola #hunor #amor #futebol #estadual #fit #fitness #engracado #meme #domingou #domingo #find #acabou #contagio #epdemia #coronavirus
2231619398611861908; 0; False; 1580249941; :face_with_tears_of_joy::face_with_tears_of_joy::face_with_tears_of_joy::face_with_tears_of_joy: | | | ——->Follow me for more #coronavirusmemes #coronavirus #memes #humour #drole #ptdr #mdr #:face_with_tears_of_joy: #:loudly_crying_face:
2231620322852316044; 0; False; 1580249937; Suasana terbaru di kota Wuhan pasca terkena virus corona . . . #beritaummatislam #dakwahislamid #wuhan #uyghur #muslim #virus #coronavirus #china #viral #viruscorona #viruschina source :Serambi Aceh
2231620672866675855; 16; False; 1580249936; Lasst uns unterhalten: Die Bill and Melinda Gates Stiftung hat nicht nur die Entwicklung des Corona-Virus finanziert. Im Oktober 2019 sagte Gates bereits den Tod von 65 Millionen Menschen durch das Virus voraus. #coronavirus
2231611087982631108; 0; False; 1580249934; Самые свежие новости. 23 человека вернулись в Казахстан из Китая с температурой, четверо из них госпитализированы. Предварительный диагноз – ОРВИ, но у всех взяли анализы крови на коронавирус . . . . #coronavirus #короновирус #китай #европа #болезнь #смерть #опасность #мир #видео #хэштеги #новости #новости_ru #карантин #эпидемия #инстатаграм #весьмир #карантин #страх #top #люди #человек #video #life #жизнь #china #europe #ухань #wuhan #россия #болезнь
2231620656113178294; 0; False; 1580249934; #coronavirus #corona #virus #cina #china #wuhan #cinesi #quercetin #quercetina #quercitin #quercitina #sars #2019nCov #CoV #SARSCoV
2231620426282132398; 11; False; 1580249933; Sopa de morcego! Um dos prováveis focos de transmissão do coranavírus é possivelmente o morcego, uma iguaria apreciada na China, como outros animais silvestres e exóticos. Esse vídeo que circula nas redes sociais mostra um morcego :bat: sendo apreciado numa mesa de restaurante. As autoridades chinesas já pediram para a população não consumir mais estes tipos de alimentos! #china #coronavirus
2231620634570667574; 2; False; 1580249932; YEAR OF THE WUHAN - Happy New Year #illustration#chinesenewyear#rat#wuhan#coronavirus#staysafe
2231620428823123908; 29; False; 1580249907; ‘2019-nCoV’ 2019 – nCoV jumped the species barrier at the Huanan Wholesale Market in Wuhan in late December. 28 of the first 41 people with the infection had recently been to the market, which draw criticism for fostering the ideal environment for coronaviruses to mutate. Both this outbreak and the 2003 SARS jumped the species barrier at a wet market. The number of confirmed cases elevated to 4,515 on Tuesday from 2,835 on Monday, a 60% increase. ___________________________________________ #coronavirus #china #news #virus #chinanews
2231620412735193056; 1; False; 1580249905; Corona virus is here people. Stay safe out there. #medicine #medicaldoctor #clinic #nurse #doctor #hospital #coronavirus #virus #medicalstudent #nursestudent #epidemic #pandemic
2231620385371450078; 0; False; 1580249902; @abm__god . . . . . . @dr.robin_radhakrishnan @dr.yaminkhan @dr.gore_styling @drrizwanullah @drashrafmemon @drsarahnicholls @doctor.rov #medical #awareness #life #doctor #neurology #virus #virology #hospital #corona #coronavirus #china #outbreak
2231620359510306001; 0; False; 1580249899; INFÓRMATE | Te invitamos a conocer más sobre el #Coronavirus y a mantenerte informado por los canales oficiales. No extiendas rumores, aún no existen casos confirmados en Ecuador. #QuitoSaludableOtraVez
2231620349938434692; 0; False; 1580249898; Go To Hell With Your Aid . -Koesno Sosrodihardjo(IR.Soekarno) #coronavirusmemes #coronavirus #coronamemes #indonesianmeme #countryballs #lol
2231620305999402114; 0; False; 1580249892; Coronaviruses (CoV) adalah keluarga besar virus yang menyebabkan penyakit mulai dari flu biasa hingga penyakit yang lebih parah seperti Sindrom Pernafasan Timur Tengah (MERS-CoV) dan Sindrom Pernafasan Akut Parah (SARS-CoV) . Coronavirus novel (nCoV) adalah jenis baru yang belum diidentifikasi sebelumnya pada manusia. Virus corona adalah zoonosis, artinya ditularkan antara hewan dan manusia. Investigasi terperinci menemukan bahwa SARS-CoV ditularkan dari kucing luwak ke manusia dan MERS-CoV dari unta dromedaris ke manusia. Beberapa coronavirus yang diketahui beredar pada hewan yang belum menginfeksi manusia. Tanda-tanda umum infeksi termasuk gejala pernapasan, demam, batuk, sesak napas dan kesulitan bernafas. Pada kasus yang lebih parah, infeksi dapat menyebabkan pneumonia, sindrom pernapasan akut, gagal ginjal, dan bahkan kematian. Rekomendasi standar untuk mencegah penyebaran infeksi termasuk mencuci tangan secara teratur, menutupi mulut dan hidung ketika batuk dan bersin, memasak daging dan telur dengan saksama. Hindari kontak dekat dengan siapa pun yang menunjukkan gejala penyakit pernapasan seperti batuk dan bersin. Source: WHO #coronavirus #viruscorona #tipssehat #healthylifestyle #health #hidupsehat #polahidupsehat #virus #penyebaranviruscorona #olahraga #who #duniakesehatan #CoV
2231620167251668584; 0; False; 1580249876; ☼му ƒιяѕт тняєα∂ ~ ܀ ✯🆆🅷:A_button_(blood_type):🆃 🅳:O_button_(blood_type): 🆈:O_button_(blood_type):🆄 🆃🅷🅸🅽🅺 :A_button_(blood_type)::B_button_(blood_type)::O_button_(blood_type):🆄🆃 🅸🆃?? ❊ #thread #threads #selfcare #aesthetic #selfcarethreads #explorepage #explore #skincare #selflove #threadaccount #follow #twitter #niche #fff #selfcarethread #twitterthreads #love #cute #memes #like #lfl #twitterthread #selfcareaccount #beauty #bhfyp #coronavirus #medecine #viral #virus #aestheticthread
2231620096057474889; 1; False; 1580249867; Hoy en #CMin: :small_blue_diamond:Activado el protocolo de detección del #coronavirus :small_blue_diamond:Ayudas para los afectados de la #BorrascaGloria :small_blue_diamond:RD que modifica las #ayudas a Entidades Asociativas Agroalimentarias :small_blue_diamond:RD sobre la estructura orgánica de departamentos ministeriales _ Más información en: www.lamoncloa.gob.es #GobiernoadeEspaña #ConsejodeMinistros #Gobierno #LaMoncloa
2231618337182676954; 0; False; 1580249867; Doctors 365 is an online platform that offers specialized medical services to patients across the globe. Find your doctor in your language. www.doctors-365.de Doctors 365 on AppStore #coronavirus #healthcare #prevention
2231619960748392077; 2; False; 1580249866; Bu depremin ülkemizde olduğunu tahmin bile etmek istemiyoruz :crying_face: [Japonya Depremine aittir] Kübadaki şiddete yakın olduğu için paylaşma gereği duydum. #corona #coronarvirus #koronavirus #virüs #deprem #çin #Wuhan #türkiye #almanya #istanbul #izmir #adana #gaziantep #tsunami #hastalık #coronavirues #CoronaVirus #takipçikazan #gt #antalya #trabzon #afad #haber #SonDakika #aztagram #followme #likeme #video #küba #çin . Dünya'da Olan En Güncel Olay ve Gelişmelerden herkesten önce haberdar olmak istemezmisiniz? @reflexhaber Bizi Takip Edebilirsiniz.
2231619977039660408; 0; False; 1580249853; The design graphic of Huoshenshan Hospital, one of Wuhan's makeshift hospitals to admit novel #coronavirus patients, was released today. The hospital will cover an area of 33,900 square meters and contain different departments, including patient wards, consulting rooms, and sterilizing rooms. From design to completion only spend 6days. #chinesespeed
2231619975865873819; 0; False; 1580249853; Para disminuir el riesgo de contagio de la enfermedad se deben realizar las siguientes medidas universales de prevención: #DocCom #SalvandoVidas #Salud #CoronaVirus #Infección #Prevención #Información #AsistenciaMédica #VidaSana #ServicioMédico #Doctores #Médicos #Doctor #Descarga #App #Aplicación #Gratis #México #AméricaLatina #TeleMedicina #Perú #Colombia #Brasil
2231619505648662341; 2; False; 1580249851; #coronavirus #beaware
2231619950111680274; 0; False; 1580249850; Los primeros casos de personas que se contagiaron del nuevo coronavirus fuera de China aparecieron este martes, mientras que varios países organizan la evacuación de sus ciudadanos de Wuhan... #Coronavirus #Wuhan http://bit.ly/2uJrGSF
2231619919476494886; 0; False; 1580249846; Corona virus is here people. Stay safe out there. #medicine #medicaldoctor #clinic #nurse #doctor #hospital #coronavirus #virus #medicalstudent #nursestudent #epidemic #pandemic
2231619188166144518; 0; False; 1580249837; Kadiskes Riau Himbau Kepada Masyarakat Riau tetap Tenang terkait Virus Corona #viruscorona #coronavirus #kadiskesriau #masyarakatriau #tetaptenang #beritariauhariini #beritariauterkini #inforiau_ #inforiau
2231619769839329901; 1; False; 1580249829; Protection against the coronavirus . . #coronavirus #budweiser #instagram #comedians #jokes #memes #comediansofinstagram #corona #dailypic
2231617757355795364; 1; False; 1580249828; 𝓼𝓱𝓪𝓶𝓮𝓵𝓮𝓼𝓼 :wilted_flower: . . . . . . . . . . #kobebrayant #kobebrayant:basketball: #xxxtentaction #billieeilish #istanbul #deprem #elazığ #enkaz #afat #lilpeep #edit #tecca #liltecca #world #juicewrld #tiktok #komik #mizah #aleynatilki #corona #coronavirus #koronavirüsü #china #end
2231619720877443290; 0; False; 1580249823; Coronavirus . #Coronavirus #Epidemic #Quarantine #Corona #China #Sars #Infectious #Ncov #Risk #Concept #Caption #Airborne #Pathogen #Bacteria #Hospital #Molecule #2020 #Pneumonia #Syringe #Coronaviridae #Human #Seafood #Incubation #Infect #Danger #Corona-virus #Viral #Infected #Disease #ruberkor @inzak.ru
2231619581391274470; 0; False; 1580249818; #coronavirus
2231619584210117613; 0; False; 1580249806; #virus #coronavirus #burnaby #richmond #vancouver #shanghai #wuhan #canada #disease
2231619417225947023; 0; False; 1580249786; #CoronaVirus
2231619394291456391; 0; False; 1580249784; :artist_palette: #SteveSack #Trump #obstruction #criminal #impeachment #impeach #imPOTUS #Senate #Congress #MitchMcConnell #conservatives #Republicans #GOP #hypocrites #JohnBolton #coronavirus #America #USA #US
2231619386146212958; 0; False; 1580249783; I’ve been lied to my whole life :face_with_tears_of_joy::face_with_tears_of_joy::face_with_tears_of_joy::face_with_tears_of_joy::face_with_tears_of_joy: #weebmemes #wholesomememes #oof #nicememes #normiememes #memes #funny #stupidmemes #qualitymemes #funnymemes #memesdaily #memes:face_with_tears_of_joy: #memestagram #dankmemes#memes:face_with_tears_of_joy: #memes #memesdaily #funnymemes #funny #funnyvideos #follow #followtrain #followforfollowback #followforfollowback #followbackinstantly #followfollow #follow4followback #dankmemes #dankmemesdaily #cancerousmemesforautisticmemes #canceroursmemes #deepfriedmemes #coronavirusmemes #coronavirus #tiktokmemes #explore #viral
2231619378378866863; 0; False; 1580249782; bruh 2020 has been wack so far - - - #coronavirus #2020memes #corona #coronavirusmemes #redditmemes #twittermemes #tiktokmemes
2231619372362612972; 2; False; 1580249781; Semoga kita semua dijauhkan dari segala macam virus dan wabah yang mematikan :smiling_face_with_smiling_eyes::folded_hands: #tanahlautinfo #tanahlautinfodakwah #dakwahpagi #selfreminder #hadistrasulullah #hadist #wabah #virus #corona #coronavirus #wuhan
2231619228079799281; 0; False; 1580249778; Bald in München und ganz Deutschland #coronavirus
2231619313515856510; 1; False; 1580249774; So you are eating animals and scared to death of this! #Stopeatinganimals #animalrights #BeVegan #EmbraceVeganism #MeatisMurder #benicetoanimals #Repost @skinnyveganfitness with @make_repost ・・・ Mad cow disease, swine flu, now this? ⠀⠀⠀⠀⠀⠀⠀⠀⠀ How many more times does history have to repeat itself before we get the message? ⠀⠀⠀⠀⠀⠀⠀⠀⠀ For the animals, for the planet, for yourself, how many more reasons do you need to make a change? ⠀⠀⠀⠀⠀⠀⠀⠀⠀ Start your new life with free support from @_challenge22_ ⠀⠀⠀⠀⠀⠀⠀⠀⠀ Message me for any guidance :folded_hands_medium-light_skin_tone: ⠀⠀⠀⠀⠀⠀⠀⠀⠀ ⠀⠀⠀⠀⠀⠀⠀⠀⠀ ⠀⠀⠀⠀⠀⠀⠀⠀⠀ ⠀⠀⠀⠀⠀⠀⠀⠀⠀ ⠀⠀⠀⠀⠀⠀⠀⠀⠀ ⠀⠀⠀⠀⠀⠀⠀⠀⠀ #coronarovirus #coronaviruses #coronavirusoutbreak #virusoutbreak #chinavirus #coronavirus #animalagriculture #swineflu #endanimalexploitation
2231619273922764777; 2; False; 1580249769; Küba'da 7.7 Şiddetinde deprem oldu Eyalette Tsunami uyarısı verildi #corona #coronarvirus #koronavirus #virüs #deprem #çin #Wuhan #türkiye #almanya #istanbul #izmir #adana #gaziantep #salgın #hastalık #coronavirues #CoronaVirus #takipçikazan #gt #antalya #trabzon #afad #haber #SonDakika #jameika #followme #likeme #tsunami #küba #çin . Dünya'da Olan En Güncel Olay ve Gelişmelerden herkesten önce haberdar olmak istemezmisiniz? @reflexhaber Bizi Takip Edebilirsiniz.
2231619253765124287; 1; False; 1580249767; :face_with_rolling_eyes: . . . . . . . #seguidoresgratis #follow4followback #memesespañol #memes #meme #momos #momazos #momasos #humor #guayaquil #españa #ecuador #humornegro #humorespañol #risas #guayacobatracio #fit #humor #disney #cabroworld #cabronazi #hardwork #lol #empleo #valgoverga #friends #coronavirus #denge
2231619234646185199; 0; False; 1580249765; Pesan Nabi Bila Wabah Melanda Suatu Negeri. #virus #corona #china #wuhan #wuhanvirus #coronavirus
2231619154150725992; 0; False; 1580249755; #CoronaVirus
2231619112717642505; 9; False; 1580249750; Vamos lembrar de coisas importantes sobre a epidemia de Coronavírus! . . . #medicinaintegrativa #saudeintegrativa #prevenção #coronavirus
2231619093266227006; 0; False; 1580249748; #impeachment, #iran, #kobebryant, #coronavirus #naturaldisasters, #2020 has been kind of messed up...but even with these moments, we can still embrace our own worlds, our people, it’s part of why I want to write #womansworld, I don’t plan to let the breaking news stop my clarity and what is important to talk about
2231619089390113462; 18; False; 1580249747; Kobi:basketball: (deleting at 5) #meme #memes #deepfriedmemes #scarymemes #minecraftmemes #420memes #firememes #2020memes #sensitivecontent #memesdaily #memer #memez #dank #dankmemes #dankmemesdaily #deepfried #void #voidmemes #offensivememes #edgymemesforedgyteens #edgy #edgymemes #memesrlife #robloxmemes #fortnite #Minecraft #memestagram #coronavirus #newmeme
2231618937633041810; 44; False; 1580249729; Swipe left to see the projected spread of the Coronavirus vs. the actual numbers confirmed as of yesterday. Everyone stay safe out there. - - - Follow @rapsoviral for more
2231618888886338061; 0; False; 1580249724; #CoronaVirus
2231618861470721587; 0; False; 1580249720; MINISTÉRIO DA SAÚDE FOI NOTIFICADO DE MAIS DOIS NOVOS CASOS DE NOVO CORONAVÍRUS O Ministério da Saúde informa que foi notificado, até às 17h desta terça-feira (28), de outros dois casos suspeitos do novo coronavírus no Brasil. Assim, no total, três casos suspeitos da doença são monitorados pelas autoridades de saúde brasileiras. Confira matéria completa em otitulo.com.br :camera: Renata Momoe/Ascom MS #coronavirus #ministeriodasaude e #saude #jornalotitulo
2231618807432336741; 0; False; 1580249714; #Repost @davidcomlay • • • • • • :flushed_face::exploding_head::man_zombie: #coronavirus #residentevil #umbrellacorporation #racooncity I’ve been training all my life for this. #zombie #zombieapocalypse @millajovovich
2231618789010515064; 0; False; 1580249712; El nuevo #coronavirus no está circulando en #México por el momento”, aseguró el Dr. Jean-Marc Gabastou, asesor regional de la Organización Panamericana de la Salud (#OPS) durante la conferencia de prensa “Nuevo coronavirus: actualización sobre la situación en el mundo y perspectivas para México”, que se llevó a cabo en la sede común de la #ONU México. A la fecha se cuentan 4,700 casos en el mundo, precisó Gabastou, 92 por ciento de ellos en #China, de los cuales 107 han fallecido.
2231618742008564116; 1; False; 1580249706; Flight from Hong Kong to Thailand. #coronavirus #airportnothospital #herdmaskunity #throwingcautiontothewind
2231618643107840833; 0; False; 1580249694; Pour one out for the homies in China. . . . . . . . #meme #dank #funny #funnymemes #memesdaily #lmfao #follow #comedy #weirdmemes #memes #memesdaily #funnymemes #dankmemes #edgymemes #offensivememes #offensive #edgy #edgycontent #edgymemes #original #edit #originalmeme #corona #coronavirus
2231618605242290750; 0; False; 1580249690; #CoronaVirus
2231618596692308997; 0; False; 1580249689; TTT 16 Summer Hatin’ #Auspol, #Bushfires, #Coronavirus, #Nzpol, #WaitangiDay
2231618568255427316; 3; False; 1580249685; #coronavirus
2231618422662241228; 0; False; 1580249673; Uhan şəhəri çində polisin özünnən getmə anı o yerindəcə öldü #cin #çin #aztagram #baku #azerbaycan:Azerbaijan: #koronavirus #coronavirus
2231618448400456155; 7; False; 1580249671; C O R O N A V I R U S - A N D - C H I L D R E N Novel Coronavirus (2019-nCoV) is a brand new virus not yet seen before in humans. It belongs to the family of viruses that include the common cold, SARS and MERS. It is still unsure exactly where the virus has come from, but it is thought to have emerged from another animal source. The virus was discovered after a pneumonia outbreak in the city of Wuhan, China. Coronavirus symptoms include - Fever - Cough - Sore throat - Difficulty breathing (mild-severe respiratory illness) Transmission: It is not clear exactly how it is spread, but respiratory droplet is the most likely mode of transmission. This includes coughing, sneezing, or transferring of infectious mucous such as saliva or nasal secretions to another person. How do I protect myself, and my children to a virus that we don’t know much about? - HANDWASH! - Avoid anyone with the above symptoms (especially with a known Coronavirus contact) until a diagnosis is made. - Keep your children home from childcare/school with the above symptoms (like any other time) - Maintain high levels of respiratory hygiene (aka sneeze into a tissue, clean frequently touched surfaces and object etc). Until more information is discovered, Coronavirus should be treated like any other infectious disease. Children, the elderly and people with underlying health conditions may be at increased risk for severe disease from the virus. Side note: Masks are not recommended for children under the age of 14 due to their smaller lung capacity, and inability to breathe through the increased resistance through the mask. There is a risk of suffocation. I’ll keep updating you with any new information that I come accross. These screen shots are from https://docs-edu.govcms.gov.au/system/files/doc/other/factsheet_for_parents_0.pdf *Information correct on day of posting.
2231618437143416691; 12; False; 1580249670; Sobe para três, o número de suspeitos de estarem contaminados com o coronavírus no Brasil, segundo o Ministério da Saúde. Além da jovem de Belo Horizonte, há um paciente sendo observado em Curitiba e outro em Porto Alegre. Especialistas acreditam que é “absolutamente possível” que o coronavírus seja transmitido pelos olhos. O contágio ocorreria quando o paciente encosta as mãos infectadas junto ao globo ocular. Especialistas em contágio da infecção ouvidos ainda ressaltam que o vírus pode se propagar por meio de tosses e espirros. Desse modo, o vírus percorreria o corpo até chegar aos olhos. Na China, 81 pessoas já morreram em decorrência da infecção. Nas Filipinas, há uma família brasileira internada com suspeita de ter contraído o vírus. #virus #sus #saude #coronavirus #brasileiros #medicina #minasgerais #curitiba #portoalegre #brasil #ceara #fortaleza #infectologia #infecção #nordeste #noticias
2231618363902249685; 10; False; 1580249661; Südlich des Weißwurstäquators ist es nun auch angekommen. Darauf erstmal ein Corona Extra. (Achtung Satire) #schabernack #sachthemen #zerstörer #coronavirus #politicalmemes #germanmeme #jungeunion #angelamerkel #akk #satire #humor #fridaysforfuture #gretathunberg #climatechange #niemehrcdu #climatestrike #memes #bundestag #meme #philippamthor #philipp #amthor #cdu #csu #politik #politics #eu #europeanunion #lustig #deutschememes
2231618302722193185; 0; False; 1580249654; :folded_hands::flushed_face::face_without_mouth: #coronavirusoutbreak #coronavirus #cleaning #lysol #influencer
2231616127046006959; 3; False; 1580249652; this is one of the songs from my second álbum. Video made by Ander Zubieta. Follow me on Spotify and YouTube (Saito Gamu)
2231618265445282962; 0; True; 1580249649; :thinking_face: ceci est le brevet du Coronavirus Respiratoires Canin. Breveté en 1984, la validité du brevet vient d’expirer. Maintenant que le brevet est expiré n’importe qui peut faire un vaccin pour des millions de gens à des fins préventive dans avoir à payer de redevance. #coronavirus #healthyfood #death #mordoreye #cashmoney :slot_machine: #jackpot
2231618267416284746; 1; False; 1580249649; It's been proven that coronavirus is contagious during incubation period although maybe less contagioat that stage. It can also be transmitted through the eyes. It's not alive in the air but drops to the ground. PLEASE BE CAREFUL everyone!! Stay safe :raising_hands::sparkling_heart::heavy_heart_exclamation: (also did a short video on it - youtube channel link in bio) #coronavirus #health #safety
2231618256771058431; 0; False; 1580249648; #koronavirüsü #coronavirus #aksaray #izmir #istanbul #ankara #adana #antalya #izmit....
2231618093677913838; 0; False; 1580249645; #coronavirus #backtoschool lol hahaha
2231618089770127680; 0; False; 1580249640; Sígueme para mas memes:face_with_tears_of_joy: : : : : #memesgraciosos #idioteces #tonterias #coronavirus #estupideces #alv #memesenespañol #memesrandom #random #re100hornea2 #jajajaja #momasos #momasosprro #momasosespañol #tiktok #momasos4people #memes
2231618151049431645; 0; False; 1580249636; Looking for Coronavirus protection? Dräger X-plore 1350 N95 Particulate Respirator with Exhalation Valve, 10 Pack, Size M/L, NIOSH-Certified, Disposable Dust Mask, Adjustable Head Harness, Low Breathing Resistance. Contact us via Bio. On-Line Store www.thesafetyequipmentstore.com #n95mask #N95-Respirator #Coronavirus-protection
2231618123667591920; 0; False; 1580249632; Oh no el #coronavirus de nuevo :rolling_on_the_floor_laughing::rolling_on_the_floor_laughing::face_with_tears_of_joy::rolling_on_the_floor_laughing::rolling_on_the_floor_laughing: #coronavirusmemes @coronavirusmemes @memes.coronavirus #memesespañol #memesgraciosos @memeroslatinos @originalmemeflix @memeroskings @memesdecolombiaoficial @memesscolombianoss @memecolombianos @memes_colombia_pagina_oficial
2231618112369592968; 0; False; 1580249631; #KapsulSihat #CoronaVirus 1. Selain amalkan kerap mencuci tangan dengan air dan sabun, pastikan juga kalian simpan sanitizer tangan bersama-sama. 2. Ketika musim wabak menyerang, hand sanitizer menjadi alat pelindung keselematan yang sangat penting selain face mask 3. Di sebabkan virus ini ‘airborne’ dan terapung di udara, ia juga boleh melekat di mana-mana permukaan seperti pemegang tombol pintu, tandas awam, meja kedai makan atau mana-mana saja tempat yang manusia boleh bersentuhan. 4. Justeru, menggunakan hand sanitizer adalah kaedah paling cepat untuk membantu menyingkirkan kuman kerana ia tidak perlu dibilas semula dengan air. 5. Walaupun pada label packaging ia menyatakan boleh membunuh 99% kuman/bakteria, namun ia tidak berupaya membunuh salmonella, e colli, MRSA dan norovirus. 6. Namun begitu, yang terbaik ialah kita tetap mengambil langkah keselamatan dan pencegahan dari penyakit lain yang berjangkit yang menunjukkan simptom yang sama iaitu batuk dan selesema. 7. Untuk menggunakan sanitizer tangan dengan betul: :play_button: Picit sejumlah hand sanitizer di tapak tangan. :play_button: Gosok kedua-dua belah tapak tangan bersama. :play_button: Gosok juga di bahagian atas keseluruahn tangan anda, dan antara jemari anda sehingga kering. 8. Oh ya, pastikan pilih hand sanitizer yang mengandungi formulasi Alkohol di dalamnya sekurang-kurangnya 60% untuk memerangi kuman. Jika kurang dari 60% atau tiada alkohol, ia mungkin kurang berkesan. 9. Yang jenama Hovid QuicKlean ini mengandungi 70% Alkohol. Ada 2 saiz, kecil (travel saiz) dan besar untuk family. Guna lah apa-apa jenama pun tak apa asalkan ia dapat membantu membunuh kuman. Silakan #Share untuk panduan bersama. Ony Nurhusni Stay safe. Stay clean.
2231617981766717975; 0; False; 1580249625; Sígueme para mas memes:face_with_tears_of_joy: : : : : #memesgraciosos #idioteces #tonterias #coronavirus #estupideces #alv #memesenespañol #memesrandom #random #re100hornea2 #jajajaja #momasos #momasosprro #momasosespañol #tiktok #momasos4people #memes
2231618050770427357; 0; False; 1580249624; Protect yourself against coronavirus :double_exclamation_mark: #healthcare #nigeria #savenaija #nigerianhealth #ministerofhealth #homehealth #nursesinNigeria #accesstohealthcare #unitednations #wellnessinNigeria #naijaconnect #naija #healthyliving #mfchh #healthcare #nigeria #naija #savenaija #nigerianhealth #homehealth #nursesinNigeria #accesstohealthcare #unitednations #wellnessinNigeria #naijaconnect #naija #healthyliving #nigeriahealthcare #doctorsinnigeria #worldhealthorganization #nationalinstitutesofhealth #healthylifestyle #onlyinnigeria #healthcareadministration #healthcaretips #nurses #healthprofessionals #handicapped #elderlyinnigeria #healthcareadministration #healthcaremanagement #nursinghomes #worldhealthorganization #coronavirus
2231618047425094742; 0; False; 1580249623; #CoronaVirus
2231618047626440724; 1; False; 1580249623; 2020 is cursed:face_with_tears_of_joy::face_with_tears_of_joy: Follow @god.of.memes.1 for more:winking_face: Ignore ~ ~ ~ ~ #dankmemes #ww3memes #memesdaily #memes #memes:face_with_tears_of_joy: #meme #coronavirus #wholesomememes #memed #memez #memer #memestar #memedaily #memegod #memelord
2231617998276597854; 1; False; 1580249617; Next time you get a cold or flu don’t waste your time with antibiotics. :sneezing_face: They won’t work! Antibiotics only inhibit the growth of BACTERIA not Viruses. Antibiotics break down the capsule that surrounds the bacterial cell and slow down it’s growth. Viruses are different, in that they insert their genetic material into the DNA of their host. Which means that there is nothing specific to target without harming the host themselves. #washyourhands #handhygiene #coughetiquette #sneezeetiquette #droplettransmission #coronavirus #host #dna #rna #virus #bacteria #antibiotics
2231617968933357382; 0; False; 1580249614; The coronavirus outbreak is more than enough reason for the citizens of every country on Earth to storm every government building and bank and burn them. What we know about the current coronavirus is that it's a new upgraded version of the one created in a lab and patented years ago. The original coronavirus was manufactured from SARS with the help of the CDC, which is a U.S. Government agency, and the Bill & Melinda Gates Foundation. Government and private corporations CREATED this monstrosity and patented it! The Chinese corporation for biological weapons that's responsible for the outbreak simply enhanced this weapon before releasing it deliberately or accidentally onto the masses. You can see the patent yourself: https://patents.google.com/patent/US7220852B1/en It's a business, folks, and entertainment for the banking elites. This sadistic social order has been going on for far too long. It must come to an end. Government buildings and banks must burn. Switzerland (the world's ONLY democracy) is a living proof that citizens can govern themselves free form politicians and the bankers who puppeteer them. In Switzerland, political decisions are made through national referendums by ALL citizens, not behind closed doors by politicians. In a world where there are masters (leaders in doublespeak), there'll always be slaves. It's time for slavery to end. #Event201 #CAPS #2019nCoV #Coronavirus #CEPI #INOVIO #MunichSecurityConference #mRNA #mRNAVaccine #Epidemic #BillGates #MelindaGates #BillAndMelindaGates #BillAndMelindaGatesFoundation #Epidemiologists #Moderna #GlobalPandemic #Pandemic #China #Wuhan #WuhanCity #MERSCoV #NuclearWar #NuclearPhysicist #NuclearWeapons #CoronavirusPatent #PopulationControl #FamilyPlanning Sources: https://is.gd/8GeVfc https://is.gd/GCrX8V https://is.gd/mPMLRz https://is.gd/j9psgS https://is.gd/pnc7Uv https://is.gd/B8DIK0 https://is.gd/e7tZkC https://is.gd/eRW1Zk https://is.gd/87jYmN https://is.gd/cZyU0m https://is.gd/enK5nM https://is.gd/y9P0Wg https://is.gd/xGo7ae https://is.gd/zp578d https://is.gd/1Wir8d https://is.gd/bBjq66 https://is.gd/j5EvgI
2231617964856103033; 0; False; 1580249613; Epidemia da #Coronavirus: vietato l’atterraggio a #Pescara di voli provenienti dalla #Cina Il Ministero della Sanità emana il provvedimento a tutela della salute pubblica e dirotta i voli su Fiumicino dove è stato attivato il cordone sanitario. In aumento i casi di #infezione #chinavirus
2231617745694685691; 1; False; 1580249605; Sígueme para mas memes:face_with_tears_of_joy: : : : : #memesgraciosos #idioteces #tonterias #coronavirus #estupideces #alv #memesenespañol #memesrandom #random #re100hornea2 #jajajaja #momasos #momasosprro #momasosespañol #tiktok #momasos4people #memes
2231617854772796496; 1; False; 1580249600; What are your plans?
2231617824078303021; 0; False; 1580249597; Spaß beiseite wir sollten das Thema doch ernst nehmen denn es ist ernst ! Leute es ist wichtig Mundschutz zu tragen besonders an Orten wo sehr viele Leute sind ! :red_heart: #coronavirus :face_with_tears_of_joy: #sladkabella #sladkabellafanpage #followher #likeforsladka #sladkabellafans #likeforlikes #lileforfollow #followthisgirl #followfofollow #arianagrande #sladkabella #sladkabellafanpage #followher #likeforsladka #sladkabellafans #likeforlikes #lileforfollow #followthisgirl #followfofollow #arianagrande #likeforlikes #deutschrap #leute #shirindavid #lucy #rap #katjakrasavice #likeforcomment #shirindavid #deutschrap
2231617793493008487; 0; False; 1580249593; Langkah pencegahan penularan Novel #coronavirus (#2019nCoV) bagi barangan dari China. . :camera:: @kementeriankesihatanmalaysia #WuhanCoronovirus #KoolPrihatin #KoolFM
2231617252184463329; 2; False; 1580249592; Wuhan is way worse than any mainstream media is willing to report on. The communist Chinese government is continuing to suppress the truth. Here is another shot inside of wuhan.#Repost @coronavirusofficialnews with @make_repost ・・・ I can't take it anymore ... Seeing my city friends like this, a mother who died on the ground in front of her baby ... I can't take it anymore, I think I'll shortly take my life ... ------ #coronavirus #wuhan #virus #china #panic #police #helpwuhan #helpme #suicide
2231617783610582152; 0; False; 1580249592; According to a few media outlets, the coronavirus from Wuhan may have originated in snakes:snake: (or an infected bat :bat:). If you’ve been in any public areas lately (especially on the west coast), you feel the sentiment: :face_with_medical_mask:Don’t. Fucking. Cough. Near. Me.:face_with_medical_mask: Sending lots of love and light to those dealing with this particular strain of flu, the regular flu, and anyone else under the weather. :two_hearts:stay safe out there kiddos. #satire #snakememes #slytherin #coronavirus #memes #coronavirusmemes #fluseason #losangeles #overheardla #portland #seattle #lax #pdx #seatac #airplanetravel #dontbreatheonme #plsdontbreatheonme #:face_with_medical_mask: #punkrock #pfr #losangelesmusic #portlandmusic #internationaltravel #breathe
2231617784945530178; 0; False; 1580249592; #inlandempire #coronavirus #coronavirusoutbreak #coronaviruschina #coronavirusontario
2231617651784247014; 0; False; 1580249576; #dengue #coronavirus
2231617653267700897; 0; False; 1580249576; #coronavirus #coronavirusmemes #podcast
2231617632566921526; 0; False; 1580249574; Everybody Was Kung Flu Fighting!! #medicaltalks #medicine #virus #pandemic #corona #coronavirus #flu #influenza #misanthrope #brainwashedsociety #medicalmemes #sickhumor #wuhanvirus #wuhanchina #darksenseofhumor
2231617550449694983; 0; False; 1580249574; Sígueme para mas memes:face_with_tears_of_joy: : : : : #memesgraciosos #idioteces #tonterias #coronavirus #estupideces #alv #memesenespañol #memesrandom #random #re100hornea2 #jajajaja #momasos #momasosprro #momasosespañol #tiktok #momasos4people #memes
2231617583902552463; 2; False; 1580249568; Strength and Courage - Big painting of Love dedicated to the people of Wuhan, China; :China: . . . ( 125 x 270 cm - acrylic and paper collage - 2020 ) . . . #strength #courage #love #wuhan #china #coronavirus #wuhanchina #staypositive #contemporaryart
2231617540768376697; 0; False; 1580249563; :globe_showing_Asia-Australia::globe_showing_Americas::globe_showing_Europe-Africa: #virus #coronavirus #update #news #takecare #warning #watchout
2231617531809096881; 0; False; 1580249562; Medidas de prevenção do Coronavírus!!! #ministeriodasaude#prevencao#saudepublica#coronavirus
2231617397474433481; 0; False; 1580249546; #infografica del giorno.. Una mappatura sui casi di #Coronavirus nel mondo. Dove ha colpito di più il #virus?
2231617360707254302; 0; False; 1580249541; A new respiratory virus first detected in the Chinese city of Wuhan has infected more than 4,500 Chinese citizens and claimed more than 100 lives. The fast-spreading infection, which causes pneumonia-like symptoms, has prompted Chinese authorities to quarantine several major cities and some Lunar New Year events were cancelled. 20 Jan: 291 cases. 22 Jan: 446 cases. 24 Jan: 864 cases. 26 Jan: 2021 cases. 28 Jan: 4524 cases. . . . . Source: @bbcnews #bbcnews #china #wuhan #government #virus #coronavirus #outbreak
2231617347227997132; 0; False; 1580249540; #CoronaVirus
2231617341841103960; 0; False; 1580249539; #spätdienst#spaß-bei-der-arbeit-tag#28.01.#evakuierung#sind gewappnet#coronavirus#klinikumlandsberg#wirsindvorbereitet
2231617264508288207; 0; False; 1580249530; This is the end #corona #coronavirus #memes #meme
2231617207263430196; 1; False; 1580249523; Adam haklï beyler #magnolia #corona #coffee #coronavirus #geritakip
2231615606524671937; 12; False; 1580249514; Sıra için kavga eden çin halkı #koronavirüsü #koronavirus #çinvirüsü #sondakika #sondakika #önemli #china #news #breakingnews #breaking #haber #gündem #coronavirus#sondakika #önemli #haber #gündem #karantina #coronavirüsü #koronavirus #koronavirüsü #Wuhan kentindeki sağlık çalışmaları yetmiyor. Çin'de karantina altına alınan şehir sayısı yükseliyor. Daha fazlası için takip etmeyi unutmayın :red_heart: @saglikbakanligi Daha fazlası için takip etmeyi unutmayın :red_heart: #corona #coronavirus #türkiye #tsk #hastalik #istanbul:Turkey: #kolombiya #istanbul #saglikbakanligi #cin #çin #woman #coronavirus #abd #trump #salgın #virus #
2231617085495320993; 0; False; 1580249509; The look you make when you have bought tickets for a trip to #china with one of your kids and there's this #coronavirus thing going on. :woman_facepalming::woman_shrugging::face_with_tears_of_joy: #ofcourse #justmyluck #travel #whatevs #familytravel #asiatravel #travelasia #frankstonsouth #morningtonpeninsula
2231616320679724424; 0; False; 1580249505; :eyes::face_with_monocle::thinking_face: #28Ene #Coronavirus #China :China: la población de #Wuhan tratando de huir de la zona de cuarentena es repelida por la policía. ⠀⠀⠀⠀⠀⠀ ⠀⠀⠀ ⠀⠀⠀⠀⠀⠀ ⠀⠀⠀⠀⠀⠀ ⠀⠀⠀⠀⠀⠀ ⠀⠀⠀ ⠀⠀⠀⠀⠀⠀ ⠀⠀⠀⠀⠀⠀ ⠀⠀⠀ ••••••••••••••••••••••••••••••••••••••••••••••••••••••••••••••• ⠀ @doblemoralrd noticias #actualidad #internacional #republicadominicana #view #alerta #novedad #viral #rd #dominicannetflix #doblemoralrd #dominicana #faride #licey #peru #lebron #trump #cualquiera #alertamundo #coronavirus #wuhan #china #cuba #jamaica #islacaiman
2231617040490635925; 0; False; 1580249503; مهندس آقاخانی09123349420 #آبنما_پرده_ای_استیل#آبنمافیبرنوری#آبنما_شیشه_ای#آبنما_فواره_ای_هوشمنده#دیجیتال#ابنما_حبابدار#آبنماحباب#حبابنما#آبنمای_حبابی#آبنما_لاکچری#ا#لابی#استخر#پذیرایی#پزشکان#هتلی#بیمارستانی#پاسیو#تابلو#مطب#نورپردازی#رقص_نور#دندانپزشکان#نورپردازی#کافی_شاپ#رستوران_سنتی#رستوران_مدرن#لاکچری#مدرن#ویروس کرونا#coronavirus Www.sohadesign.ir
2231616982625692625; 3; False; 1580249496; 有備無患 유비무환:goblin::person_fencing::stop_sign::cross_mark: #no#coronavirus#우한폐렴
2231615855347876599; 0; False; 1580249496; :exclamation_mark::exclamation_mark::exclamation_mark::exclamation_mark::exclamation_mark::exclamation_mark::exclamation_mark::exclamation_mark::exclamation_mark::exclamation_mark::exclamation_mark::exclamation_mark::exclamation_mark::exclamation_mark::exclamation_mark::exclamation_mark::right_arrow: @coronavirusoffiziell :left_arrow: Подпишись и будь в курсе всех новостей о коронавирусе :police_car_light: Subscribe and stay informed #pray #prayer #nature #indonesia #sydney #carlinhosmaia #bbb20 #anitta #bts #justinbieber #newyork #prayforrevival #prayforhealing #hope #Jesus #life #viruscorona #love #помощь #coronavirus #коронавирус #вирус #virus #china #china:China: #ухань #китай #bbc #news #новости
2231616981415664408; 0; False; 1580249496; . :microbe: “Os coronavírus (CoV) são uma grande família de vírus que causam doenças que variam do resfriado comum a doenças mais graves, como a Síndrome Respiratória do Oriente Médio e a Síndrome Respiratória Aguda Grave”. . :microbe: Eles podem ser transmitidos por animais e pessoas e recebem esse nome por terem, em sua membrana, picos projetados que se assemelham à coroa do sol. . :microbe: Contágio: Geralmente, coronavírus são passados por contato direto entre humanos, por meio de tosse ou espirro. . :microbe: Prevenção: As medidas de proteção contra o coronavírus é semelhante às de gripes e resfriados: - limpar as mãos com freqüência usando álcool ou sabão e água; - evitar contato próximo com quem tem febre e tosse; - procurar atendimento médico se apresentar febre, tosse e dificuldade em respirar; - evitar o consumo de produtos de origem animal crua ou mal cozida. . :microbe: Sintomas: Os sintomas incluem febre alta, tosse, dificuldade para respirar e lesões pulmonares. . :microbe: Devo me preocupar? . Com a disseminação do vírus para outros países e a circulação de pessoas, a chegada do coronavírus ao Brasil é uma ameaça possível. Mas, no momento, não há indícios de circulação desse vírus. Por isso, deve ser uma preocupação, mas não motivo para pânico. . . . . . . . . . . #farmacia #farmaciaporamor #saude #saudeebemestar #farmaceuticodigital #farmaceutica #farmaciadicas #dicas #farmaceuticaantenada #farmaceuticaempreendedora #farmaceuticando #empreendedorismo #cursofarmaceutico #prescriçãofarmacêutica #orientacaofarmaceutica #indicaçãofarmacêutica #atendimentoaocliente #estudantedefarmacia #estudantesdefarmácia #farma #farmas #cursoonline #farmaceuticoclinico #farmaciaclinica #interacaomedicamentosa #farmaceuticodesucesso #farmaceuticodevalor #recemformado #coronavirus
2231616923920200544; 0; False; 1580249489; Fears surrounding the #coronavirus outbreak eased slightly on Tuesday following mass panic early in the week. Investors were highly risk averse on Monday, fearing a potential of a wide-spread #Epidemic, and flocked to perceived safe-haven markets to begin the week strongly. (Link in the bio:index_pointing_up:) #coronavirus #wuhan #china #investors #wuhancoronavirus #trading #stock #stockmarket #health #virus
2231616922552641948; 0; False; 1580249489; Better wear than sorry :OK_hand: 你带了吗? :winking_face_with_tongue::zany_face::face_savoring_food: Love yourself & your family :face_with_medical_mask: #coronavirus #precaution #ratyear
2231616861811202519; 0; False; 1580249482; #Trabajadores fabricando #mascarillas en el taller de una compañía en #Changyuan, centro de China. Para ayudar a combatir el brote de neumonía causada por el nuevo #coronavirus
2231616354442702315; 0; False; 1580249465; #Repost @_scorpione_62 with @get_repost ・・・ Reposted from @fightdogmeat_dot_com CHINA: Haven Dogs Running Out Of Food. The coronavirus epidemic is affecting the Haven Sanctuary. They can’t buy kibble and there’s no deliveries. They need to buy sacks of rice for 200+ dogs, while they can. Please help if you can: PAYPAL: Donate@FightDogMeat.com. Fight Dog Meat. Registered Charity. #fightdogmeat #dog #dogs #china #china:China: #coronavirus #coronavirusoutbreak - #regrann
2231615525137850770; 130; False; 1580249465; EMOCIONANTE: Vídeos mostram moradores de Wuhan (epicentro do surto do Coronavirus :microbe:) na varanda de seus apartamentos gritando pelas janelas e cantando canções patrióticas e o hino da China para se animarem. Os vídeos estão se propagando nas redes sociais. . Wuhan, com 11 milhões de habitantes está em quarentena. A cidade está isolada pelo Governo chinês desde quinta-feira (23). Ruas e aeroportos vazios, mas hospitais continuam lotados. . #pandemia #Wuhan #oms #saude #virus #alerta #noticias #noticia #notícia #notícias #news #MinhaCapital #Brasília #Brasilia #BSB #MinasGerais #Coronavirus Vídeo: reprodução
2231616697318945438; 2; False; 1580249462; ALERTA #coronavirus
2231616633565277209; 2; False; 1580249455; FUCK follow @brightdots.jpeg . . . . . . #dankmemes #urmomgay #papafranku #cancermemes #coronavirus #memes:face_with_tears_of_joy:
2231616638120995350; 0; False; 1580249455; Why don’t they close the boarder? What if all those people just took antipyretics to get home by all means?!#corona #coronavirus #outbreak #canada #toronto #chi #wuhan #usa
2231616055061531319; 0; False; 1580249412; Koronavirusu metroda özündən getmiş gənc çinin pekin şəhəri #cin #çin #aztagram #baku #azerbaycan:Azerbaijan: #koronavirus #coronavirus
2231615318132198999; 2; False; 1580249298; Uma semana após ter sido alertada sobre diversos casos de pneumonia em Wuhan (China), causadas por um vírus não identificado, a OMS reconheceu, em 7 de Janeiro, a descoberta de um novo coronavírus, chamado temporariamente de 2019-nCoV. Os coronavírus pertencem à família de vírus chamada Coronaviridae, que tem representantes que vão desde um vírus simples de gripe até doenças de maior risco à saúde, como é o caso da SARS (do inglês Severe Acute Respiratory Syndrome, detectada pela primeira vez em 2002, na China) e da MERS (do inglês Middle East Respiratory Syndrome, com primeiro caso registrado em 2012). :question_mark:Por que o Novo Coronavírus tem assustado autoridades? Apesar de os coronavírus terem uma transmissão menos intensa do que o vírus comum da gripe (Influenza), por exemplo, há uma preocupação com o surgimento de novos casos sem existência de tratamentos específicos. O número de mortes confirmadas pelo 2019-nCoV é de 106 indivíduos e mais de 4 mil casos registrados em 13 países até a noite de 27/01. :exclamation_mark:A transmissão ocorre por contato com gotículas de saliva e secreções, contato pessoal próximo à pessoas contaminadas e contato com objetos contaminados seguidos de toque em boca, nariz ou olhos. :exclamation_mark:Para prevenir, é recomendada a lavagem frequente das mãos, utilizar lenços descartáveis para higiene nasal, cobrir nariz e boca ao espirrar ou tossir, não compartilhar objetos de uso pessoal (talheres, pratos, garrafinhas, copos), manter os ambientes bem ventilados, evitar contato com pessoas que apresentem sinais da doença. :double_exclamation_mark: Ainda não existem casos confirmados no Brasil, mas se você teve contato com alguém com suspeita diagnóstica de 2019-nCoV e/ou esteve num dos países com casos confirmados nos últimos 14 dias, e começa observar os sintomas de febre, tosse e dificuldades para respirar, procure atendimento médico para diagnóstico preciso e tratamento adequado. . Fontes: who.int / saude.gov.br . #who #oms #coronavirus #prevention #prevencao #saude #atencaoprimaria #sus #fonoaudiologia
2231611994683526069; 2; False; 1580249035; Wuhan！Stay Strong！China！Stay Strong！their determination of fighting the novel coronavirus outbreak to the very end！#coronavirus
2231612114665227558; 2; False; 1580248916; #shrimp #shrimpgang #meme #memes #funny #dankmemes #memesdaily #funnymemes #lol #dank #humor #like #follow #lmao #dankmeme #edgymemes #offensivememes #anime #love #fortnite #comedy #dailymemes #edgy #fun #memestagram #funnymeme #instagram #china #corona #coronavirus
2231611510460106481; 11; False; 1580248844; We’d be better off without both :grinning_face_with_sweat:
2231601931791390950; 0; False; 1580247776; Koronavirus bağlı mübarizə davam edir hazirda 20 nəfərdə bu xəstəlikdən düniyasin dəyişdi #cin #çin #aztagram #baku #azerbaycan:Azerbaijan: #koronavirus #coronavirus
2231601175063662206; 0; False; 1580247612; Coronavirus 1960 ci illərdə səudiyyə ərəbistanı çin və s kimi ölkələrdə var idi amma indi ki, kimi sürətlə yayilmirdi #cin #çin #aztagram #baku #azerbaycan:Azerbaijan: #koronavirus #coronavirus
2231529901708587462; 66; False; 1580239115; @xijinping #xijinping can you spray by aircraft and tube structures areas to sterilize neutralize?... lets have fun, America has a lot of mean men!
2230758232452707812; 4; False; 1580147125; GG -Embeces:alien: :copyright: :copyright: :copyright: :copyright: :copyright: :copyright: :copyright: :copyright: :copyright: :copyright: #dank #dankmeme #dankmemes #shitposting #posting #dylanteromeme #chile #chilememe #chilememes #Chilegram #instachile #instamemes #instameme #video #memes #meme #coronavirus #virus #brote #plaga
2201696166633075911; 1; False; 1576682657; Cristina Blackwell, Cristina MacArthur #cristinablackwell #cristinamacarthur #crisblackwell #cute #instacute #instafun #japanesefood #doll #livingthedream #insta #wuhan #coronavirus
1792241711626248461; 6; False; 1527871882; Come prepared with your disposable tray table cover. #flyclean #nogerms #allergyhelp #southwestairlines #nonuts #upgraded #coronavirus #coronaviruses #coronavírus #coronav
2231616601010783678; 0; False; 1580249451; #china #coronavirus ....#bothitharman :rolling_on_the_floor_laughing::face_with_tears_of_joy::grinning_face_with_big_eyes::grinning_face_with_smiling_eyes::beaming_face_with_smiling_eyes:
2231616388307362846; 10; False; 1580249444; Tents set up @ the hospital for the Corona virus #coronavirus
2231616486464840934; 0; False; 1580249437; Koronavirus için yeni tehlike : Çin'den satın alınan ve gönderilen kargo paketlerinden virüsün tüm dünyaya yayılma ihtimali var!... #coronavirus @çin #virus #cin #aliexpressturkey #aliekpress @yeniseksenlerdizisi @siyahbeyazreplikler
2231616486682535936; 1; False; 1580249437; Dica importante Principais sintomas clinícos do novo Coronavírus são principalmente respiratório, semelhantes a um resfriado. Podem, também, causar infecção do trato respiratório inferior, como as pneumonias. Febre Tosse Dificuldade para respirar. Obs. Em caso de suspeita procure um médico. #coronavirus #prevencao #saude #ClinicaEssencele #cuidamosdasuasaude #nutrologia #clinicamedica
2231616443807805834; 0; False; 1580249432; L:cyclone: •⁣ Send this to a friend:cyclone: •⁣ •⁣ #meme #memes #ps4 #wshh #hood #coronavirus #funny #xbox #dankmemes #offensivememes #edgymemes #spicymemes #69 #memepage #gaming #dank #memesdaily #shitpost #dankmeme420 #hiphop #witcher #worldstar #grapejuiceboys #playstation #worldwar3 #sexy #corona #weed #reddit #420 •⁣
2231616391698190545; 0; False; 1580249426; Read the labels to what you eat! Read the side effects of the medicine you take! Look for alternatives that are healthy! #healthyfood #healthylife #healthy #heartbroken #heartattack #corona #coronavirus #usa #maga #trump #kobebryant #floridadoctors #loveyourself #boxing #mma #biking #drifting #boxer #fighter #fitfam #fitness #diet #healthydiet #appreciation #meditate #medical #medicinalherbs #medicine #bigpharma #pharmaceuticals
2231616098600565217; 2; False; 1580249411; Apoya para seguir así: :backhand_index_pointing_right::red_heart::backhand_index_pointing_left: . #humor #memes #divertido #coronavirus #china
2231616257672503464; 4; False; 1580249410; Koronavirus için yeni tehlike : Çin'den satın alınan ve gönderilen kargo paketlerinden virüsün tüm dünyaya yayılma ihtimali var!... #coronavirus @çin #virus #cin #aliexpressturkey #aliekpress @yeniseksenlerdizisi @siyahbeyazreplikler
2231615943805345550; 17; False; 1580249392; Sebuah rekaman video memperlihatkan seorang turis asal China meradang lantaran harus menjalani serangkaian tes untuk mencegah masuknya virus Corona dari Wuhan di Bandara Senai, Malaysia. . Dilansir dari World of Buzz, Senin (27/1/2020), turis tersebut tampak ditempatkan di sebuah ruang. Kemungkinan besar untuk menjalani screening dari otoritas bandara. Terlihat di video itu, dia menggedor dinding kaca yang 'mengurungnya'. . Bukan cuma itu, dia bahkan mencoba untuk memanjat dinding kaca tersebut guna menarik perhatian otoritas Bandara Senai, Distrik Kulai, Johor, Malaysia. Tak pelak, polah turis tersebut membuat geger bandara. . Sekadar informasi, Malaysia kini berada di tengah kekhawatiran besar masuknya wabah virus Corona dari Wuhan, China. Alhasil, sejumlah alat screening ditempatkan untuk menyasar turis-turis yang datang dari negara tersebut. Artikel: Suara.com #jakartainformasi #jakarta #malaysia #coronavirus
2231615468859256093; 3; False; 1580249387; Be careful who you smoke with. :face_with_tears_of_joy: • • • Follow me for funny content :sleeping_face: @grabbaaddict • • • #grabba #coronavirus #comedyskits #haha #australiafires #funny #memesdaily #funnymemes #newmemes #coolmemes #ifb #twittermemes #comedypost #tiktok #wethenorth #canadian #2020 #comedy #dailymemes #edgy #memestagram #originalmemes #ww3 #514 #416 #memeita #memeoftheday #funnymemesdaily #memepages
2231616068544473624; 0; False; 1580249387; Web palestra sobre o Coronavírus. #sus #sesab #coronavirus #coronavírus #saude #saúde #vigilanciaepidemiologica #vigilanciaemsaude #vigilânciaemsaúde
2231616006130955539; 0; False; 1580249380; To reduce the risk of spreading the disease, the following universal prevention measures should be performed: #DocCom #SavingLives #Health #CoronaVirus #Infection #Prevention #HealthCare #VirtualCare #HealthyLiving #ModernHealthCare #Free #App #Download #MedicalAssistance #MedicalService #Information #USA
2231615673212173644; 0; False; 1580249366; Korronavirusuna yoluxmuş bu kişi artiq düniyasin dəyişib #cin #çin #aztagram #baku #azerbaycan:Azerbaijan: #koronavirus #coronavirus
2231615702675135805; 0; False; 1580249344; Dadurch entsteht #coronavirus #bayern @muenchen
2231615686969797493; 1; False; 1580249342; Papua New Guinea is banning travelers from Asian countries, amid growing concerns about coronavirus. There are no confirmed cases of the deadly virus in PNG, but the health department has said the country will struggle to cope if there's a local outbreak. PNG’s Immigration Minister has issued a public notice that all air and sea ports will refuse entry for travelers from Asian ports, but the notice doesn't specify which countries are included in the ban or how it will be enforced. @abcnews_au #coronavirus
2231615412309965968; 2; False; 1580249340; :heavy_large_circle::movie_camera: ساکنان ووهان چین که برای شیوع ویروس کرونا قرنطینه شده‌اند، با حضور در بالکن‌های منزل خود و با همخوانی «مبارزه می‌کنیم» به یکدیگر روحیه می‌دهند. ‌ #ووهان #چین #کرونا #coronavirus
2231615675504247479; 2; False; 1580249340; Son 1 aydır gezegenin kuzey yarısında en yoğun çalışan hekim grubu çocuk hekimleri olmuştur herhalde. Bu yoğunlukta her zaman olduğu gibi influenza = grip virüsleri bu yıl da başrolü kimseye kaptırmamakta kararlı görünüyor. :direct_hit::direct_hit::direct_hit: :direct_hit::direct_hit: :direct_hit: Önceki yıllarda Influenza A genelde perdeyi açar aylar sonra ilkbahara doğru Influenza B' ler sahneye çıkardı. Bu yıl farklı olarak yıllardır geri planda kalmaktan sıkılan Influenza B ler de sezonu aynı A tipi virüsler gibi hızlı açtı. ... .. . Bu A lar B ler nedir derseniz bunlar Influenza =grip virüs ailesinin birbirleriyle amca oğlu seviyesinde akrabalıkları olan kuzen virüsler. Influenza A denince H1N1 ve H3N2 bu coğrafyada en meşhur olan kuzenler. H1N1 eski adı -2009daki şöhretli ismi ile domuz gribi, ama artık domuzları rahat bıraktık, olaylara karıştırmayalım diyoruz , kendilerini mevsimsel grip olarak adlandırıyoruz. ... .. Influenza B ler bir miktar daha hafif seyreder diye bilirdik bu kışa kadar ama bu kış onlar da huy değiştirmiş gibi. :umbrella_with_rain_drops::umbrella_with_rain_drops::umbrella_with_rain_drops: :umbrella_with_rain_drops::umbrella_with_rain_drops: :umbrella_with_rain_drops: Grip = Influenza virüs grubunu soğuk algınlığı yapan masum canlılar Rhino virüsler ile sakın karıştırmayın. Soğuk algınlığı yapan Rhino virüsler ne yüksek ateş yaparlar ne de kimseyi hastanelik ederler. Kış sezonu boyunca hekimleri uğraştıran solunum yolu virüslerinde devler ligi yani ilk 5 sıra: 1- Influenza A ve B 2- RSV (Respiratuvar Sinsisyal virus) 3- Adeno virüs 4- Corona virüs 5- Rhino virus :tulip::tulip::tulip: :tulip::tulip: :tulip: Bu 5 çeşit virüsten aşısı geliştirilen sadece Influenza dır, şimdilik. Henüz ülkemizde sorun oluşturmamış olan Corona virüs gelirse ne yaparız düşünceleri ile enerjinizi harcamak yerine mevcut binlerce vaka sayısına ulaşmış influenza =mevsimsel grip mikrobu için RİSK GRUBU iseniz lütfeeeeen aşılanın. .. . . #gripsalgini #influenza #mevsimselgrip #H1N1 #drozlenkayacardak #pediatricianistanbul #çocukdoktoru #uphilltowers #asihayattir #yuksekates #RSV #adenovirus #coronavirus #vaccinework
2231615601474551752; 2; False; 1580249332; Yes! I’ve been having all the kids ingest Oregano and Thieves in capsules on the regular. Nature is medicine. If you haven’t gotten your starter collection of oils... NOW is the time, people! Let me help you plan your next few months of immune support. The cost is less than a trip to the ER would cost you. Message me and let’s stay healthy through this sick season!!! • • • @graceandlavender #oilsforthewin #naturesmedicine #godsmedicine #oilymama #oregano #coronavirus #healfromwithin #farmtotable #holistichealth
2231613415797078790; 0; False; 1580249326; VIRUS CORONA . 𝗟𝗜𝗞𝗘 𝗗𝗔𝗡 𝗙𝗢𝗟𝗟𝗢𝗪 𝗞𝗔𝗠𝗜 𝗕𝗜𝗔𝗥 𝗧𝗜𝗗𝗔𝗞 𝗞𝗘𝗧𝗜𝗡𝗚𝗚𝗔𝗟𝗔𝗡 𝗕𝗘𝗥𝗕𝗔𝗚𝗔𝗜 𝗞𝗢𝗡𝗧𝗘𝗡 𝗦𝗘𝗥𝗨 𝗟𝗔𝗜𝗡𝗬𝗔 . #coronavirus #coronaviruschina #infoterkini #infosurabaya #infobandung #infoindonesia #beritaterkini #beritaheboh #beritaterbaru #beritaviral #beritaindonesia #beritaharian #beritanasional #beritahariini #beritapolisi #beritamedan #kecelakaan #infounik #infosurabaya #infomedan #infokalteng #chinavirus #viruscorona #kalimantanselatan #viruscoronachina #infokalimantan :wavy_dash::wavy_dash::wavy_dash::wavy_dash::wavy_dash::wavy_dash::wavy_dash::wavy_dash::wavy_dash::wavy_dash::wavy_dash::wavy_dash: :white_medium_star:Bantu, support Follow juga ya:backhand_index_pointing_down: @atfashione Like dan komen postinganya :smiling_face_with_smiling_eyes: Terimakasih.
2231615547578439543; 3; False; 1580249325; Três casos suspeitos de coronavìrus no Brasil: São Leopoldo (RS), Curitiba (PR) e Belo Horizonte (MG) #belohorizonte #riograndedosul #coronavirus #curitiba #minas #STFVergonhaNacional #politica #ptnuncamais #ptlixo #globolixo #impeachmentgilmarmendes #brasilacimadetudo #direitaconservadora #monarquia #patriota #ptnão #foratoffoli #sergiomoro #justica #jairbolsonaro #segiomoro
2231615175591523612; 0; False; 1580249313; Çində koronarirusu səbəbindən xəstəxanalar dolub artiq yer olmadıqı görünür #cin #çin #aztagram #baku #azerbaycan:Azerbaijan: #koronavirus #coronavirus
2231615449036369843; 0; False; 1580249313; Coincidence? #coronavirus #residentevil #who #agenda21
2231615383908368788; 1; False; 1580249306; Bismillah... Sahabat Hawa, jaga kebersihan makanan, pakaian, dan pola hidup sehat selalu ya :red_heart: Dan yang paling penting, minta selalu perlindungan pada Allah Subhanahu wa ta'ala agar kita terhindar dari virus penyakit yang berbahaya. Salah satunya, yang sedang viral & mengerikan sekarang. Naudzubillahimindzalik... :face_with_medical_mask: . . . #corona #coronavirus #fiqihwanita
2231615362458526036; 0; False; 1580249303; No, el nuevo Coronavirus (2019-nCov) no es tan mortal como otros. La tasa de mortalidad del Coronavirus es de apenas el 3%, mientras que en otros virus, como el ébola, su tasa de mortalidad es de hasta el 90% en humanos. "Todo indica que la tasa de mortalidad del Coronavirus es más baja en comparación con el SARS del 2003, dijo Peter Piot a CNBC’s. Él es profesor de Salud Global y director en la London School of Hygiene and Tropical Medicine". BSLs: Hay cuatro niveles de bioseguridad. Los riesgos primarios que determinan el nivel de contención son: -Infectividad -Gravedad de la enfermedad -Forma de transmisión -Naturaleza del trabajo a realizar -Origen del agente en cuestión Más información: https://www.cnbc.com/2020/01/28/coronavirus-vs-sars-health-experts-on-the-key-differences.html #science #ciencia #biosafety #biology #biologia #virus #coronavirus #corona #SARS #china #epidemiology #medicine #medical #doctor #SARS #ebola #statistics #transmission #disease #mortalityrate #mortal #humans #animals #nature #microorganismo #microbiology #global #salud #health
2231615352576257665; 2; False; 1580249302; :exploding_head: #coronavirus #usa #unitedstates
2231614298689796267; 4; False; 1580249298; When Coronavirus chose to visit you...my broda japa Follow @the_kingcomedy Follow @the_kingcomedy @iamhearttaylor @petite_talker_ @kolaqalagbo @bwestudios @officialbossx @bwetv.ng ........ #bwe #thekingcomedy #cuppymusic #bornwinnersempire @heinekenng #heinekenng @christineptrick #thekingofcomedy #zotzone #myflatmates #tundeednut #instablog #instagood #insta #flatmate #comedy #comedyspecial #thekingsstudios #theexperiencelagos #warri #te14 #lagoscomedy #maryandjoseph #funny #naijacomedy #nigeriancomedy #lagos #2020 #coronavirus
2231615301523314597; 0; False; 1580249296; Hold up #edgy #edgymemes #goals #meme #memes #dankmemes #funny #funnymemes #funnyshit #like #follow #shitpost #spicymemes #spicy #usa #minecraft #vape #vapetricks #vapelife #swag #follow4followback #lol #smile #happy #pain #murica #minecraftmemes #coronavirus
2231615057840575092; 0; False; 1580249284; Repost @freedom_faction by @media.repost: Thoughts? Hotel staff have sent robots to deliver meals to plane passengers who were isolated for stricter screening of #coronavirus. More than 200 tourists were housed in the isolation point in #Hangzhou, east #China, after their flight landed in the city. Some of the passengers on board came from #Wuhan, the city where the virus that has killed more than 100 people originated from. To prevent cross-infection between the passengers, the hotel staff decided to deliver the meals through robots. Video taken by the guests on Sunday shows the robot stopping in front of the room doors while playing the announcement to the guests. It can be heard saying: "Hi everyone. I am now serving meals to you and if you have any meal requirements, please send us a message through WeChat. "A member of staff will contact you shortly. Enjoy your meal, thank you." A man, who wears a face mask and a long coat, opens the door, takes the food off the shelf of the robot and walks back into his room. A spokesman at Hangzhou School of Communist Party of China told Pear that they have programmed 16 robots, one on each floor across the building. He said: "We have set the route for the robots, including where to go, where to stop and to play the announcement at the door. "The robots can entertain and sing songs to the guests." Transport Minister, Grant Shapps, has said the government is working on plans to repatriate UK nationals in the city of Wuhan, where the outbreak is believed to have started. He spoke on BBC Breakfast this morning: "One of the things we’re asking people to do is to contact the consulate there to make them aware. People have started to do that. :hand_with_fingers_splayed_medium-dark_skin_tone:More in comments:backhand_index_pointing_down_medium-dark_skin_tone:#Biowarfare
2231615177447268729; 0; False; 1580249281; All man made .. purposeful #coronavirus
2231615162323262025; 0; False; 1580249279; Con la presencia del vicegobernador @drcarlosarce_ y el ministro de Salud Publica @oscar_alarcon_mtro se presentó este martes el protocolo provincial que se aplicará en Misiones para la prevención del #coronavirus denominado 2019-Cov El mismo fue dirigido a referentes de organismos nacionales y provinciales que se desempeñan en las zonas de frontera. #C6Digital #noticiasdel6 . . . . . . . . . . . . . . #posadasmisiones #argentinaig #noticiasrcn #news #instanews #flashnews #misnius (+INFO: :mobile_phone_with_arrow: www.noticiasdel6.com :desktop_computer:)
2231615134120373158; 0; False; 1580249276; #porshe #cayenne ! #luxe #kimkardashian #luxurylifestyle #luxurylife #luxury #millionaire #amant #gay #homosexuality #gaypride #lacageauxfolles #cinema #acteur #sport #cineaste #comedie #luxurycars #barbie #poupee #live #france #bitch #streptease #businessman #business #chine #coronavirus
2231615133833379720; 2; False; 1580249276; El Coronavirus es un virus que ya ha afectado a sobre 4,500 personas. Con origen en China, ya ha llegado a Europa y a América. Infórmate en nuestro post sobre esta enfermedad, su origen, qué implica y qué medidas está tomando el gobierno de Puerto Rico al respecto. #PolíticaAccesible #Coronavirus #Internacional #Noticias #China #Puerto Rico #Salud ¿Crees que el Departamento de Salud está preparado para un evento como este? Déjanos saber en los comentarios Fuentes: CNN / NIUS Diario / El Mundo / Primera Hora / Metro
2231615120654667669; 0; False; 1580249274; Actual live footage of me being social. Just kidding, I don't answer the phone ever! :face_with_tears_of_joy: Sorry for the bad news extroverts... #introvert #cats #dogs #animals #peoplesuck #napswithcats #healthy #coronavirus #snugs #cuddles #stayathome #inbed #nopeople #pawsome #caturdayiseveryday #catnaps #checkmeowt #loner #social #antisocial #hibernation #sanctuary @sweatpantsandcoffee #introverting #pajamas #nobra #textsonly :person_in_bed::paw_prints::grinning_cat_face_with_smiling_eyes::cat::pizza::television:
2231615099030669664; 0; False; 1580249272; #TixaNoTwitter. Três casos de #coronavirus. Já estamos em nível de alerta de “perigo iminente”.
2231615014740103304; 16; False; 1580249262; Jurava que era isso kkkkkkkkkkkkkk (Só pra descontrair pessoal, não levem a sério) ____________ :warning:LEIA COM ATENÇÃO:warning: . :right_arrow:Você sofre para achar conteúdo pra estudar na internet? Pois é, resolvemos isso para você!! . :right_arrow:Montamos a apostila digital com as 180 melhores perguntas e respostas de estudo para concursos públicos em enfermagem... . :right_arrow:Já foi comprovado que esse é um método poderoso de estudo, no caso específico de concursos públicos, a recomendação é fazer toneladas de exercícios de provas anteriores. . :right_arrow:E o melhor, de R$29,90 por R$19,90 , gente R$19,90 não paga nem um ingresso de cinema hoje em dia, você pode investir em você por esse valor!!!! APROVEITE!! :warning:Clique no link da descrição do perfil @enfermagem.detalhada :warning: ____________ Siga nosso instagram @enfermagem.detalhada . . #enfermagem #enfermagemporamor #enfermagemcomamor #enfermeira #nursing #enfermagemlove #enfermagemaartedecuidar #enfermagemdadepressao #enfermagemobstétrica #enfermeiro #enfermeiras #tecnicosdeenfermagem #enfermagemartedecuidar #enfermagemobstetrica #enfermagemdoamor #Enf #enfermagemminhavida #enfermagemdotrabalho #enfermagemdadepressão #tecnicodeenfermagem #agua #corona #coronavirus #imaginação #imagino #virus #meme #memes #cerveja #bar
2231615011546395310; 0; False; 1580249261; Best Coronavirus meme yet? #memes #dailymemes #coronavirusmemes #Coronavirus #funnymemes
2231615005412701896; 5; False; 1580249261; SCIENTISTS SHOULD BE PAID MORE THAN DOCTORS! (scientists CREATE the cures) People don't appreciate that #Australia has some of the best scientists in the world. Look up a list of all the inventions Australian scientists have created/discovered/invented and you'll be surprised+proud. A Melbourne lab becomes the first outside of China to re-create the deadly novel #coronavirus, enabling researchers to develop screening tests and help with the creation of a #vaccine #puppersagainstcoronavirus
2231614908431376169; 2; False; 1580249249; #banana #virus #coronavirus #wuhan #hair #colorful #bacteria #cinema4D #c4d #maxon #cgart #cgi #yellow #blue #inspire #inspiration #art #GraphicDesign #graphic #design #render #weeklyrender #dailyrender #arnold #c4dtoa #solidangle #autodesk #maya
2231614900344547769; 1; False; 1580249248; Reusable stylish face masks Protect yourself this cold flu and #coronavirus season. ThmeUS.com under accessories
2231614825536188720; 1; False; 1580249239; #repost @greengoldcbdoils Type in Code “GG” for discounts on all CBD products. Link in bio #CBD #coronavirus #health #cancer #cures #pets #cbdoil #vapes :shushing_face::see-no-evil_monkey::hear-no-evil_monkey::speak-no-evil_monkey: PAY ATTENTION :eyes::eye::eyes::eye::eyes: A compound made by #cannabis plants has been found to wipe out drug-resistant bacteria, raising hopes of a new weapon in the fight against #superbugs. Scientists screened five cannabis compounds for their antibiotic properties and found that one, cannabigerol (CBG), was particularly potent at killing methicillin-resistant Staphylococcus aureus (#MRSA), one of the most common hospital #superbugs. Tests in the lab showed that CBG, which is not psychoactive, killed common MRSA microbes and "persister" cells that are especially resistant to antibiotics and that often drive repeat infections. The compound also cleared up hard-to-shift "biofilms" of MRSA that can form on the skin and on medical implants. Having seen how effective the substance was against bacteria in the lab, the researchers decided to test CBG's ability to treat infections in animals. In a study that has not yet been published, they found that CBG cured mice of MRSA infections as effectively as vancomycin, a #drug widely considered to be the last line of defence against drug-resistant microbes. The study is under review at the ACS Infectious Diseases journal. Eric Brown, a microbiologist who led the work at #McMasterUniversity in #Hamilton, #Ontario, said cannabinoids were "clearly great drug-like compounds", but noted it was early days in assessing the compounds for use in the clinic. "There is much work to do to explore the potential of the cannabinoids as antibiotics from the safety standpoint," he said. #Antibiotic resistance has become a major threat to public health. #England's former chief medical officer Dame Sally Davies has said the loss of effective antibiotics would lead to "apocalyptic scenarios", with patients dying from routine infections and many operations becoming too risky to perform. In the study, the researchers describe how the rapid global spread of drug resistance, caused by #microbes developing mutations that protect them against antibiotics, has driven an urgent need to explore new sou
2231613651216173109; 0; False; 1580249235; qr crew after operating China and HKG flights be like.. :nauseated_face: #viewfrommyoffice #viewfromthetop #cabincrewmemes #flightattendantmemes #aviation #aviationmemes #passengershaming #cabincrewlife #flightattendantlife #qatarairways #qatarairwayscrew #qr #emirates #emiratescrew #etihad #etihadcrew #goingplacestogether #excellenceineverythingwedo #glamorous #falife #coronavirus #coronavirusoutbreak #wuhan #wuhanvirus #wuhanchina #china #chineseflu #flu
2231614623371472545; 0; False; 1580249233; #me #metal #motivation #creative #bodybuilding #crossfit #calistenics #yoga #music #moda #model #makeup #creenciabase #winter #summer #kardashian #picoftheday #pink #youtube #mode #trump #memes #sunset #food #coronavirus #coronarvirus
2231614552982487358; 1; False; 1580249227; Simpsons and the phoney baloney crisis, predictive programming! #coronavirus Learntherisk.org Childrenshealthdefence.org Pubmed.gov #learntherisks #bigpharmasucks
2231614711469166285; 0; False; 1580249226; . . . #wuhanchan #coronachan #coronavirus #wuhan #wuhancoronavirus #novelcoronavirus #wuhanchina #pol #4chan #ebolachan #nurgle #goodluck #China #winnietheflu #wuhanquarantine #wuhanflu #shtf #MAGA #anime #waifu #corona #makeanimegreatagain #batsoup
2231614702021297877; 0; False; 1580249224; #banana #virus #coronavirus #wuhan #hair #colorful #bacteria #cinema4D #c4d #maxon #cgart #cgi #yellow #blue #inspire #inspiration #art #GraphicDesign #graphic #design #render #weeklyrender #dailyrender #arnold #c4dtoa #solidangle #autodesk #maya
2231614627406911249; 1; False; 1580249216; Primeiramente, não existe motivo para pânico! O Ministério da Saúde confirmou que mantém em isolamento em um hospital de Belo Horizonte, uma jovem de 24 anos que viajou a China e voltou para o país com sintomas do Coronavírus. No entanto, o caso ainda é uma suspeita e confirmação poderá sair somente na sexta-feira. . A recomendação do Ministério da Saúde brasileiro e também do chinês é que se evite ao máximo viagens para países onde o Coronavirus já foi detectado, sendo eles: China, França, Alemanha, Coreia do Sul, Nepal, Japão, Taiwan, Tailândia, Vietnã, Camboja, Sri Lanka, Cingapura, Malásia, Austrália, EUA e Canadá. . . . . . #laboratoriopremium #vemserpremium #barreirasbahia #barreirasba #barreiras #lem #luiseduardo #ibotirama #oestebaiano #bahia #coronavirus #oms #saude #epidemia #laboratorio #analisesclinicas
2231614553477938410; 0; False; 1580249207; :skull::skull::skull::skull::skull::rolling_on_the_floor_laughing::rolling_on_the_floor_laughing::rolling_on_the_floor_laughing::rolling_on_the_floor_laughing::rolling_on_the_floor_laughing::beer_mug::beer_mug::lemon::lemon: #dankmemesdaily #funnymemesdaily #coronavirusmemes #coronavirus #fuckedupmemes #funnyshit #lymedisease #itsjustajoke #coronaextra #findyourbeach #cerveza #mexicanbeer #imfuckingdead #mexicansbelike #coronatime:beer_mug: #itscoronatime #coronatimefoo #sanjose #bayareamemes #408memes #408 #followforfollowback
2231614530618425956; 3; False; 1580249204; :warning:WARNING GRAPHIC IMAGES:warning: Please share this URGENT post about the coronavirus epidemic with your followers as the origin of the virus has been traced to the zone of the Wuhan market where live wild animals like snakes, rats, bats and monkeys were traded before China instituted a temporary ban yesterday. But a temporary ban is NOT enough, WE MUST use our social media platforms to spread awareness and BAN WILD ANIMAL TRADING WORLDWIDE as this is EXACTLY what caused the SARS virus that killed nearly 800 people in 2003! SARS was 17 years ago and yet these markets are doing the exact same thing, selling live wild animals in unhygienic conditions that create diseases with devastating consequences for the entire human race! This new virus, which has no vaccine, has killed 82 people with 2,887 confirmed cases in 15 countries, numbers which have increased 50% SINCE YESTERDAY and 60 million more people are on lockdown to prevent further spreading. Please pray for the world and share this URGENT post with your followers and tag people, celebrities, influencers and news media that need to see this and let’s work together to PERMANENTLY ban the trading of wild animals that create these deadly viruses! #coronavirus #endanimalcruelty #coronavirusoutbreak #Bismillahirrahmanirraheem, #Allah (ﷻ), #Islam, #Islamknowledge, #ProphetMuhammad (ﷺ), #Quran, #Hadith, #Hereafter,#Islamicquote, #Ummah, #Sunnah, #Religion, #Muslim, #Hijabi, #God, #Deen, #Dawah, #Dunya,#Shadow, #Salah, #Ameen, #Sabr, #Islamic, #Jannah, #Paradise, #Akhirah, #Faith
2231614496542115829; 0; False; 1580249200; Sigue todos los detalles del #coronavirus a través de @novemapp la innovadora aplicación de salud que cambiará tu vida! —————————————————————— #Repost @novemapp with @make_repost ・・・ Los #coronavirus son una amplia familia de #virus:exclamation_mark:que normalmente afectan sólo a los #animales, aunque en #China, específicamente en la ciudad de #Wuan surgió una nueva #cepa de esta #enfermedad :warning:, la cual es perjudicial para el ser humano :sneezing_face: . El coronavirus produce cuadros clínicos que van desde el resfriado común :sleepy_face: hasta enfermedades más graves :cross_mark: . Ya hay más de 50 casos, en 13 países como China, #Japón, #Vietnam, #Tailandia, #CoreadelSur, Nepal, #Taiwan, Singapur, Malasia, #EstadosUnidos, Canadá, #Francia y Australia :slightly_frowning_face::frowning_face: . En total, ya son más 2.846 personas afectadas por el coronavirus :tired_face::weary_face:y 82 víctimas. Aunque, se creen que los infectados podrían ser más :exploding_head:. Ahí radica la importancia de mantener tu historial médico actualizado,:mobile_phone:ya que esto permitirá mantener un control y monitoreo de las #pandemias :hospital: . Descarga #Novem a través de: https://play.google.com/store/apps/details?id=com.asertech.novemapp . . . #enfermedadesraras #nuevasenfermedades #salud #saludable #medicos #vacuna #medicina #doctores #atencionhospitalaria
2231614447495783226; 0; False; 1580249194; Sigue todos los detalles del #coronavirus a través de @novemapp la innovadora aplicación de salud que cambiará tu vida! —————————————————————— #Repost @novemapp with @make_repost ・・・ Los #coronavirus son una amplia familia de #virus:exclamation_mark:que normalmente afectan sólo a los #animales, aunque en #China, específicamente en la ciudad de #Wuan surgió una nueva #cepa de esta #enfermedad :warning:, la cual es perjudicial para el ser humano :sneezing_face: . El coronavirus produce cuadros clínicos que van desde el resfriado común :sleepy_face: hasta enfermedades más graves :cross_mark: . Ya hay más de 50 casos, en 13 países como China, #Japón, #Vietnam, #Tailandia, #CoreadelSur, Nepal, #Taiwan, Singapur, Malasia, #EstadosUnidos, Canadá, #Francia y Australia :slightly_frowning_face::frowning_face: . En total, ya son más 2.846 personas afectadas por el coronavirus :tired_face::weary_face:y 82 víctimas. Aunque, se creen que los infectados podrían ser más :exploding_head:. Ahí radica la importancia de mantener tu historial médico actualizado,:mobile_phone:ya que esto permitirá mantener un control y monitoreo de las #pandemias :hospital: . Descarga #Novem a través de: https://play.google.com/store/apps/details?id=com.asertech.novemapp . . . #enfermedadesraras #nuevasenfermedades #salud #saludable #medicos #vacuna #medicina #doctores #atencionhospitalaria
2231614402365528357; 7; False; 1580249189; O Ministério da Saúde informou no início da noite de hoje que está investigando mais dois casos suspeitos de coronavírus no Brasil: um em São Leopoldo, no Rio Grande do Sul, e outro em Curitiba. Outro caso suspeito em Belo Horizonte já havia sido anunciado anteriormente. Segundo o governo, os pacientes se enquadraram na atual definição de caso suspeito para NCOV-2019 (o novo coronavírus), apresentando febre e pelo menos um sinal ou sintoma respiratório. O paciente de São Leopoldo é um homem de 40 anos que procurou atendimento na Unidade de Pronto Atendimento (UPA) da cidade, na região metropolitana de Porto Alegre. Ele relatou que chegou de viagem da China há quatro dias. Em nota, a prefeitura informou que o paciente foi isolado e realizou exames prévios, seguindo o protocolo do Ministério da Saúde. O material da coleta do exame foi encaminhado nesta tarde ao Laboratório Central do Estado (Lacen) para análise. O paciente segue internado e em isolamento para observação. Ainda segundo nota da prefeitura, o homem é morador da cidade de Kunming, a mais de 1,5 mil km de Wuhan, cidade onde surgiram os primeiros casos do vírus na China. Em nota, o Ministério da Saúde reforçou entre as orientações que viagens para a China sejam realizadas apenas em casos de extrema necessidade. Com quase três mil casos confirmados, segundo o último boletim da OMS (Organização Mundial de Saúde), todo o território chinês passa a ser considerado área de transmissão ativa da doença. Ainda segundo a OMS, o risco mundial de contaminação é considerado "alto". . https://noticias.uol.com.br/saude/ultimas-noticias/redacao/2020/01/28/ministerio-confirma-mais-duas-suspeitas-de-coronavirus-no-brasil-rs-e-pr.htm?cmpid=copiaecola . . . . . . #virus #Coronavirus #Brasil #analisesclinicas #laboratorio #exames #oms #biomed #Biomedicina
2231614383524765891; 2; False; 1580249186; Yobazlar ne zaman biter:question_mark: #coronavirüsü #coronavirus #din #inanc #tarikat #tarikatlardanuzakdurun
2231614368784036624; 1; False; 1580249185; #coronavirus
2231614353317528649; 0; False; 1580249183; #SONDAKİKA Trump ve Netanyahu'nun #Beyazsaray daki önemli toplantısında Türk gazetecilerin toplantıya girişi yasaklanmış olduğu öğrenildi. #corona #coronarvirus #koronavirus #virüs #deprem #çin #Wuhan #türkiye #almanya #istanbul #izmir #adana #gaziantep #salgın #hastalık #coronavirues #CoronaVirus #takipçikazan #gt #antalya #trabzon #afad #haber #SonDakika #aztagram #followme #likeme
2231614325465219167; 0; False; 1580249180; O coronavírus causa problemas respiratórios, sendo transmitido por via aérea, como em gripes comuns. Esse danado tá presente pra banda da China, mas pode vir pra cá também. Previna-se com uma boa higiene das mãos até ter vacina pra controlar! #coronavirus #cordel #saude #medicina #nordeste
2231614277608106764; 3; False; 1580249174; #coronavirus
2231614127351465968; 0; False; 1580249156; Nos preocupamos por tú salud, por eso te informamos sobre el #Coronavirus y como protegerte de las infecciones respiratorias.:face_with_medical_mask::sneezing_face: :right_arrow:En caso de presentar síntomas. No se automedique y acuda al establecimiento de salud más cercano. #ConsultorioDentalVidal #PensandoEnTi
2231614011388958967; 1; False; 1580249156; :Turkey:Jamaika'da hayvanlar depremden sonra garip sesler çıkarmaya başladı. :European_Union:In Jamaica, animals make strange noises after the earthquake. #clinicalnews #coronavirus #virusoutbreak #corona #health #nursing #nurse #wuhan2020 #wuhanvirus #coronaoutbreak #who #china #doctor #hospital #european #europe #crisis #lastnews #cdc #coronavirus #wuhan2020 #outbreak #usa #earthquake #jamaica #deprem #jamaicaearthquake
2231613550862259834; 0; False; 1580249155; Khawatir Virus Corona, Marwan Yohanis Minta Stop Impor China Jika Terpapar Virus #viruscorona #coronavirus #riausiaga #imporchina #beritariauhariini #beritariauterkini #inforiau_
2231614042291232899; 0; False; 1580249146; #coronavirus
2231613991296659429; 0; False; 1580249140; My friends...Living Legends...:face_with_tears_of_joy::face_with_tears_of_joy::rolling_on_the_floor_laughing::rolling_on_the_floor_laughing:...Tag your corona friends..and be safee US Lo kuda oka 5 cases unnay ani bayata talkuuu... Please Follow: @desilolliusa for more entertainment #telugunri #desilolli #confuseddesi #telugumemes #telugucomedy #telugucomedymemes #telugucinema #americakastalu #telugufunnymemes #telugufunny #sontham #sunil #corona #coronavirus #coronavirusmemes
2231613917057218281; 1; False; 1580249131; #coronavirus #pandemic #hellafunny #corona #dosequis #mostinterestingmanintheworld #china
2231613915431050333; 0; False; 1580249131; #SONDAKİKA | Akdeniz açıklarında 4.5 büyüklüğünde bir #deprem meydana geldi. #corona #coronarvirus #koronavirus #virüs #deprem #çin #Wuhan #türkiye #almanya #istanbul #izmir #adana #gaziantep #salgın #hastalık #coronavirues #CoronaVirus #takipçikazan #gt #antalya #trabzon #afad #haber #SonDakika #aztagram #followme #likeme #video #mizah #çin . Dünya'da Olan En Güncel Olay ve Gelişmelerden herkesten önce haberdar olmak istemezmisiniz? @reflexhaber Bizi Takip Edebilirsiniz.
2231613913880205853; 2; False; 1580249130; @_acvids_ każe mi wrzucać takie zdjęcia, coś tam o szczegółach i atencji mówił. Ja się uczę how to media społecznościowe, ale słabi mi wychodzi. Nosimy maseczki bo #coronavirus groźny. #mood #instagood #instaphoto #photooftheday
2231613883830127359; 0; False; 1580249127; #Repost @elcomerciocom (@get_repost) ・・・ #ATENCIÓN | Esta es la lista de países que anunciaron casos de contagio de un nuevo #coronavirus, de la misma familia que el SRAS, desde su irrupción en diciembre en #Wuhan, en el centro de #China
2231613845436954863; 2; False; 1580249122; Urgente! ..... #alertanacional #coronavirus
2231613796061757365; 0; False; 1580249116; Coincidence? :rolling_on_the_floor_laughing::skull:#accurateaf #simpsons #coronavirus #facts #trend #dead #simpsonsmemes #staywoke #memeofthemonth #trending #china #followmeformore
2231613730704304691; 0; False; 1580249109; #CoronaVirus El Presidente tomó estado de situación sobre la preparación nacional frente al Coronavirus :red_triangle_pointed_up:El presidente Alberto Fernández se reunió esta mañana en Casa Rosada con el titular de la cartera sanitaria nacional, Ginés González García, quien le expuso un informe de situación acerca de la información epidemiológica existente a nivel mundial sobre el Coronavirus, que ya afecta a once países en el mundo. :red_triangle_pointed_up:El primer mandatario se puso al tanto de las medidas de implementación que permitan dar respuestas rápidas en caso de que el virus ingrese a la Argentina. :red_triangle_pointed_up:El ministro explicó que se está realizando un exhaustivo seguimiento de la situación brindada por la Organización Mundial de la Salud (OMS), así también como la de los países afectados. la de las anteriores epidemias de virus respiratorios de los últimos años, como el SARS en 2003 o la Pandemia de Gripe H1N1 en 2009. :backhand_index_pointing_right_medium-light_skin_tone: Entérate más en nuestra web :mobile_phone_with_arrow: haciendo click en el link de la biografía :up_arrow:
2231609421190933477; 0; False; 1580249106; Musings on viruses and how to prevent hysteria #viruses #coronavirus #coronavirusoutbreak #achangeiscoming #the1percent
2231613696002235340; 0; False; 1580249104; Man down #edgy #edgymemes #goals #meme #memes #dankmemes #funny #funnymemes #funnyshit #like #follow #shitpost #spicymemes #spicy #usa #minecraft #vape #vapetricks #vapelife #swag #follow4followback #lol #smile #happy #pain #murica #minecraftmemes #coronavirus
2231612128043901972; 5; False; 1580249104; #china, ta callaita, pero lo que se está viviendo en #wuhan, ciudad del #coronaVirus no es fácil. La escena muestra un contaminado tratando de escapar de la sala del #aislamiento.
2231613689206075749; 0; False; 1580249104; Via @eltubazo - El nuevo coronavirus, que está causando un brote de neumonía en China y otros países asiáticos, se transmite, principalmente, a través de gotas de aire. Pero el contacto físico también es otra vía de propagación, han explicado las autoridades sanitarias chinas. . Así lo informó la Comisión Nacional de Salud china este martes, en una actualización del plan para el diagnóstico y tratamiento del coronavirus. . En comparación con la versión anterior, el plan añade nuevas características epidemiológicas del virus. Así, recoge que la principal fuente de infección es la gente que ya está infectada. . Si se infectan, los ancianos y las personas con problemas de salud subyacentes, como diabetes, hipertensión y enfermedades cardiovasculares, son más propensos a enfermar gravemente. . El balance de la epidemia de neumonía viral en China ha aumentado a 106 muertos y casi 1.300 nuevos casos confirmados, anunciaron este martes las autoridades. . Las autoridades sanitarias de la provincia de Hubei (centro), donde comenzó la epidemia, afirmaron que el virus había causado 24 muertos más e infectado a otras 1.291 personas, lo que eleva el número de pacientes confirmados a más de 4.000 en toda China. . Por su parte, las autoridades chinas aseguraron a la Organización de Naciones Unidas que tiene plena capacidad para atender la emergencia. . "China está trabajando con la comunidad internacional en un espíritu de apertura, transparencia y coordinación científica", dijo Zhang Jun, embajador chino, y afirmó que su nación cuenta con los medios necesarios para atacar la enfermedad. . Entretanto, el virus está expandiéndose a varios países, luego de que turistas se movilizaran a distintas ciudades del mundo desde Wuhan por la celebración del año nuevo chino. . Fuente: Europa Press / AFP #china #coronavirus #eltubazo #venezuela #virus #wuhan
2231613688997422392; 0; False; 1580249104; Un nuevo #coronavirus es una nueva cepa que no se ha identificado previamente en humanos - Lee el artículo completo de Álvaro Campo de la @ucasagrande :backhand_index_pointing_right::backhand_index_pointing_right::backhand_index_pointing_right: bit.ly/2tKsxCD http://bit.ly/2O940y5
2231613671657172254; 0; False; 1580249102; To help prevent the spread of a deadly coronavirus, please read and share these healthful reminders from the World Health Organization (WHO). #HealthAdvisory #Coronavirus
2231613651282725141; 1; False; 1580249099; When I #quarantine the place a-yo I step correct #WUHAN Got you all in check! I got that #epidemic shit that make you break your neck WUHAN! I got you all in check And you know spreadin like #panic to wreck the discotheque WUHAN! I got you all in check Throw your guts up in the #airport don't ever disrespect WUHAN! I got you all in check . . . This is da remix.... radios play dis remix.....
2231613646753041518; 1; False; 1580249099; 第一日喺慕尼黑武漢肺炎爆發：stockdorf已經有三個人有武漢肺炎.:moai:#coronavirus #munich
2231613644284641933; 4; False; 1580249098; One murdery Chinese boi, of course :diamond_with_a_dot::diamond_with_a_dot::diamond_with_a_dot::diamond_with_a_dot::diamond_with_a_dot::diamond_with_a_dot::diamond_with_a_dot::diamond_with_a_dot::diamond_with_a_dot::diamond_with_a_dot::diamond_with_a_dot::diamond_with_a_dot::diamond_with_a_dot::diamond_with_a_dot::diamond_with_a_dot::diamond_with_a_dot::diamond_with_a_dot::diamond_with_a_dot::diamond_with_a_dot::diamond_with_a_dot::diamond_with_a_dot: #memes #politics #politicalmemes #edgymemes #dankmemes #funny #darkhumor #darkmemes #greta #memes #memes:face_with_tears_of_joy: #memesdaily #gretathunbergmemes #gretamemes #edgymemesforedgyteens #explore #explorepage #informationwar #ancap #instagood #edgyhumor #edgyedits #zoomermemes #virus #china #currentevents #coronavirus #news #journalism #liberty #libertarian
2231613633446648668; 0; False; 1580249097; Via @nationalpost 3rd confirmed case in Canada. #coronavirus
2231613552479961542; 0; False; 1580249087; O primeiro caso suspeito de incidência do coronavírus no Brasil é investigado em Minas Gerais. A possível infectada é uma mulher de 22 anos, que esteve em Wuhan, na China. O Ministério da Saúde confirmou, nesta terça-feira (28) existência do caso. Acompanhe a notícia completa no nosso site: www.vaimudarnoticias.com.br/ Site na bio! Twitter: @sitevmnoticias #Brasil #Bahia #Salvador #noticias #noticiassalvador #noticiasbahia #mundo #noticiasbrasil #seliga #noticiasdehoje #mundo #nordeste #minasgerais #coronavirus #noticiasnordeste #VMNoticias
2231613513816743544; 1; False; 1580249083; Behind the Scenes with LA36! • Dr. Barbara Ferrer of LA County Department of Public Health took the time to set our minds at ease with the growing concerns of the CORONAVIRUS. Sleep easy LA, the Doc is on the case! • • • • #la36 #lacounty #coronavirus #publichealth #health #flu #flushot #boardofsupervisors #healthyla #myofficefortheday #stayhealthy #entertainmentindustry #production #postproduction #tv #film #industry #tvmagic #lightscameraaction #lifebehindthelens #productiontruck #editorlife #adobe #director #editor #cameraman #engineering
2231613510445795134; 0; False; 1580249082; Cette semaine, dans le balado « Ça s'explique », on discute de l'état actuel du coronavirus. Le nombre de personnes atteintes se multiplie en Chine et ailleurs dans le monde. Que sait-on vraiment au sujet de ce virus? Un épisode très intéressant à écouter dès maintenant sur l'application Radio-Canada OHdio! :headphone: . . . . . #radiocanada #ohdio #coronavirus #balado #podcastfranco #santé
2231613507684944352; 2; False; 1580249082; :face_with_medical_mask: 武汉加油 !! 中国加油 !! :yellow_heart: สู้ๆ ทั้งชาวอู่ฮั่น จีน ไทย และทุกประเทศเลยนะคะ เป็นกำลังใจให้ผู้ติดเชื้อ บุคลากรทางการแพทย์ และบุคลากรทุกภาคส่วนที่เกี่ยวข้อง สู้ๆ ค่ะ :victory_hand_light_skin_tone::victory_hand_light_skin_tone::victory_hand_light_skin_tone: #Wuhan #WuhanCoronavirus #Coronavirus #China #Thailand . ติดตามข่าวสารแบบมีสติ ระวัง Fake News :cross_mark: ด้วยนะคะ . #CyranoDesign #illustration #โคโรนาไวรัส #Cr.cyranodesign :folded_hands_light_skin_tone:
2231613490934903757; 0; False; 1580249080; Ministro confirma caso suspeito de COrona Vírus em Minas Gerais. Saiba mais: O ministro da Saúde, Luiz Henrique Mandetta, confirmou nesta terça-feira (28) o primeiro caso suspeito de coronavírus investigado no Brasil. A paciente se enquadra nas definições da OMS (Organização Mundial da Saúde), pois esteve recentemente na cidade de Wuhan, na China, epicentro da epidemia. Na semana passada, o Ministério da Saúde chegou a informar que ao menos cinco governos estaduais notificaram a pasta sobre viajantes que apresentaram sintomas gripais — e que poderiam ser casos suspeitos —, mas todos foram descartados, justamente por não terem visitado a região de Wuhan e não terem contato com alguém infectado pelo novo coronavírus. Se confirmado, o caso da brasileira será o primeiro do novo coronavírus na América do Sul. A Anvisa (Agência Nacional de Vigilância Sanitária) vai intensificar as orientações sobre o coronavírus durante voos em que possa haver passageiros procedentes da China. Além disso, a Anvisa pretende distribuir nos próximos dias folhetos informativos sobre o vírus aos viajantes que desembarcarem nos aeroportos internacionais brasileiros. O ministro da Saúde, Luiz Henrique Mandetta, desaconselhou que brasileiros viajem à China, exceto em caso de "estrita necessidade". Fonte: R7.com #noticias #radio #coronavirus #virus #china #surto #saude #wuhan
2231613471018879036; 0; False; 1580249078; Смертельно опасный коронавирус становится сильнее, предупреждает Китай.й Китайские власти заявили, что коронавирус 2019-nCoV все быстрее приобретает способность передаваться от человека к человеку, поэтому число заразившихся будет расти. Инкубационный период вируса составляет от одного до 14 дней, однако заразившиеся могут передавать его другим людям даже в течение инкубации, чего не было во время эпидемии тяжелого острого респираторного синдрома (Sars), или атипичной пневмонии, в 2002-03 годах. Несколько китайских регионов ввели значительные ограничения на передвижение людей. Предполагается, что очаг заболевания находился на рынке диких животных в городе Ухань с населением около 11 млн человек; это административный центр провинции Хубэй в Центральном Китае. Уже несколько дней город находится в карантине, а с воскресенья в центральной части Уханя запрещено передвижение обычных автотранспортных средств. Китай также запретил на территории всей страны торговлю дикими животными в магазинах, рынках и ресторанах, а также в сетевых магазинах. Как известно, традиционная китайская кухня имеет множество рецептов, основанных на мясе диких и экзотических животных, птиц и рептилий. #coronavirus#china#news#китай#вирус#like4likes#folow4folow #followforfollowback#китайскийвирус#болезнь
2231613466555196971; 0; False; 1580249077; #gerenciamentodecrise #OMS #WHO #coronavirus
2231613371330174416; 1; False; 1580249066; Lmaoooo
2231613260952481183; 0; False; 1580249053; Preparando un post muy especial para mañana:grinning_face_with_sweat:. Descubre cómo es vivir en China. #Organizacion #viajes #viajar #pekin #beijing #china #organizadoraimpecable #trip #vivirenasia #asia #coronavirus
2231613227489730433; 1; False; 1580249049; Radiografia de tórax em pacientes afetados pelo #Coronavirus. Fonte: https://www.nejm.org/doi/full/10.1056/NEJMoa2001017 . . . . . . #raioxdigital #raiox #raiosx #radiología #radiologiaveterinaria #radiology #radiologiaporamor #radiologiamedica #rx #radiologystudent #radiologia #radiologytech #radiografia #medicina #ressonância #ressonancia #anatomiahumana #anatomy #ortognatica #mamografia #estágio #estagio #tc #tomografia #tomography #anatomia #vslab #corona
2231613144265767379; 0; False; 1580249039; . . . . . . #memesdaily #meme #memes #dankmemes #shrek #coronavirus #corona #viral #virus #share #followers #following #warnerbrosstudios #fail #pc #china #coronavirusmemes #area51
2231613069843187911; 0; False; 1580249030; China. I'm so lazy. #coronavirus #countryhumans #countryhumanschina
2231613054181545276; 0; False; 1580249028; I’m sick of China and their shit. More news here: @mandydolldoll *** *** *** #news #politics as usual #truth #medical #coronavirus #healthy #virus #family #asian #asia #china #travel #washington #family #sick #donaldtrump #conservative #liberal #flu #children #africa #europe #russia #america #london #paris #germany #canada #uk #WW3ThePayback:fire: #mandydolldoll
2231612810952081709; 0; False; 1580249025; Çində yoluxmuş xəstə həkimlərə tabe olmaq istəmir və yoluxmadiqini bildirir lakin polislər onu məcburi nəzarətə götürür #cin #çin #aztagram #baku #azerbaycan:Azerbaijan: #koronavirus #coronavirus
2231613029754462201; 0; False; 1580249025; En Clínica el Rosario nos preocupamos por tu salud y queremos compartirte algunas recomendaciones para evitar el contagio del coronavirus:backhand_index_pointing_up_medium-light_skin_tone::backhand_index_pointing_up_medium-light_skin_tone: ⁣⁣⁣ ⁣⁣⁣ :round_pushpin:Sede El Poblado⁣⁣⁣ :round_pushpin:Sede Centro⁣⁣⁣ :telephone:4441555⁣⁣⁣ :envelope_with_arrow:citas@clinicaelrosario.com⁣⁣⁣ ⁣⁣⁣ ⁣⁣⁣ ⁣⁣⁣ ⁣⁣⁣ ⁣⁣⁣ ⁣⁣⁣ ⁣⁣⁣ ⁣⁣⁣ ⁣⁣⁣ #clinicaelrosario #medellin #poblado #antioquia #colombia #salud #especialistas #citasmedicas #urgencias #coronavirus #virus
2231613014755663728; 0; False; 1580249023; No, novel Coronavirus (2019-nCov) is not as deadly as others. Coronavirus mortality rate is only 3%. On the other hand, Ebola virus disease has a mortality rate of up to 90% in humans. "Everything indicates that the mortality rate of coronavirus is lower when compared to the outbreak of SARS in 2003, Peter Piot, professor of global health and director at London School of Hygiene and Tropical Medicine, told CNBC’s “Squawk Box Europe” on Tuesday". BSLs: There are four biosafety levels. Each level has specific controls for containment of microbes and biological agents. The primary risks that determine levels of containment are: -Infectivity -Severity of disease -Transmissibility -Nature of the work conducted -Origin of the microbe, or the agent in question, and the route of exposure are also important. More information: https://www.cnbc.com/2020/01/28/coronavirus-vs-sars-health-experts-on-the-key-differences.html #science #ciencia #biosafety #biology #biologia #virus #coronavirus #corona #SARS #china #epidemiology #medicine #medical #doctor #SARS #ebola #statistics #transmission #disease #mortalityrate #mortal #humans #animals #nature #microbiology #microorganism #health #hygiene
2231612118431848059; 0; False; 1580249023; :face_with_medical_mask: @_just_watching_memes_ #justwatchingmemes #memes #meme #dankmemes #memesdaily #memelord #china #coronavirus #coronavirusmemes
2231612985135466015; 3; False; 1580249020; UPDATE: 101 confirmed fatalities due to the corona virus :beer_mug::test_tube: #corona #coronavirus #ronaseason
2231612977584676286; 0; False; 1580249019; Bad bunny must have been prepared for the Corona virus back from 2019 VMA's #lol Reminds me of a Gi-Joe! #:rolling_on_the_floor_laughing: #china #coronavirus #badbunny #comedy #:Italy: #gijoe #italian #guido #abruzzese #sicilian #boston #italiancomedy #:face_with_medical_mask: Wash your hands !lol #:TOP_arrow:
2231612891593807258; 0; False; 1580249009; #coronavirus
2231612847612100338; 0; False; 1580249003; @tinfoilhatcast #harvard #china #biology #lieber #coronavirus ? #2020 #wuhan #wuhanchina #wuhanvirus
2231612749984524133; 0; False; 1580248992; Infórmate sobre el "Coronavirus" y participa de forma gratuita en la conferencia que se realizará el día jueves 30 de #enero . :backhand_index_pointing_down_medium-light_skin_tone: Conéctate también a la transmisión en vivo a través de esta cuenta de Instagram. . . :three_o’clock: Hora: 12:00 m. a 1:00 p.m. . Lugar: Auditorio Principal. -->> Entrada libre sin previa inscripción. . . . #coronavirus #conferencia #virus #salud #health #infectologia #transmisionenvivo #instagramlive #fundacionvalledellili
2231612668011939648; 0; False; 1580248982; :face_with_medical_mask: • • • • • #jokes #stupid #news #meme #memes #funny #memesdaily #dankmemes #lol #funnymemes #bestmemesever #newpost #coronavirus #corona #virus #chinese #sick
2231612049486789492; 0; False; 1580248976; Bütün sağlık çalışanları Corona virüs için dikkatli olsunlar. Bir vaka bile yakalamak :eye:‍:left_speech_bubble: birçok kişiyi kurtarabilir. #coronavirüsü #coronavirus
2231612541402253791; 1; False; 1580248967; Throats killing and gotta dry cough... must be coronavirus #sendhelp #overreaction #selfie #gayselfie #gay #gayuk #gayfollow #gaylife #gaylike #instagay #lgbt #coronavirus
2231612447257486288; 8; False; 1580248956; Circula nas redes sociais um tuíte supostamente publicado pelo @jornaloglobo informando que um paciente infectado pelo novo coronavírus mordeu a jugular de um médico. . :cross_mark: Trata-se de uma montagem. O jornal O Globo não publicou, em sua conta no Twitter ou em seu site, reportagem dizendo que um paciente infectado com o novo coronavírus mordeu a jugular de um médico nos Estados Unidos. . :cross_mark: Além disso, o link citado no tuíte (https://t.co/YqBqAdA3DJ) direciona para um artigo sobre a defesa do criacionismo pelo presidente da Capes, Benedito Guimarães Aguiar Neto. . :cross_mark: Vale notar que todos os links publicados pelo veículo no Twitter são encurtados utilizando o domínio “glo.bo”, e não “t.co”, o padrão da plataforma. Há, ainda, um erro de digitação no tuíte: a palavra “coronavírus” foi grafada sem acento. . Confira a checagem completa em nosso site. Link na bio. . :camera_with_flash:: Reprodução do Facebook. . . #AgênciaLupa #factchecking #factcheck #checagem #fakenews #noticiasfalsas #boatos #CoronaVirusFacts #DatosCoronaVirus #coronavirus #epidemia #contagio #transmissao #china #virus #wuhan #oglobo #jornaloglobo #mordida #medico
2231612260116080139; 0; False; 1580248950; #pray #prayer #nature #indonesia #sydney #carlinhosmaia #bbb20 #anitta #bts #justinbieber #newyork #prayforrevival #prayforhealing #hope #Jesus #life #viruscorona #love #помощь #coronavirus #коронавирус #вирус #virus #china #china:China: #ухань #китай #bbc #news #новости
2231612391943011055; 2; False; 1580248949; Warm wishes to all with love. #HappyNewYear !!!! "The #YearOfTheBat2020 ." Ooops, correction "#YearOfTheRat2020 ." #GongXiFaCai " #新年快樂 #CoronaVirus meme #StraightOuttaChina #CHINA
2231612320941322073; 0; False; 1580248941; #SONDAKİKA Trump ve Netanyahu'nun #Beyazsaray daki önemli toplantısında Türk gazetecilerin toplantıya girişi yasaklanmış olduğu öğrenildi. #corona #coronarvirus #koronavirus #virüs #deprem #çin #Wuhan #türkiye #almanya #istanbul #izmir #adana #gaziantep #salgın #hastalık #coronavirues #CoronaVirus #takipçikazan #gt #antalya #trabzon #afad #haber #SonDakika #aztagram #followme #likeme #çin . Dünya'da Olan En Güncel Olay ve Gelişmelerden herkesten önce haberdar olmak istemezmisiniz? @reflexhaber Bizi Takip Edebilirsiniz.Kopyaladığınız metin otomatik olarak burada görünür
2231612286320172156; 0; False; 1580248936; Cuídense de el Coronavirus!! . . . . . . . #selfcare #selfcareespañol #selfcarelatinoamerica #selfcarebooty #coronavirus #selfcare #selfcarebooty #selfcareespañol
2231611109717262133; 1; False; 1580248928; Çinin uhan şəhərində həyat sözün əsil mınasinda sönüb #cin #çin #aztagram #baku #azerbaycan:Azerbaijan: #koronavirus #coronavirus
2231612194450167325; 0; False; 1580248925; Instruccións para evitar el coronavirus:index_pointing_up_light_skin_tone::index_pointing_up_light_skin_tone::index_pointing_up_light_skin_tone: El más sorprendente es el tercer punto nunca me lo hubiera imaginado :face_screaming_in_fear::face_screaming_in_fear::face_screaming_in_fear: #Risi:winking_face_with_tongue: #coronavirus
2231612106856166599; 0; False; 1580248915; The CDC has urged visitors to avoid nonessential travel to the country. “The situation is changing by the hour. The virus is spreading, and we are getting more information on case counts, patient types and the health impact,” said Lauren Sauer, director of research at the Biocontainment Unit at Johns Hopkins University School of Medicine. Travelers can stay abreast of developments by checking the CDC website and monitoring alerts issued by the State Department and U.S. embassies. :eyes: Visit the link in bio for more. (photo by Kevin Fraye / Getty) • #coronavirus #coronavirusoutbreak #viruscorona #coronaviruschina #china #wuhanchina #wuhan #chinacoronavirus #corona #chinatravel
2231612052606355772; 0; False; 1580248909; ● Data WN China di Bandung Diperbarui dan Jalani Tes Kesehatan . Sumber: merdeka.com . Warga China yang berada di Kota Bandung dengan beragam status pekerjaan ada 47 orang. Pemerintah Kota Bandung segera melakukan pendataan sekaligus berencana memeriksa kesehatannya. . Jumlah itu berdasarkan data dari Dinas Tenaga Kerja (Disnaker) Kota Bandung hingga 31 Desember 2019. Berkaitan dengan pendataan, mereka akan berkoordinasi dengan Dinas Kesehatan (Dinkes) Kota Bandung. . Sementara itu, Kepala Dinas Kesehatan Provinsi Jawa Barat Berli Hamdani mengaku sudah melakukan sejumlah langkah untuk mengantisipasi penyebaran virus corona. . Salah satunya membuat surat edaran kepada rumah sakit, puskesmas dan klinik untuk meningkatkan kewaspadaan, penanganan dan rujukan dalam penanganan kemungkinan pasien novel coronavirus. . Lalu, menyosialisasikan informasi kepada masyarakat melalui berbagai saluran media. Tujuannya, agar masyarakat mengenali gejala, waspada namun tidak diiringi dengan perasaan cemas atau panik dalam menyikapi virus corona. . "Jika ada riwayat perjalanan dan kontak dengan orang yang bepergian ke wilayah Tiongkok (Wuhan) atau negara yang terjangkit dalam waktu 14 hari dan mengalami demam di atas 38 derajat, batuk, sulit bernapas, segera kunjungi rumah sakit atau puskesmas terdekat. Jangan tunggu besok lagi," kata Berli saat dihubungi via pesan singkat. . Hindari kontak dekat dengan siapa pun yang menderita demam dan batuk dengan riwayat perjalanan dari negara terjangkit. Kemudian, jaga pola hidup bersih dan sehat. . "Pakai masker apabila menderita gangguan pernapasan atau batuk. Terakhir, berhati-hati dalam mengonsumsi produk hewani mentah atau setengah matang untuk menghindari kontaminasi silang dengan makanan mentah," pungkasnya. . √ :bust_in_silhouette: Follow kami untuk seputar dunia berita √ :bust_in_silhouette: Follow juga @duniaolahraga.co.id untuk seputar dunia olahraga √ :thumbs_up: Like jika kalian suka postingan kami √ :memo: Dan berikan komentar kalian di kolom postingan kami :smiling_face_with_smiling_eyes: . #wabahviruscorona #viruscorona #china:China: #bandung #wuhanchina #waspadaviruscorona #coronavirus #virus #kesehatanmasyarakat #kesehatankeluarga #orangchina
2231612042054546797; 0; False; 1580248907; #coronavirus
2231608304862557160; 47; False; 1580248903; :police_car_light:..ATTENTION!!..:police_car_light: There has reportedly been a CoronaVIRUS outbreak...:anxious_face_with_sweat::loudly_crying_face::nauseated_face: STAY SAFE YALL!! :eyes: @cp24breakingnews . TAG 5 FRIENDS! REPOST ON YOUR STORY & TAG ME! :face_with_tears_of_joy::face_with_tears_of_joy::down_arrow: . . Follow (@faaaaithhh_) for MORE! #viral #toronto #comedy #jokes #funny #funnyvideos #explore #explorepage #memes #memesdaily #china #virus #coronavirus #content #twitter #cp24 #news @globalnewsto @globalnews #tagfriends #follow #24 #kobe #kobebryant #gaintrain #ripgigi #subscribe #like #comment
2231611956708995688; 2; False; 1580248897; :flushed_face::pensive_face::pensive_face: O Ministério da Saúde informa que foi notificado de outros dois casos suspeitos do novo coronavírus no Brasil. Assim, no total, três casos suspeitos da doença são monitorados pelas autoridades de saúde brasileiras. Eles estão localizados em Porto Alegre (RS) e Curitiba (PR), além de Belo Horizonte (MG), noticiado nesta manhã. #biomedicina #saude #coronavirus
2231611330305909797; 0; False; 1580248893; Topic Tuesday Part 1...#topictuesday #currentevents #impeachmenthearings #johnbolton #trumpisatraitor #coronavirus #usa
2231610931702415656; 0; False; 1580248888; Repost @freedom_faction by @media.repost: Johnson & Johnson Advised on Coronavirus #Event201 :microbe: and Potential Vaccine :syringe: Thoughts? Prior to the coronavirus outbreak, The Johns Hopkins Center for Health Security hosted Event 201, a high-level pandemic exercise focused on a #coronavirus outbreak — yes they ran a simulation of exactly what we see unfolding right now, before it happened! The pandemic exercise was conducted in partnership with the #WorldEconomicForum and the #BillandMelindaGatesFoundation. During Event 201 Johnson & Johnson was asked specifically about a coronavirus vaccine. When asked, the Johnson & Johnson representative talked about the need for regulatory flexibility for an accelerated vaccine, financing and business. Not once did he mention safety or effectiveness. In today’s news, we see that Johnson & Johnson are currently working on a vaccine and they’re “pretty confident” they can quickly develop one. #BigPharma #BioWarfare #PopulationControl #GlobalHealthSecurityAgenda #VaccineAgenda #WuhanVirus
2231611884205712069; 0; False; 1580248888; AMERICAN AIRLINES SUSPENDS SOME FLIGHTS (China) CORONAVIRUS..... GERM-WARFARE 2020 Designer Virus Detected #coronavirus #pneumonicplague #newyorktimes #worldhealthorganization #cdc #news #plague2020 #eschatology #biowar #eugenics #china #globalepidemic #science #epidemiology #aignerauryyel #agenda21 #agenda2030 #world #currentaffairs #exitthematrix #matrix2020 #aliceinwonderland #wuhan #wuhanchina #beijing #germwarfare
2231611874541358701; 0; False; 1580248887; The risk to residents in #Grey and #Bruce remains low. Grey Bruce Health Unit​ is continually reassessing public health risk as new information becomes available. #coronavirus #healththreat
2231611862361828503; 0; False; 1580248886; AMERICAN AIRLINES SUSPENDS SOME FLIGHTS (China) CORONAVIRUS..... GERM-WARFARE 2020 Designer Virus Detected #coronavirus #pneumonicplague #newyorktimes #worldhealthorganization #cdc #news #plague2020 #eschatology #biowar #eugenics #china #globalepidemic #science #epidemiology #aignerauryyel #agenda21 #agenda2030 #world #currentaffairs #exitthematrix #matrix2020 #aliceinwonderland #wuhan #wuhanchina #beijing #germwarfare
2231611855852108844; 0; False; 1580248885; Keep your immune system up especially with all these illnesses going around #coronavirus :face_with_medical_mask: and get all your vitamins in 1 shot ! :comet: #nutraburst has 72 minerals protect yourself ppl :double_exclamation_mark: - - - #lasotea #alleviatecream #liquidmultivitamin #smallbusinessowner #cbd #cbdmovement #cbdtea #vitamins #nutrition #health #healthyliving
2231611833890729125; 0; False; 1580248882; AMERICAN AIRLINES SUSPENDS SOME FLIGHTS (China) CORONAVIRUS..... GERM-WARFARE 2020 Designer Virus Detected #coronavirus #pneumonicplague #newyorktimes #worldhealthorganization #cdc #news #plague2020 #eschatology #biowar #eugenics #china #globalepidemic #science #epidemiology #aignerauryyel #agenda21 #agenda2030 #world #currentaffairs #exitthematrix #matrix2020 #aliceinwonderland #wuhan #wuhanchina #beijing #germwarfare
2231611789079019227; 0; False; 1580248877; . . . . . . . . . . #memeitalia #memeita #meme #memes #ignoranza #risate #italia #tiktok #divertimento #memesita #scuola #funny #dankmemes #likeforlikes #memesdaily #fun #memer #giochi #dank #funnymemes #weeb #otaku #anime #blackhumor #dankmeme #disegno #likeforfollow #game #coronavirus #dankmeme
2231611786084738902; 38; False; 1580248877; “The D.C. Department of Health issued notice that as of Tuesday, one person in the District has tested negative and two people are still undergoing testing after showing symptoms of a novel coronavirus that began spreading in China last December. The virus is a new strain that had never been known to infect humans, per the D.C. DOH. While it’s still too soon to be able to definitively list symptoms of the virus, they include fever, cough, sore throat, and shortness of breath. The SARS virus is a relative of this new coronavirus, though it causes more severe respiratory symptoms and appears to have a higher mortality rate.” Read more @dcist • • • • • • #dc #washingtondc #districtofcolumbia #maryland #virginia #dmv #washingtonianproblems #chocolatecity #wmata #washingtonpost #dcist #smithsonian #nationalmall #potomacriver #adamsmorgan #capitolhill #ustreet #hstreet #georgetowndc #dupontcircle #gwu #202 #dcnative #howarduniversity #unionmarket #metro #anacostia #americanuniversity #coronavirus
2231611785788621292; 0; False; 1580248877; Coronavirus Case Recorded In Africa . One suspected case of Coronavirus had been detected in Ivory Coast. a student who flew in from Beijing China has shown related symptoms. . I believe this is a good time to remind us all of the symptoms of the #coronavirus and how to prevent it. . #coronavirus #wuhancoronavirus #wuhanpneumonia #coronavirusprevention
2231611756999057917; 0; False; 1580248873; AMERICAN AIRLINES SUSPENDS SOME FLIGHTS (China) CORONAVIRUS..... GERM-WARFARE 2020 Designer Virus Detected #coronavirus #pneumonicplague #newyorktimes #worldhealthorganization #cdc #news #plague2020 #eschatology #biowar #eugenics #china #globalepidemic #science #epidemiology #aignerauryyel #agenda21 #agenda2030 #world #currentaffairs #exitthematrix #matrix2020 #aliceinwonderland #wuhan #wuhanchina #beijing #germwarfare
2231611527713085033; 19; False; 1580248871; please say sike :sad_but_relieved_face::face_with_medical_mask: tag someone & share :film_projector: new video every week
2231611709563308984; 0; False; 1580248868; TENDENCIAS:white_exclamation_mark: . En #4Connect somos conscientes de hechos que cambian y hacen reflexionar al mundo... . ¿Cuáles son las cosas en la vida que realmente puedes anticipar? Coméntanos:white_exclamation_mark::white_exclamation_mark: . . #KobeBryant #GiannaBryant #coronavirus #australia #consultoria #integral #business #emprendimiento #tecnologia #marketing
2231611336076030852; 1; False; 1580248859; ⠀ This is just my take on the Corona virus as many of you were asking for my opinion or some content regarding it. I’ve seen the fearful posts especially those portrayed by mainstream media. Let’s not get ahead of ourselves and bury our graves before its time.⠀ ——⠀ How can one protect themselves? I’m going to list some foods you can research that are believed to increase immune system function: - citrus fruits (lemons, limes, oranges, grapefruits) as vitamin C is essential. - Garlic, ginger, broccoli, turmeric, all carry essential anti-oxidants.⠀ ⠀ Getting your organs and glands functioning properly again is essential. One may achieve this by firstly detoxifying the body - ridding the body of parasites, heavy metals, and toxic waste. This is the first step towards wellness - then one should replenish the body with foods that enhance energy, keep the lymph system moving and the immune system strong - fruits are great. They are your friends.⠀ ⠀ To stay updated with non-biased and non-government⠀ —⠀ My good people, lets stay vigilant, stay informed, stay conscious and give fear the “:middle_finger_medium_skin_tone:”⠀ —⠀ Follow :backhand_index_pointing_right_medium_skin_tone: @BlackVeganshop⠀ ——⠀ #populationcontrol #staywoke #nwo #population #newworldorder #elite #explorepage #pinealgland #wakeuppeople #truthseeker #thirdeye #wakeupsheeple #anonymous #conscious #secretsocieties #mindcontrol #consciousawareness #politics #selfaware #freedomthinker #illuminati #truthseeker #conscious #awareness #peoplepower #depopulation #conspiracy #wakeup #coronavirus #bigpharma
2231610658091462654; 0; False; 1580248853; If you Asian, stay away from me I don’t want yo cooties nigga #love #instagood #instagram #memes #dankmemes #shitpost ##photooftheday #nature #indian #rap #playboicarti #eternalatake #shit #barbershop #barber #wavecheck #360waves #fire #streetfights #thebox #tiktok #hiphop #coronavirus #china #chinese #nigga
2231611562116583909; 1; False; 1580248850; :exclamation_mark:MAXIMUM SHARE:exclamation_mark: Based on swabs and blood from patients at Jinyintan Hospital in Wuhan, they found the genetic sequence closely matched a virus known to live in bats. The first people who contracted the deadly new coronavirus sweeping through Asia were infected when the virus jumped from animals to humans, and a new report points to the original animal source: bats. Based on oral swabs, anal swabs, and blood collected from seven patients at Jinyintan Hospital in Wuhan, the scientists were able to genetically sequence the virus. Then they tested it against a database of known viruses and found a 96.2% match with a coronavirus known to live in bats, which is also believed to be the source of the SARS and MERS outbreaks. Source: https://www.vice.com/en_us/article/xgqy3n/scientists-now-think-they-know-what-started-chinas-deadly-coronavirus-bats . #coronavirus #coronavirusoutbreak #virus #wuhan #wuhanvirus #coronaviruschina #wuhanchina #corona #coronovirus
2231609479131443209; 14; False; 1580248849; Cuernovirus anda por todo palmira :rolling_on_the_floor_laughing: . . . #tuluavalle #comedia #buga #medellin #humor #nuevovideo #humorcolombiano #cerrito #colombia #viral #humorviral #cartago #videosdehumor #coronavirus #colombia #palmiravalle #cuernovirus
2231609510337472067; 0; False; 1580248846; Skincare is a must :sparkles::sparkles: Take care of yourself and your soul. Listen to it :folded_hands_medium-light_skin_tone: I hope everyone has a good and safe day, stay protected and stay healthy #coronavirus - Also go follow my clothing brand @thehustleprodigyclothing :shopping_bags::shopping_bags: - #modelsearch #subscribetomychannel #vloggerlifestyle #followforfollowback #modelingagencies #losangelesphotographer #skincareroutine #thehustleprodigyclothingandcompany19 #california #manifestation #2020vision #liveyourbestlife
2231611261511001644; 2; False; 1580248814; ¿Como la ven?
2231608350940210759; 6; False; 1580248467; Corona virüs yarasa yiyerek güç yapmışlar #geritakip #china #geritakip #coronavirus
2231607728119666097; 3; False; 1580248393; The more I discover the world the more I discover myself :globe_showing_Europe-Africa::exploding_head::flexed_biceps_medium_skin_tone:. - - - - #earth#explorepage #jamacia #prayforaustralia #prayforpuertorico #prayforword:globe_showing_Americas: #explore#china#crazy #freeuyghur#freeughyur#peace #loveyourself #alhamdulillah
2231607618589526466; 0; False; 1580248380; :microbe: Here we go again! :airplane: First it was #LAX, #LosAngeles, #ONT, #Ontario & NOW #SAN, #SanDiego :microbe::face_with_medical_mask::microbe::face_with_medical_mask::microbe: #Coronavirus, #WearMasks:face_with_medical_mask: #StaySafe, #StayHealthy, #EatHealthy, #Scary :folded_hands_medium-light_skin_tone:
2231604885110149008; 2; False; 1580248054; Редкий гость по заграницам....вряд ли буду на Бали в ближайшее время....Грецию люблю не на столько....Египет я видела в #windowoftheworld в Китае...да и в сам Китай теперь вряд ли соберусь. Так что пусть будет фото обычного дня, где животные не летают в багажном отделении самолета...а живут там, где забота и любовь :folded_hands_light_skin_tone: Перелетов было не мало....и страх от них ранее миновал и возник снова....в свете последних событий....желаний и любви к странам тоже было масса....но а теперь.... меняю картинки на рабочем столе компа и думаю, сколько же ещё существует мест на земле, которые не угробила рука человека....сколько ещё власти и возможности ему нужно дать для того, чтоб планетушка окончательно психанула и струсила нас как бродячая собака блох....
2231568530830906645; 1; False; 1580243720; • JUST SOLD • 8 Cory Court, #Syosset $2,425,000 Successfully Represented Buyer! . . . :mobile_phone:917.293.0915 :mobile_phone:347.539.9893 :e-mail:michael.stanco@elliman.com :e-mail:michael.misiti@elliman.com www.StancoMisitiTeam.com
2231558773244146144; 1; False; 1580242561; :0
2231463412529763553; 1; False; 1580231206; #breakingnews #coronas #coronavirus #beer #doublewammy
2231019191981208211; 0; False; 1580178238; @hashtag_autism @hashtag_autism @hashtag_autism @hashtag_autism @hashtag_autism @hashtag_autism @hashtag_autism @hashtag_autism @hashtag_autism . | | | | | | #memes #meme #dankmemes #okboomer #okboomermemes #freememeskids #memez #dailydoseofmemes #wholesomememes #edgymemes #redditmemes #wiimemes #spongebobmemes #patrickmemes #internetmemes #deadmemes #memegod #memester #pornhubmemes #memesthatcuredepression #memesthatkeepmealive #fortnite #fortnitememesdaily #kahootmemes #kahoot #coronavirusmemes #coronavirus
2231611509376302324; 1; False; 1580248846; #Coronavirus causes mild to moderate cold, sinus and respiratory symptoms. At worst, it causes pneumonia, which can be fatal. Our chief of infectious diseases, Dr. Suraj Saggar weigh in on the threat and what is being done locally and state-wide to monitor and prevent infection. LINK IN BIO.
2231611470310129615; 1; False; 1580248839; Reposted from @foundconscious (@get_regrann) - For ya’ll who haven’t played this game - its basically about virus outbreak that sweeps the whole world. Just let that sink in... — Gamers have also been startled to discover that there is a biological research lab near the city where the outbreak originated has a familiar logo. Shanghai Ruilan Bao Hu San Biotech Limited seems to be linked to the Umbrella Corporation from Resident Evil. It has also been pointed out that Corona is an anagram of ‘Racoon’, fans of Resident Evil will know that the original outbreak in the game started in Raccoon city. Follow my personal :backhand_index_pointing_right_medium_skin_tone: @itsazeem Follow my other :backhand_index_pointing_right_medium_skin_tone: @foundverity —— #populationcontrol #staywoke #nwo #population #newworldorder #elite #explorepage #pinealgland #wakeuppeople #truthseeker #thirdeye #wakeupsheeple #anonymous #conscious #secretsocieties #mindcontrol #consciousawareness #politics #selfaware #freedomthinker #illuminati #truthseeker #conscious #awareness #peoplepower #depopulation #conspiracy #wakeup #coronavirus #news #newsflash #breakingnews
2231611459489128207; 0; False; 1580248838; В МИРЕ → 28 января 2020 Во Франции зафиксировали четвертый случай заражения коронавирусом. Четвертый случай заражения коронавирусом зафиксирован на территории Франции, сообщают во вторник французские СМИ. По словам директора главного управления здравоохранения Франции Жерома Саломона, заболевание диагностировано у пожилого китайского туриста. В настоящее время пациент находится в тяжелом состоянии в реанимации. Отмечается, что мужчина госпитализирован в Париже. Он приехал из провинции Хубэй, которая стала очагом распространения заболевания. Ранее сообщалось, что Еврокомиссия объявила о решении активизировать европейский механизм гражданской защиты в связи с просьбой Франции об оказании консульской поддержки гражданам ЕС в китайском городе Ухань. Еврокомиссия сообщает, что ЕС софинансирует расходы по доставке людей самолетами. Первый самолет должен вылететь из Франции в среду, 29 января, утром. Второй отправится в Китай позднее на этой неделе. Ранее в январе сообщалось, что жительница Уханя с признаками заражения новым типом коронавируса сумела проникнуть в Париж, обманом преодолев медицинские барьеры аэропорта во французской столице. Женщина, у которой перед отлетом в Париж поднялась температура и начался кашель, приняла жаропонижающее, что позволило ей в аэропорту Парижа благополучно миновать тепловизор. Вспышка пневмонии в Ухане началась в середине декабря 2019 года, возбудителем стал ранее неизвестный коронавирус. По последним данным, в КНР им заразились свыше 4,5 тыс. человек, более 106 человек погибли. Кроме того, случаи заболевания зафиксированы в ряде стран, в том числе в Таиланде, Австралит, Сингапуре, Японии и США... #coronavirus #news #bbc #новости
2231611423360655862; 0; False; 1580248834; #coronavirus #imperialism #usa #deathtoamerica
2231611178614675511; 1; False; 1580248831; With the #coronavirus making headlines, Hugo Salazar, MD, from the #StMU Student Health Center breaks down what you need to know about the virus.
2231611399040481453; 0; False; 1580248831; Check my latest #HumpDayHotTakes that just went up! Touching on everything from #KobeBryant and #Coronavirus to #GrammyAwards and #ImpeachmentHearings. #LinkInBio
2231611296683778792; 0; False; 1580248818; Stay safe out there. #explorepage #coronavirus #KeepYourHeadUp #Freedom #peace
2231611261862217847; 0; False; 1580248814; I have seen it for myself. People I talk to regularly have shown their true side uttering racist comments since the virus spread. . . . . . #coronavirus#coronavirusoutbreak#coronaviruschina#twitter#activist#socialactivism#awearness#ajplus#instagram#feminist#feminism#equality#activist#activism#intersectionalfeminism#girlpower#equalrights#humanrights#racism
2231611187286731305; 0; False; 1580248805; ¿Best coronavirus defense?: Wash your hands. :sweat_droplets: - Hand, cough hygiene important in preventing coronavirus spread. Wash your hands often and thoroughly. One of the best ways to avoid infecting yourself with the virus is by washing your hands frequently and thoroughly – as they are the main vehicle for transporting germs. If you’re out in public spaces where you’re touching shared surfaces, you should be washing your hands as often as you can. Using an alcohol-based hand sanitizer is also a good substitute if washing your hands isn’t an option. . . . #aquafeelmiami #coronavirus #lavarselasmanos #aguapura #salud
2231611069930507961; 0; False; 1580248791; #meme #memeita #memeitalia #memeitaliani #memes #memesdaily #virus #coronavirus #china #instagram #likeforlikes #followforfollowback
2231611037669229241; 1; False; 1580248788; Ouh damn #meme #memes #dankmeme #dankmemes #dank #funnymeme #funnymemes #funny #kobememes #corona #coronavirus
2231611005709234607; 0; False; 1580248784; ATENCIÓN :face_with_medical_mask:| Respecto a un posible caso de #Coronavirus:sneezing_face: en Ecuador, pedimos a nuestros queridos amigos y seguidores tener en cuenta las medidas de prevención y mantenerse informados por los canales oficiales. . . . . . . #LifeCirugíasPlásticas #Life #EscogeLife #ConfíaEnNosotros #Prevención #CuidaTuSalud #Amigos #salud #coronavirus #oms #precaución
2231610990271969249; 0; False; 1580248782; Uh-oh.... - - - - - - - - - - - - - #shrekmemes #shrek #corona #coronavirus #dankmemes #wwiiimemes #area51 #area51memes #memes:face_with_tears_of_joy: #:face_with_tears_of_joy::face_with_tears_of_joy::face_with_tears_of_joy::face_with_tears_of_joy::face_with_tears_of_joy::face_with_tears_of_joy::face_with_tears_of_joy::face_with_tears_of_joy::face_with_tears_of_joy::face_with_tears_of_joy::face_with_tears_of_joy::face_with_tears_of_joy::face_with_tears_of_joy::face_with_tears_of_joy::face_with_tears_of_joy::face_with_tears_of_joy::face_with_tears_of_joy::face_with_tears_of_joy::face_with_tears_of_joy::face_with_tears_of_joy::face_with_tears_of_joy::face_with_tears_of_joy::face_with_tears_of_joy::face_with_tears_of_joy::face_with_tears_of_joy::face_with_tears_of_joy::face_with_tears_of_joy::face_with_tears_of_joy::face_with_tears_of_joy::face_with_tears_of_joy::face_with_tears_of_joy::face_with_tears_of_joy::face_with_tears_of_joy::face_with_tears_of_joy:
2231610944069688560; 0; False; 1580248782; Cuando entras a instagram y ves que son tendencia #sismo #ovnis #Jerusalem #coronavirus #TerremotoCaribe #TrumpsWar
2231610753043306862; 8; False; 1580248780; I can't take it anymore ... Seeing my city friends like this, a mother who died on the ground in front of her baby ... I can't take it anymore, I think I'll shortly take my life ... ------ #coronavirus #wuhan #virus #china #panic #police #helpwuhan #helpme #suicide
2231610962104563805; 0; False; 1580248779; :grimacing_face: #meme #coronavirus
2231610948077348072; 0; False; 1580248777; O Ministério da Saúde confirmou nesta terça-feira (28) o primeiro caso suspeito de coronavírus no País e elevou o nível de atenção para Alerta de Perigo Iminente para a presença do vírus. De acordo com o ministro da Saúde, Luiz Henrique Mandetta, uma estudante de 22 anos está internada, em Belo Horizonte, em observação. Ela viajou para a cidade de Wuhan no período de 29 de agosto de 2019 a 24 de janeiro deste ano. O ministro afirmou que a estudante “está em isolamento e os 14 contatos mais próximos estão sendo acompanhados”. _ Foto: Wilson Dias/ Agência Brasil _ #coronavirus #brasil #alerta #perigo #belohorizonte
2231610772327505741; 3; False; 1580248773; Coronavirus :OK_hand: [] #coronavirus #coronavirusmeme #coronavirusmemes #china #chinesenewyear #estornudo #virus
2231610661322231171; 0; False; 1580248771; #Repost @coronavirusofficialnews with @make_repost ・・・ People randomly fall in the street, for a collapse, and there's someone who broke his nose and bleed out layed down. Hope something is gonna happen :folded_hands_light_skin_tone:. Gods safe us. #helpwuhan #coronavirus #wuhan #virus #china #panic #god I will keep looking for videos from inside of wuhan. This is getting scary.
2231602961746089810; 0; False; 1580248769; Un recuento con las informaciones más relevantes en el día de hoy. . Para ampliar visita nuestra página web www.radar24.do #Radar24RD #Radar24h #RD #Noticias #News #SNS #Salud #Virus #Enfermedad #Coronavirus #China #Canciller #MiguelVargas #Wuhan #Hotel #MedioAmbiente #Cotubanamá #SOSCutubanamá #Econimia #Dinero #PIB #BancoCentral #Sismo #Temblor #Cuba #Jamaica #Tsunami #Caribe #ElCaribe
2231610868663051400; 1; False; 1580248767; :red_circle::biohazard: ¿𝙋𝙧𝙞𝙢𝙚𝙧 𝙘𝙖𝙨𝙤 𝙨𝙤𝙨𝙥𝙚𝙘𝙝𝙤𝙨𝙤 𝙙𝙚 𝙘𝙤𝙧𝙤𝙣𝙖𝙫𝙞𝙧𝙪𝙨 𝙚𝙣 𝙋𝙖𝙧𝙖𝙜𝙪𝙖𝙮? :backhand_index_pointing_right:Joven de Taiwán fue asistido en un sanatorio privado por un cuadro respiratorio. De pronto se descarta caso de #CORONAVIRUS #Asunción #LaVozpy @MaritoAbdo @minteriorpy https://t.co/86C4qo9dOn
2231610528421969707; 1; False; 1580248762; GELECEK 3 FELAKETE HAZIRMISIN? Kimyasal ve Biyolojik Silahlara karşı hatta daha tehlikeli olan ve 6 ay gibi kısa bir sürede 30 Milyon insanın ölümüne sebep olabilecek ve dünyayı sarsacak Virüslere karşı hazırlıklımısın? Hacamat Bağışıklık Sisteminizi Güçlendirir, olmadan oluşabilecek tehlikelere karşı önlem almanızı sağlar. Bist du bereit für 3 zukünftige Katastrophen? Sollten Sie auf Viren vorbereitet sein, die für chemische und biologische Waffen noch gefährlicher sind und in nur 6 Monaten den Tod von 30 Millionen Menschen verursachen und die Welt erschüttern können? Schröpfen stärkt Ihr Immunsystem und ermöglicht es Ihnen, Vorsichtsmaßnahmen gegen mögliche Gefahren zu treffen. #hacamat, #hacamatolunşifabulun, #sülük, #schröpfen, #tedavi, #cuppingtherapy, #cupping, #cuppingmassage, #bağışıklıksistemi, #immunesystem, #coronavirus, #virus, #virusvideo, #salzburg, #salzburgaustria, #austria, #türkiye, #ankara, #istanbul, #europe, #world, #europa, #gesund, #sağlık, #gesundheit, #gesundleben, #welt, #turkiye, #avrupa, #krank,
2231610792026188908; 1; False; 1580248758; #coronavirus #bc #wefucked #vanlife #vancouver #stpaulshospitalvancouver
2231581704450338534; 0; False; 1580248753; Самые свежие новости. Число жертв нового короновируса в Китае возросло до 80. Только за последние сутки количество зараженных увеличилось на треть. Сейчас их уже более 2800. Одна из крупнейших сетей питания объявила о закрытии ресторанов по всему Китаю, чтобы сдержать распространение. . . . . #coronavirus #короновирус #китай #европа #болезнь #смерть #опасность #мир #видео #хэштеги #новости #новости_ru #карантин #эпидемия #инстатаграм #весьмир #карантин #страх #top #люди #человек #video #life #жизнь #china #europe #ухань #wuhan #россия #болезнь
2231610618640572200; 0; False; 1580248746; Les garantizo que el coronavirus '2019-nCov' va a llegar a México; no me gusta, pero hay que decir la verdad: Hugo López-Gatell, subsecretario de Salud. La epidemia está confirmada en Oceanía, sureste asiático, Europa, Canadá y EEUU. | #coronavirus #coronavirusoutbreak #neumonia #international #internacional #chiapas #tabasco #villahermosa #mexico #mexico:Mexico: #monterrey #sonora #jalisco #queretaro #veracruz #merida #acapulco #sinaloa #cdjuárez #tijuana #mexicali #chihuahua #michoacan #morelia #yucatan #quintanaroo #cancun #cdmx #cdmx:Mexico:
2231610627943346553; 2; False; 1580248739; Holu ~ :two_hearts: Según yo ayer hice un cosplay improvisado de #coronachan nomas porque me entro la espinita y ne gusta hacer gijinkas (´∀`) :crown: La verdad me gusto el atuendo rojo con pelo negro, se ve muy bello, luego subo fotos de la versión en rubia xD . . . #cosplay #cosplayer #gijinkacosplay #gijinka #coronavirus #coronachancosplay
2231610547363495531; 1; False; 1580248729; ICOMODEISHON MOMENT :grimacing_face: . . . #dankmemes #dylanteromemes #dylanteromeme #memes #memesdaily #electromom #mom #baby #yummy #JB #wuhan #corona #coronavirus #coronao
2231610242539082393; 1; False; 1580248705; Follow coronaantivirus for more! :bat: - - - - - - - - - - - - #meme #coronavirus #plague #dank #bruhmoment #wwz #ww3 #lmao #dankmemes #lol #corona #yolo #china #plagues #rofl #dead #explore #bruh #clown #clownmemes #w #haha #lmfao
2231610099829663983; 1; False; 1580248703; #Coronavirus #2019-nCoV Koronavirus - Ambil langkah pencegahan dan jangan sebar berita palsu
2231610266445877255; 0; False; 1580248696; Os países melhores e piores preparados para uma epidemia! Em outubro de 209 o Índice Global de Segurança Sanitária foi lançado e avaliou os níveis de segurança global em saúde em 195 países. Ele analisou especificamente os níveis de preparação, concentrando-se em saber se os países possuem as ferramentas adequadas para lidar com surtos graves de doenças. Os países foram pontuados em uma escala de 0 a 100, onde 100 é o nível mais alto de preparação. Os EUA :U.S._Outlying_Islands: foram nomeados como o país com as medidas mais fortes em vigor e ficaram em primeiro lugar com 83,5 em 100. O Reino Unido :United_Kingdom: ficou em segundo com 77,9, seguido pelos Países Baixos :Netherlands: com 75,6. A China :China:, que iniciou uma série de bloqueios em resposta ao surto do Coronavírus, ocupa a 51ª posição com 48,2 pontos. No mapa que mostra os níveis de preparação em todo o mundo, a vulnerabilidade da África é imediatamente perceptível. O continente lutou contra doenças graves no passado e, em 2014, um grande surto de Ebola deixou partes devastadas da África Ocidental, matando mais de 10.000 pessoas. Até agora, nenhum país da África relatou um caso confirmado de coronavírus. No entanto, o continente tem alguns dos países mais fracos quando se trata de conter doenças, sendo a Guiné Equatorial :Equatorial_Guinea: (16.2) e a Somália :Somalia: (16.6) os países com pior pontuação no Índice Global de Segurança Sanitária. Acesso ao relatório do Índice Global de Segurança Sanitária: https://www.ghsindex.org/ Acesso à matéria do @statista: https://www.statista.com/chart/20629/ability-to-respond-to-an-epidemic-or-pandemic/ #geografiageral #geografia #geography #saude #medicina #coronavirus #atualidades #mapamundi #worldmap
2231610164474049774; 1; False; 1580248683; passend zur morgigen #tz hier schon die #Therapie -Empfehlung nach Jens S. (#gesundheitsminister) für's #Immunsystem: täglich eine Ampulle #corona:beer_mug: je zu den Mahlzeiten! #corona #coronavirus #coronatherapy
2231610161319125786; 1; False; 1580248683; #coronavirus #coronavirusoutbreak #wuhan #wuhanvirus #wuhanvirusoutbreak #coronavirusnews #wuhancoronavirus
2231610117489299993; 0; False; 1580248678; I think I just caught the #coronavirus
2231610103839377071; 1; False; 1580248676; Imagine nigga. . . . . . . . . . . #memes#dank #dankmemes#funny#corona#virus #coronavirus #awesome#pewdiepie #superfun#goals#couple #quotes #sofunny#bored#lol#wow#wtf#new#memepages#dsrkmemes#offensivememes:sweat_droplets::eyes::hundred_points::face_with_tears_of_joy::face_with_tears_of_joy::gem_stone::fire::face_with_steam_from_nose::sweat_droplets::OK_hand::hundred_points::face_with_tears_of_joy::folded_hands::face_with_tears_of_joy::face_with_tears_of_joy::gem_stone::gem_stone::fire::face_with_steam_from_nose::sweat_droplets::eyes::eyes: #offensive #offensivememes#supermemes#sexymemes#coolmemes#memesforkids#meme4mykid
2231610030424237132; 6; False; 1580248668; Concentració modo on :ON!_arrow: #vueltaalcole #tornadaaltreball #periodista #àpunt #àpuntmèdia #àpuntnotícies #redacció #20hntc:satellite_antenna: #actualitat #coronavirus #ultimahora #mon #comunitatvalenciana #tv #working
2231609997220261258; 3; False; 1580248664; JAJJJAJJAJAJAJAJAJJA vrg:face_with_tears_of_joy::face_with_tears_of_joy::grinning_squinting_face::grinning_squinting_face::grinning_squinting_face: . . . #ecuador #ecuador:Ecuador: #coronavirus #humorecuatoriano
2231609856106978402; 5; False; 1580248657; Aynı böylesiniz aq ama yinede kaçışınız yok .d #corona #virus #coronavirus #wuhan #china #corona #virus #turkey #usa #russia #sirke #korona #türkiye #wuhan
2231609942242380757; 6; False; 1580248657; I pissed her off then SMASHED her phone- but then gave her a $1500 iPhone 11 Pro Max :red_heart: am I great boyfriend or what?? • • • • Subscribe to our channel to keep up with the shenanigans! • • • • • • #ripkobe #kobe #smallyoutuber #blackyoutubers #youtubefamily #explore #pranks #funnyvids #laughable #laughingmemes #shotoniphone11pro #youtubecouple #funnyasf #iphone11promax #letsgoviral #hilariousvideos #virusvideo #coronavirus
2231605825113435944; 28; False; 1580248653; I pissed her off then SMASHED her phone- but then gave her a $1500 iPhone 11 Pro Max :red_heart: am I great boyfriend or what?? • • • • Subscribe to our channel to keep up with the shenanigans! Shout out to the homie @yosoynewby for the assist with this prank :rolling_on_the_floor_laughing: you’re a legend • • • • • #ripkobe #kobe #smallyoutuber #blackyoutubers #youtubefamily #explore #pranks #funnyvids #laughable #laughingmemes #shotoniphone11pro #youtubecouple #funnyasf #iphone11promax #letsgoviral #hilariousvideos #virusvideo #coronavirus
2231609012911489946; 2; False; 1580248651; Thought he was a good boy first:flushed_face::crying_face: ¤ ¤ ¤ ¤ ¤ ¤ ¤ ¤ ¤ ¤ Tags just for growth: #penguin #memes #funniest #offensive #edgy #everyday #dailydankmemes #spiceymemes #yeetmemes #pewdiepie #robloxmemes #juicymemes #dopememes #memeforyou #jimmyneutronmemes #jimmyneutron #coronavirus #bestmeme #followforfollow #wtfvideos #funnyclips #offensivehumor #memester #superfunny #fatanimals #stonks #offensiveshit #youlaughyoulose #youlaughed #makeyoulaugh
2231609861360407720; 0; False; 1580248647; #Venezuela #Yaracuy #Salud Sistema de alerta por #Coronavirus está activo y desplegado en Yaracuy https://cibernoticiasca.blogspot.com/2020/01/sistema-de-alerta-por-coronavirus-esta.html
2231609770946061542; 5; False; 1580248637; Bandida! SÍGUEME @ellosdicen.pe . . . #meme #memes #momos #momosperuanos #momaso #humor #memesperuanos #risas #chistes #humorperuano #peru #lima #risa #memesgraciosos #humornegro #trujillo #lima #coronavirus #beso #virus #chino #party #arribaalianza #daleu
2231609589711062122; 31; False; 1580248631; #China El #coronavirus deja a Wuhan como una ciudad fantasma . La epidemia ya es más que una crisis sanitaria. El número de personas que han contraído la enfermedad y el de fallecidos sigue aumentando. En la ciudad de Wuhan, en el centro de China y origen de la infección, 11 millones de personas se han quedado atrapadas, a causa de su cierre total por la cuarentena. Las imágenes aéreas de la ciudad muestran las calles vacías y cómo se ha convertido en una ciudad fantasma. Por las noches la gente grita desde sus ventanas para darse ánimos “Vamos a salir” “Adelante Wuhan”.
2231609701237616776; 3; False; 1580248628; Stay safe from the coronavirus y’all • • •Edit:there are actually 106 deaths and 4,700 cases Credit:@Chcrry.gloss Follow @gurly.teen_hacks for more:red_heart::red_heart: #coronavirus #coronavirusoutbreak #precautions #besafe #whewchiletheghetto #virusessuck
2231607388188636924; 1; False; 1580248625; #conspiracytheory #gaming #coronavirus
2231609602747919917; 0; False; 1580248617; :face_with_medical_mask::hospital::ambulance::biohazard:Consiglio medico sanitario:biohazard::ambulance::hospital::face_with_medical_mask: Si informano i vari amici, parenti, colleghi e conoscenti, che in questo momento così drammatico e problematico a causa del diffondersi del coronavirus:nauseated_face::face_vomiting: in Cina :face_with_medical_mask:sarebbe consigliabile non andare nei negozi cinesi per un breve medio periodo, finché questo virus non sarà circoscritto e sconfinato; il perché è giustificabile in quanto molte persone e commercianti cinesi che lavorano in Italia, hanno contatti continui con la catena di distribuzione nei loro ingrossi, dove tanti imprenditori cinesi vengono o sono passati per Wuhan per ovvi motivi di business nell'ultimo periodo. Lanciamo questo appello solo a scopo protettivo della salute nazionale. Fate girare se siete d'accordo #save #italy #no #coronavirus
2231609567918377256; 1; False; 1580248612; Lost . Leica M8 Elmarit-M 1:2.8/24 ASPH. . Shot by me. . #leicaphotography #leicam8 #photographer #photos #fr #francais #paris #camera #coronavirus
2231609295682489596; 0; False; 1580248611; #Repost from @amelmilenialss with @regram.app ... INNALILLAHI, KOK BISA KEMAKAN ITU LOH, GAK ADA SAMA SEKALI RASA IBA DI HATINYA, MEMANG PATUT NEGRI INI DI BINASAKAN #chinavirus #corona #coronavirus #wuhansars
2231609548917792351; 1; False; 1580248610; O Brasil não podia ficar de fora. Já vou começar a tomar álcool gel de café da manhã. . . . #novocoronavírus #coronavirus
2231609460762540051; 0; False; 1580248600; From u/apmcruZ #workout #marriage #proposal #propose #gym #corona #coronavirus #china #worldwar3 #worldwar #worldwarmemes #worldwar3memes #draft #darkhumor #darkhumormemes #reddit #redditmemes #meme #blackhole #memes #cursedcomments #cursedcomment #cursed #comment #pewdiepie #reddit #school #cursed #cursedimages #shooter #youtube #youtuber
2231609401805892217; 12; False; 1580248593; Rabbi Yekutiel Kalmenson made a special trip to Shanghai, about three hours away by bus, in order to stock up on Kosher products. As the death toll and emergency measures increase daily, Jewish communities in cities across China joined the population at large in the struggle to protect themselves against the new deadly #coronavirus and cope with the extreme precautions being taken to guard against the spread of the flu-like respiratory disease. As of Tuesday, the virus has claimed at least 106 lives and infected more than 4,500 people in China alone. #Chabad-#Lubavitch representatives and other Jewish community leaders across the country are doing their best to help and reassure residents and visitors while taking steps to protect themselves and their families. In China’s capital, Rabbi Shimon Freundlich, co-director of Chabad of Beijing with his wife, Dini, told Chabad.org that he helped secure the evacuation of a Jewish mother and daughter from Palo Alto, Calif., who were visiting family for the Chinese New Year in Wuhan, the epicenter of the virus. Freundlich said he was contacted about the matter by Rabbi Yosef Levin of Chabad of Palo Alto, Calif., where the mother, Dr. Esther Tebeka, and her family are congregants. Tebeka and her 16-year-old daughter flew to safety Tuesday night on a converted U.S. cargo plane bound for San Francisco with 228 others, including U.S. government employees and officials stationed around #China. The arrangements were made with the help of one of Freundlich’s congregants, who was able to have Tebeka and her daughter added to the flight. Meanwhile, Freundlich said that he and his family are vigilantly following health protocols calling for constant hand-washing, produce-washing, the avoidance of hand-shaking and the donning of what has become a scarce supply of face masks. He asked three girls who teach in a #Beijing Jewish day school to return with 5,000 masks from their recent trip to Cambodia for the #Chinese holiday.
2231609370792189324; 0; False; 1580248589; INFÓRMATE | Te invitamos a conocer más sobre el #Coronavirus y a mantenerte informado por los canales oficiales. No extiendas rumores, aún no existen casos confirmados en Ecuador. #QuitoSaludableOtraVez
2231609349478602733; 2; False; 1580248586; Got the last box in town, who wants one? Bidding starts at $12/mask. Capitalism in effect! #sars #coronavirus #toronto #medicalmask #madeinwuhan #madeinchina
2231602443734075228; 6; False; 1580248584; Así fue como Dino se deshizo de mí :grinning_face_with_sweat: #andamosruleta #tiktok #dinocornios #playcouple
2231608989321672793; 1; False; 1580248574; if ur feeling a little under the weather, I hope you stay tf away from me :loudly_crying_face::middle_finger_medium-dark_skin_tone::double_exclamation_mark:
2231609220881500747; 0; False; 1580248571; #ciencia #science #cienciaentumano#vivalaciencia #soñemos #futuro #future #esperanza #hope #descubrimiento #vida #life #servivo #avance #laboratorio #lab #cientificos #Scientists #china #virus #coronavirus #vacuna #vacune #enfermedad #disease
2231609186344226702; 0; False; 1580248567; Tout va mal en fait. #coronavirus #réformedesretraites #feuxenAustralie #freinsdelavoiture #tachesurmachaussure #vener #maistropvener
2231609163813713600; 0; False; 1580248564; Bin ich gefährdet, muss ich mich schützen? Die wichtigsten Fragen und Antworten zum #Coronavirus im Überblick: https://www.infektionsschutz.de/coronavirus-2019-ncov.html https://www.rki.de/SharedDocs/FAQ/NCOV2019/FAQ_Liste.html
2231609155995451723; 0; False; 1580248563; Oh dammmn :face_with_tears_of_joy: #meme #coronavirus #corona #rez
2231609103783262706; 0; False; 1580248557; #prepared #coronavirus Who's crazy now?LOL
2231609077243624312; 3; False; 1580248554; Amen :folded_hands_medium-light_skin_tone::red_heart::raising_hands: #Amen #Jesus #Church #Godisgood #blessed #Bible #Church #Christian #gym #coffee #sports #love #igdaily #reading #books #God #jesussaves #forgiven935 #jesuschrist #fishing #nba #coronavirus #war #saved
2231609066363516836; 1; False; 1580248553; #CoronaVirus
2231609033580079698; 0; False; 1580248549; Coronavirus merch now available! www.bit.ly/CorVirus #coronavirus #coronaviruses #merch #shop #clothes #clothing #model #teespring #hoodies #tshirt #corona #virus #trending #trendy #trend
2231608774504841341; 0; False; 1580248548; Çində koronavirusuna yoluxanlarin son halları ölüləri və diriləri haqqinda məlumat yoxdur #coronavirus #aztagram #baku #koronavirus #azeri
2231608971723308452; 0; False; 1580248541; these are all confirmed countries with coronavirus cases. To be safe from the deadly virus, carry gloves, hand sanitizer and never touch your, ears,eyes,nose or mouth before washing your hands with soap or an antibacterial thing. #coronavirus #foryou
2231608934676971200; 0; False; 1580248537; INFÓRMATE | Te invitamos a conocer más sobre el #Coronavirus y a mantenerte informado por los canales oficiales. No extiendas rumores, aún no existen casos confirmados en Ecuador. #QuitoSaludableOtraVez
2231608932665639713; 0; False; 1580248537; :sunflower:Botas pa que amarre el vato:sunflower: (Nuevas) talla 3 1/2 $500 . . . #bazar #botas #invierno #ozono #terciopelo #negro #nice #coronavirus #bara #bonito #bello
2231608916400067762; 1; False; 1580248535; History repeats it self #coronavirus #repost #news#hundredyears #century
2231608903630701184; 0; False; 1580248533; #Dengue #Coronavirus #MemesBr #TudoViraMeme #piada #Hahaha
2231608867376465240; 2; False; 1580248529; #coronavirus
2231608770824395191; 0; False; 1580248517; SofaScore is the most data packed sports app. Our best reviewed app so far! #sofascore #ios #android #app #news #sport #apps #review #kobe #bryant #coronavirus #sports #football #tennis #rugby #cricket #badminton #darts
2231608756478088835; 0; False; 1580248516; Olhem a foto do causador desse problema mundial. Repost from @newscientist using @RepostRegramApp - The new 2019-nCoV coronavirus which has infected thousands of people after emerging in Wuhan, China in December has been imaged under an electron microscope for the first time. ⁠ ⁠ The China Novel Coronavirus Investigating and Research Team, a group of scientists from across China working together to find out more about the outbreak, managed to isolate a sample of the virus from an infected patient in Wuhan. ⁠ ⁠ The image shows the coronavirus virion (a virus outside its host cell) and its quite distinctive spikes which give it the appearance of a solar corona, hence the name coronavirus.⁠ ⁠ Image credit: Zhu et al/NEJM :copyright: 2020, Massachusetts Medical Society #Coronavirus #Virion #Virus #Virusoutbreak #2019nCoV #Wuhan
2231608746354476812; 0; False; 1580248514; Efectuamos todo tipo de pruebas de laboratorio clínico a los mejores precios del mercado...solicita cualquier presupuesto a través de whats app por nuestro telf 0414.547.78.36 o dirígete a las instalaciones de nuestro laboratorio ubicado en el Hogar Hispano de Valencia de lunes a viernes de 7 a 3 p.m..... TRABAJAMOS para socios del club como para no socios, así como con Salud Ocupacional para tu empresa a excelentes precios.... #perfil20#examenesdelaboratorio#examenesdesangre#antigenoprostatico#valencia#promociones#laboratorio#perfiltiroideo#hogarhispanoval#caronicalaboratorioclinico#coronavirus#saludocupacional#salud#china
2231608729559980553; 0; False; 1580248512; [BLOG] China corre contra o relógio para construir um hospital em 10 dias. ⠀ Nos arredores de Wuhan, na China, a construção de um hospital com mil leitos, para tratar pacientes com coronavírus, se assemelha a uma corrida contra o relógio, com centenas de trabalhadores, dezenas de escavadeiras e seus termômetros para detectar a pneumonia viral. "É preciso trabalhar rápido para combater a epidemia", diz um trabalhador, que prefere não dar seu nome. ⠀ #INBEC #PósGraduação #Especialização #China #CoronaVirus #Wuhan #Hospital
2231608542461167619; 6; False; 1580248507; #coronavirus #samere #beurck
2231608674707446465; 8; False; 1580248506; #STOP EATING ANIMALS/SEAFOOD:double_exclamation_mark: GET :clapping_hands_medium_skin_tone: IT :clapping_hands_medium_skin_tone: THRU :clapping_hands_medium_skin_tone: YOUR :clapping_hands_medium_skin_tone: FUCKING :clapping_hands_medium_skin_tone: HEAD:double_exclamation_mark: ITS 2020 GODAMMITT:double_exclamation_mark: LET THE HEARTLESS, IGNORANT MFS PARISH FOR LACK OF KNOWLEDGE:double_exclamation_mark:#facts #coronavirus #cancer #diabetes #obesity #cloggedarteries #sick #parasite #illness #detox #cleanse #alkaline #drsebi #vegan #nutritarian
2231608599619246932; 1; False; 1580248497; INFÓRMATE | Te invitamos a conocer más sobre el #Coronavirus y a mantenerte informado por los canales oficiales. No extiendas rumores, aún no existen casos confirmados en Ecuador. #QuitoSaludableOtraVez
2231607946828552594; 0; False; 1580248493; Çin, Wuhan kenti hayalet kasabaya döndü. Yetkililer salgını önlemeye çalışıyor. Endemi :SOON_arrow: pandemi olabilir. #coronavirüsü #coronavirus
2231608302394136746; 4; False; 1580248490; Taxi driver :oncoming_taxi: #WuhanSARS #WuhanOutbreak #CCPChina #chinazi #SARS2020 #武漢肺炎 #武汉疫情 #ChinaVirus #CoronavirusOutbreak at #Wuhan #china #武漢疫情 #冠狀病毒 #武漢肺炎 #新型肺炎 #新型コロナウィルス #武漢 #武漢市新型冠狀病毒肺炎 #武漢市 #chinanews #becausechina #faceofchina #massmigration #springfestival #coronavirus #WuhanCoronavirus #WuhanPneumonia #wuhanvirus
2231608444935136356; 0; False; 1580248478; Reposted from @pictoline El coronavirus de Wuhan, China :face_with_medical_mask::globe_showing_Europe-Africa: Si no has estado al tanto de lo ocurrido en la última semana, estos son los datos más recientes: #coronavirus #wuhan #china #salud #virus - #regrann
2231513760141889074; 0; False; 1580248477; راههای پیشگیری از #کروناویروس #coronavirus #hiv #بیماری
2231608431202935597; 0; False; 1580248477; :Turkey:Alkol bazlı el ovma veya sabun ve su kullanarak elleri sık sık temizleyin; Öksürürken ve hapşırırken ağzınızı ve burnunuzu bükülmüş dirsek veya doku ile örtün - dokuyu derhal atın ve ellerinizi yıkayın; Ateş ve öksürüğü olanlarla yakın temastan kaçının; Ateş, öksürük ve nefes almada zorluk yaşıyorsanız erken tıbbi yardım alın ve önceki seyahat geçmişinizi sağlık uzmanınızla paylaşın; Halen yeni koronavirüs vakalarının yaşandığı bölgelerde canlı pazarları ziyaret ederken, canlı hayvanlarla ve hayvanlarla temas eden yüzeylerle doğrudan korumasız temastan kaçının; Çiğ veya az pişmiş hayvansal ürünlerin tüketiminden kaçınılmalıdır. Çiğ et, süt veya hayvan organları, iyi gıda güvenliği uygulamalarına göre pişmemiş gıdalarla çapraz kontaminasyonu önlemek için dikkatle kullanılmalıdır. :Germany:Reinigen Sie die Hände häufig mit einem Handpeeling auf Alkoholbasis oder mit Seife und Wasser. Bedecken Sie beim Husten und Niesen Mund und Nase mit einem gebogenen Ellbogen oder Papiertaschentuch - werfen Sie das Papiertaschentuch sofort weg und waschen Sie sich die Hände; Vermeiden Sie engen Kontakt mit Menschen mit Fieber und Husten; Wenn Sie Fieber, Husten und Atembeschwerden haben, suchen Sie frühzeitig medizinische Hilfe auf und teilen Sie Ihre bisherige Reiseanamnese Ihrem medizinischen Fachpersonal mit. Vermeiden Sie den direkten ungeschützten Kontakt mit lebenden Tieren und Tierkontaktflächen, während Sie noch lebende Märkte in Gebieten besuchen, in denen neue Fälle von Coronaviren aufgetreten sind. Der Verzehr von rohen oder nicht gekochten tierischen Produkten sollte vermieden werden. Rohes Fleisch, Milch oder tierische Organe sollten gemäß der guten Lebensmittelsicherheitspraxis mit Vorsicht verwendet werden, um eine Kreuzkontamination mit ungekochten Lebensmitteln zu vermeiden. #clinicalnews #coronavirus #virusoutbreak #corona #health #nursing #nurse #wuhan2020 #wuhanvirus #coronaoutbreak #who #china #doctor #hospital #european #europe #crisis #lastnews #cdc #coronavirus #wuhan2020 #outbreak #germany #germanycoronavirus
2231608369974637120; 0; False; 1580248470; #momasosdelmomento #coronavirus #memesespañol #momasosxd
2231608324489787283; 10; False; 1580248464; Good vibes only #coronavirus #bushfiresaustralia #worldwar3 #2020
2231608313544254137; 74; False; 1580248463; Coincidência? Eu acho que não :face_with_tears_of_joy: #residentevil #coronavirus #racconcity #jogo #game #meme #nerd #geek #distopianerd
2231608178982799154; 0; False; 1580248447; Bonjour， Je suis en bonne sante et je n’ai aucun symptôme de coronavirus. Par contre ce virus a une incubation de quinze jours avant qu’il se manifeste. Je choisi porter le masque pour me protéger et surtout pour ne pas transmettre le virus aux personne âgés et enfants près de moi car je m’inquiète pour eux. Ce masque chirurgical peut bloquer 99% de virus. J’utiliserai également gel hydroalcoolique après descendre le transport. Merci de comprendre mon intention pour me protéger et protéger les autres. Je crois que la France étant un pays de liberté et égalité peut accepter ma façon que je protége les gens que j’aime. J’espère d’être compris et acceptée. Merci #liberté #masque #coronavirus #chinoiserie # Paris # protection
2231606170899357914; 2; False; 1580248446; چین اعلام کرد ۴بیمار مبتلابه کرونا ویروس پس از بهبودی از بیمارستان مرخص شدند،این افراد در زمان بستری در حالت وخیمی قرار داشتند⁦:clapping_hands::clapping_hands:⁦:victory_hand:⁩ . . . . . #کرونا #کروناویروس #ویروس_کرونا #مدیریت_دانش #مدیریت #سلامتی #علم_پزشکی #پیشگیری #پیشگیری_درمان #پیشگیری_بهتر_از_درمان #ghovatedin #corona #coronavirus #خبر#خبر_فوری #ایران#کورد#تورک#عرب#اهواز#اصفهان#کرمان#کرمانشاه#تهران#آهنگ_جدید #آهنگ_جدید
2231608151736337170; 20; False; 1580248444; Tag a friend and follow @huncho.meme for more memes!
2231608122762784419; 0; False; 1580248440; El temido (?) virus coronavirus llego a Tierra del Fuego en su peor versión: provoca síntomas muy desagradables como contar chistes malísimos de suegras, putear cada 2 palabras, y unas muletillas insoportables como «andå a lavarte las tetas» y «guacho puto lo parió». El doctor Eduardo Sierra nos manifestó: «Estoy preocupado. Anteriormente habíamos tenido casos con gente contando chistes del Negro Álvarez, Chichilo Viale o últimamente standaperos locales muy horribles realmente, pero esto es mucho peor: atendí un paciente que me dijo: ‘ponete de perfil hijo de p…'». #humorfueguino #coronavirus #jorgecorona #parodia #satira #virus #Ushuaia #riograndetdf #tolhuin #tierradelfuego #radio #ntet #ntettemporada9 #temporada9 #humor #chistes
2231608082832404354; 10; False; 1580248435; Në Top Show për #coronavirus #China #WuFlu
2231608075526493059; 8; False; 1580248434; From a Prince of Wales Hospital Ward Manager (HK) : It is more important to use hand sanitizer/wash hands than to wear a mask - no matter what kind of pneumonia, it is contagious by droplets. Because the droplets are heavy, they are not airborne, so chances are low that people will breathe these bacteria directly into the body. But the bacteria from the droplets can stay on the surface of any public object for 24 hours and still be active, including elevator buttons, any handrails, and even the salt/pepper/seasoning racks in restaurants. Studies have shown that an average person touches the face 10 times every hour (fixing glasses, squinting eyes, blowing your nose). Once your hands are contaminated and you touch your eyes/nose/mouth, you will be at risk. This is also why in the early stage of SARS, even though medical staff wore N95 masks they still contracted the disease. Sanitizing and washing your hands often is more important. - Very good advice! . Please share. #coronavirus #washyourhands
2231607961138854399; 0; False; 1580248421; Today I'm home sick... There's a whole virus going on in Oregon that's making everyone sick R.I.P. #coronavirus
2231607847229929995; 0; False; 1580248419; 溫哥華出現第一宗武漢肺炎確診病例 . . . #Canada #BC #Vancouver #Coronavirus #Wuhan #mingpaocanada #mingpaonews #mingpao #明報加拿大 #明報加東網 #明報
2231607920889874516; 0; False; 1580248416; Diyanet İşleri Başkanı Erbaş: “Kudüs, Filistin devletinin ebedi başkentidir” #corona #coronarvirus #koronavirus #virüs #deprem #çin #Wuhan #türkiye #almanya #istanbul #izmir #adana #gaziantep #salgın #hastalık #coronavirues #CoronaVirus #takipçikazan #gt #antalya #trabzon #afad #haber #SonDakika #filistin #followme #likeme #kudüs #diyanetişleribaşkanlığı #çin . Dünya'da Olan En Güncel Olay ve Gelişmelerden herkesten önce haberdar olmak istemezmisiniz? @reflexhaber Bizi Takip Edebilirsiniz.
2231607890447982768; 7; False; 1580248412; :man_tipping_hand_light_skin_tone: #coronavirus #coronavirusoutbreak #coronavirusmemes
2231607881806377597; 0; False; 1580248411; #enfermagem #saude #coronavirus #brasil #ministeriodasaude
2231607792886998098; 1; False; 1580248401; For protecting our immunity & preserving it. There are 3 main vitamins :A, C , D Vitamin A: fish, cheese, shrimp, milk, eggs, carrots, sweet potatoes, broccoli, kale, and other fresh vegetables. Vitamin C: strawberries, pineapple, broccoli, mango, kiwi, papaya, guava. Vitamin D: The Sun , eggs, fish, beef liver, common mushrooms, and cereals. Beside ; The most important thing is to wash hands with soap regularly after doing any kind of activities because viruses can stick to things. #nutrition #byengyabouzeid #nutritionist #clinical #prevention #precautions #awareness #coronavirus #تغذية #تغذية_علاجية #تغذية_صحية #تغذية_سليمة
2231607791923406358; 0; False; 1580248401; What is corona virus? #corona#coronavirus#medical#mbbs#surgery#medicine#important#prevention#disease#virus#medicalstudent#doctor#patient#news#india#china Follow @drsilentknight for more information
2231607719304036172; 178; False; 1580248392; #coronavirus incluido :microbe:.
2231607692493092449; 1; False; 1580248389; Thinking of changing this account to a dark humour account #coronavirus #megamind #megamindmeme #megamindmemes #blue #bluememes #mega #mind #china #chinesefood #megamindisyomamme
2231607593146783920; 0; False; 1580248386; ENG: People try to leave quarantine zones by all means, but they are immediately caught. Because of the panic, many do not understand how dangerous this is. RUS: Люди всеми силами пытаются покинуть карантинные зоны, но их тут же ловят. Из-за паники многие не понимают, насколько это опасно. #china #china:China: #coronavirus #coronaviruses #corona #instagram #instadaily #news #picoftheday #life #wuhan #video #китай #коронавирус #новости #вирус
2231607529453189231; 0; False; 1580248382; Os novos casos de coronavírus preocupam autoridades do mundo todo. A Agência Brasil preparou uma série de matérias sobre o assunto. Acesse o link na bio e tire suas dúvidas sobre o coronavírus. #Coronavirus #SaúdePublica #PerguntasERespostas
2231607417178999440; 6; False; 1580248378; Lmao :face_with_tears_of_joy::face_with_tears_of_joy: #memes #coronavirus #coronavirusmemes
2231607594445734295; 2; False; 1580248377; Join the club WWIII :rolling_on_the_floor_laughing: • • • • #bestmemes #goodday #spongebobmemes #try #yourbestlife #coronavirus #selfcare #selflove #memes #memesdaily #dankmemes
2231607097497626943; 0; False; 1580248371; Omw Greenland - - - #coronavirusmemes #coronavirus #china #wuhan #outbreak #plagueinc #memes #meme #dankmeme #dankmemes #kobe #ww3 #corona #epicmemes #explorepage #explore #memez #memer
2231607545407923589; 0; False; 1580248371; INFÓRMATE | Te invitamos a conocer más sobre el #Coronavirus y a mantenerte informado por los canales oficiales. No extiendas rumores, aún no existen casos confirmados en Ecuador. #QuitoSaludableOtraVez
2231607009995258710; 1; False; 1580248365; #Repost @koronavirus_officiall ・・・ Вот такая очередь в больницу ! И это только начало ! Бедалаги(! #коронавирус #coronavirus #virus #новости #китай #china #chinaglaze #bbc
2231607481159048209; 0; False; 1580248364; #wuhanvirusaustralia #governmentcoverup #wuhan #coronavirus #coronavirus #arrestscottmorrisonfortreason “Researchers at Melbourne's Peter Doherty Institute for Infection and Immunity have become the first to recreate the virus outside of China”
2231607465111688352; 1; False; 1580248362; Literally lights my pants on fire Follow @dewpy20 Follow @dewpy20
2231607433897465864; 0; False; 1580248358; I can’t get the corona virus because all I drink is Modelo :smiling_face_with_sunglasses: – Cali - - - - #memes #dank #dankmemes #edgy #edgymemes #spicymemes #memesdaily #dailymemes #funny #cringe #cringy #mood #genz #tiktok #lol #lmao #lmfao #jokes #comedy #coronavirus #minecraft #pewdiepie #ww3 #offensivememes #memesdaily #vines #tumblr #twitter #tweets #textposts #shitposts
2231607415737331235; 0; False; 1580248356; :thinking_face::thinking_face::thinking_face: . . . #viruscorona #coronavirus #Virus #Corona #viruscorona #Update #HotNews #qolbumuslim #qolbu_muslim
2231607354792894906; 0; False; 1580248349; . . . . #virus #coronavirus #hahabeniz #benzo
2231607341353385695; 0; False; 1580248347; Worst case scenario :face_with_medical_mask: #coronavirus #outbreak #canonphotography #strobist #idminifigures #preiserphotography #preiser #miniaturephotography #miniatureworld #worstcasescenario #tabletopphotography #toyphotography #corona
2231604044573926558; 41; False; 1580248345; :right_arrow: Recado importante sobre o trabalho em #SantaCatarina para prevenir o Coronavírus. . Sua participação é importante. :movie_camera: Confira no vídeo. . #saúde #prevenção #coronavirus @saude.sc @divesantacatarina
2231607305248956782; 0; False; 1580248343; Posted @withregram • @nejm Visualization of #2019nCoV with Transmission Electron Microscopy. ⁠ ⁠ Negative-stained 2019-nCoV particles are shown in Panel A, and 2019-nCoV particles in the human airway epithelial cell ultrathin sections are shown in Panel B.⁠ ⁠ Read "A Novel Coronavirus from Patients with Pneumonia in China, 2019" on #NEJM | Link in bio directs to free full text. ⁠ ⁠ #coronavirus #viralinfections #emergencymedicine #criticalcare #infectiousdisease⁠
2231607196466375850; 0; False; 1580248330; Prevntive measures against corona virus#corona#coronavirus#medical#mbbs#surgery#medicine#important#prevention#disease#virus#medicalstudent#doctor#patient
2231607078002405990; 0; False; 1580248329; Oh no, toms gonna get the corona virus. . . . . . #meme #memes #bruh #dankmeme #dankmemes #darkmemes #darkhumor #edgy #edgymemes #epicgamermoment #dailymemes #funny #funnymemes #coronavirus
2231607153415032498; 9; False; 1580248325; Reposted from @dr.lucashomeopatia :SOS_button: Médicos da homeopatia clássica hahnemanniana evidenciam que os medicamentos homeopáticos têm ação curativa e preventiva em doenças epidêmicas quando selecionados conforme o conjunto de sintomas peculiares à epidemia, o qual é denominado “gênio epidêmico. . :right_arrow: Dr. Samuel Hahnemann, em 1799 utilizou a belladonna no controle de uma epidemia de escarlatina, posteriormente tratou uma epidemia de Tifo tendo conseguido aproximadamente 99% de sucesso nos resultados. . :right_arrow: A Homeopatia foi utilizada também nas seguintes epidemias: Epidemia de cólera na Europa (1821-1834); Epidemia de gripe espanhola (1918); Epidemia de Tifo, Bahia, Brasil (1925-1926); Profilaxia da meningite meningocócica, Guaratinguetá, SP (1974) – 18.640 doses, a incidência da doença na cidade ficou entre as menores do Estado de SP, com repercussão internacional.:winking_face: . :right_arrow: Homeopathy,99:156-166, 2010: Em Cuba verificou-se que a intervenção homeopática permitiu uma diminuição significativa nas taxas de Leptospirose: Potencial hemoprofilático no controle de epidemias. Petrópolis, Macaé (RJ) e Campo Grande (RS): Trabalho científico: Homeopatia para tratamento e prevenção da gripe H1N1 (int J High Dil Res, 12:125-126, 2013).:thumbs_up_light_skin_tone: . :right_arrow: Hahnemann, em seu clássico “Organon da Arte de Curar” (§241), descreve que “as epidemias de febre intermitente sob condições em que nenhuma é endêmica, são da natureza das doenças crônicas, compostas de uma única crise aguda; cada epidemia é de caráter peculiar, uniforme, comum a todos os indivíduos atacados, e quando este caráter se encontra na totalidade dos sintomas comuns a todos, leva-nos à descoberta do remédio homeopático adequado para todos os casos, que é quase universalmente utilizável nos pacientes de saúde mediana antes da epidemia […]”. . :right_arrow: Dr. Farokh Master (médico homeopata, Índia), identificou o medicamento Justicia adhatoda como sendo o medicamento homeopático indicado na prevenção e tratamento da atual epidemia do coronavírus. . #homeopatia #homeopathy #homeopathic #coronavirus #epidemia #antroposofia #waldorf #medicinaintegrativa - #regrann
2231607142543181345; 0; False; 1580248323; Doa menghadapi berbagai virus #doa #zikirpagi #pesantren #santri #mahasiswa #kampus #tarekat #islam #tijani #tijaniyah #coronavirus
2231606907486079814; 0; False; 1580248321; “China will stop individual travelers to Hong Kong to curb the spread of the coronavirus, Chief Executive Carrie Lam says‪.”‬⁣ ⁣ ‪From QuickTake on Twitter.‬⁣ ⁣ #news #breakingnews⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣ #worldnews⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣ #coronavirus #wuhanvirus #wuhancoronavirusoutbreak #WuhanCoronavirus⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣ #coronavirusoutbreak #corona #ncov2019 #ncov⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣ #武漢肺炎 #武汉疫情⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣ #China #Wuhan⁣⁣⁣⁣⁣ #StandWithWuhan⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣ #LunarNewYear #NewYear #SpringFestival⁣⁣ #HongKong #CarrieLam - #regrann
2231607080813121857; 0; False; 1580248316; . All the google scholars out there causing unnecessary panic around the coronavirus. Do yourself and the world a favour .. get your flu shot this year. Would be a much greater help than spewing misinformation about stuff you have know idea about. Get smart , be healthy , stop causing the unawares to panic. • • • #Coronavirus #Flu #MumLife #MummyBlogger #InstaCute #InstaKids #Darren #Darius #MomLife #MommyBlogger #4yo #7yo #BoyMom #Moms #MumTribe #MomSquad #TiltedCrowns #MomsOfInstagram #IG_Motherhood #AussieMum #KiwiMum #Summer #Gisborne #AussieInNewZealand
2231607081683732950; 0; False; 1580248316; INFÓRMATE | Te invitamos a conocer más sobre el #Coronavirus y a mantenerte informado por los canales oficiales. No extiendas rumores, aún no existen casos confirmados en Ecuador. #QuitoSaludableOtraVez
2231606939734069325; 0; False; 1580248299; INFÓRMATE | Te invitamos a conocer más sobre el #Coronavirus y a mantenerte informado por los canales oficiales. No extiendas rumores, aún no existen casos confirmados en Ecuador. #QuitoSaludableOtraVez
2231606885231279580; 1; False; 1580248293; #earthquake #comedy #jamaicanmusic #coronavirus #trump
2231606857062765456; 0; False; 1580248289; ATUALIZAÇÕES ESSENCIAIS SOBRE O NOVO CORONAVÍRUS _____________________________________ Vale ressaltar inicialmente que este, compõe uma grande família viral, registrados desde meados de 1960, que causam infecções respiratórias em seres humanos e em animais. Geralmente, infecções por coronavírus causam doenças respiratórias leves a moderadas, semelhantes a um resfriado comum. Alguns coronavírus podem causar doenças graves com impacto importante em termos de saúde pública, como a Síndrome Respiratória Aguda Grave (SARS), identificada em 2002 e a Síndrome Respiratória do Oriente Médio (MERS), identificada em 2012. TRANSMISSÃO A transmissão dos coronavírus costuma ocorrer pelo ar ou por contato pessoal com secreções contaminadas, como: gotículas de saliva; espirro; tosse; catarro; contato pessoal próximo, como toque ou aperto de mão; contato com objetos ou superfícies contaminadas, seguido de contato com a boca, nariz ou olhos. DIAGNÓSTICO O diagnóstico do novo coronavírus é feito com a coleta de materiais respiratórios (aspiração de vias aéreas ou indução de escarro). É necessária a coleta de duas amostras na suspeita do coronavírus. Para confirmar a doença é necessário realizar exames de biologia molecular que detecte o RNA viral. TRATAMENTO Não existe tratamento específico para infecções causadas por coronavírus humano. No caso do novo coronavírus é indicado repouso e consumo de bastante água, além de algumas medidas adotadas para aliviar os sintomas, conforme cada caso, como, por exemplo: Uso de medicamento para dor e febre (antitérmicos e analgésicos). Uso de humidificador no quarto ou tomar banho quente para auxiliar no alívio da dor de garanta e toss SINTOMAS Febre. Tosse. Dificuldade para respirar. Como o Brasil está se preparando para atuar em um possível caso do novo coronavírus? O Ministério da Saúde realiza monitoramento diário da situação junto à Organização Mundial da Saúde (OMS), que acompanha o assunto desde as primeiras notificações de casos em Wuhan, na China, no dia 31 de dezembro de 2019. FONTE: http://www.saude.gov.br/saude-de-a-z/novocoronavirus #coronavirus #coronabreak #brasil #boanoite #fisioterapia #estudos #atualidades
2231606854195451866; 0; False; 1580248289; INFÓRMATE | Te invitamos a conocer más sobre el #Coronavirus y a mantenerte informado por los canales oficiales. No extiendas rumores, aún no existen casos confirmados en Ecuador. #QuitoSaludableOtraVez
2231606847005335425; 3; False; 1580248288; Damn yall hear somethin?⁣ ⁣ ⁣ ⁣ ⁣ ⁣ ⁣ ⁣ ⁣ ⁣ ⁣ ⁣ ⁣ ⁣ ⁣ ⁣ ⁣ ⁣ ⁣ #funnymemes #cancerousmemes #wholesomememes #surrealmemes #cringememes #cursedimage #funnyedits #shitposts #deepfriedmemes #surreal #wholesomememe #dankmemes #darkmemes #smashultimate #ww3 #aliens #nicememe #nicememes #spicymemes #memes:face_with_tears_of_joy: #tumblr #comedy #trending #frontpage #explore #meme #memes #coronavirus #coronavirusmemes #australia
2231606790240356293; 1; False; 1580248281; :round_pushpin:Lookfantastic @lookfantastic this Works @thisworks I 18,29€!! ______________________________ :United_Kingdom: this Works Deep Sleep Pillow Spray 75ml II Original price 23,45€, now for 18,29€ II Save 22% with Code: HALLO2020 II >>>>> Suitable during pregnancy! II >>>>> 97% slept better 89% fell asleep faster 98% felt more refreshed in the morning 100% would recommend deep sleep pillow spray to a friend* *In a study of 100 subjects and 100 ex-prescription users compared to no product. >>>>> WHEN: use at bedtime to help reduce sleep anxiety and improve sleep quality. . HOW: our award-winning natural, aromatherapeutic Superblend of Lavender, Vetivert and Camomile calm both mind and body, soothing you to sleep. . WHY: when we sleep our skin cells repair and harmful toxins are removed, making sleep the ultimate beauty secret and first step in your skincare routine. ____________________________ :Germany: this works Deep Sleep Kissenspray 75ml II Originalpreis 23,45€, jetzt für 18,29€ II SPARE 22% mit Code: HALLO2020 >>>>> Geeignet für die Verwendung während der Schwangerschaft. >>>>> Das 97% der Probanden haben besser geschlafen Das 89% der Probanden sind schneller eingeschlafen Das 98% der Probanden fühlten sich am Morgen mehr erfrischt Das 100% der Probanden würden das Deep Sleep Pillow Spray an einen Freund empfehlen* *In einer Studie von 100 Probanden und 100 ehemaligen verschreibungspflichtigen Benutzern im Vergleich zu keinem Produkt. >>>>> WANN: Beruhigen Sie den Geist, verbessern Sie die Schlafqualität und fühlen Sie sich erfrischt, wenn Sie aufwachen. . WIE: Unsere schlaffördernde Supermischung kombiniert entspannenden Lavendel mit Vetiver und beruhigender Kamille, um die Sinne zu beruhigen und Unruhe beim Schlafen zu lindern. . WARUM: Wachen Sie auf und sehen Sie sichtbar erfrischt aus, angetrieben von einer besseren Nacht. ____________________________ #thisworks #pillowspray #kissenspray #lookfantastic #angobot #hallo2020 #thisworksforme #sleepwell #deepsleep #icantsleep #antistress #stress #insomnia #goodnight #health #traum #bedtime #wellness #healthylifestyle #smelllikehome #kobeRIP #coronavirus #berlin #saarbrücken #ohhhdiscount #bayern #sale #selflove
2231606459267675583; 58; False; 1580248279; Kevin Carpenter who arrived today at the Norman Manley International Airport in Kingston from Toronto, Canada, one of the countries that have recorded a case of the #coronavirus, says there was no screening for the virus upon his arrival. He also said he noticed people wearing masks at Toronto's Pearson International Airport.
2231604776437821437; 0; False; 1580248275; Virus hopefully has not entered Jamaica :Jamaica: #coronavirus #screening #becareful #cuidado
2231603788436280889; 0; False; 1580248254; Follow coronaantivirus for more! :bat: - - - - - - - - - - - - #meme #coronavirus #plague #dank #bruhmoment #wwz #ww3 #lmao #dankmemes #lol #corona #yolo #china #plagues #rofl #dead #explore #bruh #clown #clownmemes #w #haha #lmfao
2231606544043053830; 1; False; 1580248252; #Repost @rioconciergecare • • • • • • No final de janeiro de 2020, um surto de um novo coronavírus incluiu milhares de casos na China;. O coronavírus é um vírus de RNA da Ordem Nidovirales Família: Coronaviridae que infecta primariamente mamíferos e aves. O 2019-nCOV tem similaridade com o SARS-CoV (2002 – sem atividade atual) e o MERS-CoV (2012 – até 2020 no Oriente Médio), patógenos respiratórios de fácil disseminação e que podem causar formas graves de síndrome viral. A doença é caracterizada principalmente por febre, tosse e infiltrados bilaterais na imagem do tórax. A possibilidade desse novo coronavírus deve ser considerada em pacientes com febre e / ou sintomas do trato respiratório inferior que residem ou viajaram recentemente para a área de Wuhan na China ou que tiveram contato próximo com um caso confirmado ou suspeito de novo coronavírus. Mais informações no nosso site. www.conciergecare.com.br⠀⠀ Rua Visconde de Pirajá, 82 - Sobreloja, 204.⠀ Ipanema - Rio de Janeiro | RJ⠀ rioconciergecare@gmail.com⠀ 21 99523 3636.⠀ 21 2523 3636.⠀ #coronavirus #prevenção #cardiologia #clinicogeral #conciergecare #CTI #doctor #geriatria #health #hospital #instadaily #medicina #medicinadefamilia #medico #nutricao #rioconciergecare #riodejaneiro #rj #saude #UTI
2231606526769028913; 0; False; 1580248250; INFÓRMATE | Te invitamos a conocer más sobre el #Coronavirus y a mantenerte informado por los canales oficiales. No extiendas rumores, aún no existen casos confirmados en Ecuador. #QuitoSaludableOtraVez
2231606200193471360; 0; False; 1580248249; Brooo whattt:skull::skull::skull::skull: Follow @frostedlol if you enjoyed . . . . #meme #memes #funny #dankmemes #memesdaily #funnymemes #lol #dank #relatable #like #follow #Imao #dankmeme #edgymemes #offensivememes #anime #twitter #coronavirus #comedy #dailymemes #edgy #followme #noticeme #funnymeme #followforfollow #foryou #tiktok #twittermemes #explore #helpmegrow
2231606492000021524; 0; False; 1580248246; :orange_heart:"EL único modo de hacer un gran trabajo, es amar lo que haces.":orange_heart: -steve jobs :red_heart::fountain::red_heart: . .:camera_with_flash:@mork_gamer . . . #locura #parati #viral #coronavirus #juvenil #tiktok #tiktokdance #youtube #youtuber #intagram #intagramer #vlogger #figurapublica #chile #chilegram #chile:Chile: #chilito #pop #trap #influencer #influencerchile #como #para #ser
2231606064701531422; 0; False; 1580248195; :police_car_light:Alert! With recent cases of coronavirus, 2 of which are confirmed in Toronto, here are few few tips by @who. • #coronavirus #virus #worldhealthorganization #toronto #wuhan #china
2231605990041328441; 0; False; 1580248186; . . . #memes #dankmemes #memesdaily #darkmemes #dark #darkhumor #coronavirus #coronavirusmemes
2231592391639276515; 11; False; 1580246565; УРОКИ ЖИЗНИ ... :broken_heart: ⠀ А вы учитесь на уроках, которые Вам преподносит жизнь ? Я думаю, данная ситуация должна меня многому научить! Я летела с разбитым сердцем в надежде отвлечься, забыться, а по итогу чуть не потеряла саму себя... Самое дорогое, что у нас есть это здоровье! И об этом не стоит забывать! Летели на китайские Мальдивы, а оказались в Минском изоляторе :woman_facepalming_medium-light_skin_tone:. Вот тебе и урок Вика. Первое - никогда не рискуйте своей жизнью. Второе - учитесь на чужих ошибках. И самое главное , моя самая большая ошибка - БЕЗ ПАНИКИ. В той ситуации было сложно не паниковать, и честно говоря, успокоиться я смогла лишь оказавшись дома. Сейчас нахожусь в больнице в ожидании результатов анализов... у меня будет много времени подумать над своими ошибками, и думать что же делать дальше ... ⠀ ⠀ ⠀ #коронавирус #хайнань #china #hainan #китай #пустьговорят #первыйканал #coronavirus #карантин #14дней
2231590765884421005; 0; False; 1580246371; Corona Virus #coronavirus #china #memes #funny #spongbob
2231393641254123930; 0; False; 1580222872; We are the superior ones :flushed_face: #hongkong #corona #china #hongkongers #coronavirus #coronavirusoutbreak #coronavirusmemes #coronavirusmeme #coronavirusmemesarenotfunny
2231389605285631610; 0; False; 1580222391; عذبتم و عزلتم المسلمين فعذبكم و عزلكم آلله سبحانه عن العالم قُل لَّن يُصِيبَنَا إِلَّا مَا كَتَبَ اللَّهُ لَنَا هُوَ مَوْلَانَا ۚ وَعَلَى اللَّهِ فَلْيَتَوَكَّلِ الْمُؤْمِنُونَ #jenesuispasunvirus #coronavirus #morocco cordialement
2231606513709296916; 0; False; 1580248248; #coronavirus
2231606484138189070; 0; False; 1580248245; INFÓRMATE | Te invitamos a conocer más sobre el #Coronavirus y a mantenerte informado por los canales oficiales. No extiendas rumores, aún no existen casos confirmados en Ecuador. #QuitoSaludableOtraVez
2231606435124696853; 0; False; 1580248239; Coronavirus merch now available! www.bit.ly/CorVirus #coronavirus #coronaviruses #merch #shop #clothes #clothing #model #teespring #hoodies #tshirt #corona #virus #trending #trendy #trend
2231606401571449646; 0; False; 1580248235; #infectologia #ccih #ccihmed #coronavirus #prevencaoinfeccao #cuidar #medicinaporamor
2231606390361775940; 1; False; 1580248234; Y a esta hora ya sabemos que hay al menos 1 caso confirmado en Alemania. · #Wuhan #China #Virus #Coronavirus #Salud #saludable #wuhanvirus #curiosidades #curiosidad #Chila #wuhanchina #enfermedad #cuerpoymente #medicamentos #medicinainterna #internalmedicine #emergenciologia #infectologia #medicinadeurgencia
2231606334009537723; 3; False; 1580248227; Amen :folded_hands_medium-light_skin_tone::red_heart::raising_hands: #Amen #Jesus #Church #Godisgood #blessed #Bible #Church #Christian #gym #coffee #sports #love #igdaily #reading #books #God #jesussaves #forgiven935 #jesuschrist #fishing #nba #coronavirus #war #saved
2231606319277227672; 1; False; 1580248225; :warning:Ú𝘭𝘵𝘪𝘮𝘢𝘴 𝘯𝘰𝘵𝘪𝘤𝘪𝘢𝘴 𝘴𝘰𝘣𝘳𝘦 𝘦𝘭 𝘊𝘰𝘳𝘰𝘯𝘢𝘷𝘪𝘳𝘶𝘴 𝘥𝘦 𝘞𝘶𝘩𝘢𝘯 𝘰 2019-𝘯𝘊𝘰𝘝:microbe::warning:. ⠀⠀⠀⠀⠀⠀⠀⠀⠀ :pushpin:La OMS ha emitido 7 informes desde que las autoridades sanitarias chinas comunicasen el 31 de Diciembre de 2019 los primeros casos de neumonía de etiología desconocida. ⠀⠀⠀⠀⠀⠀⠀⠀⠀ :pushpin:27 de Enero de 2020 la OMS ha emitido su último informe: -Casos confirmados a nivel global 2798 -China: 2741 confirmados:face_with_medical_mask: 5794 sospechosos:face_with_head-bandage: 461 graves:face_with_thermometer: 80 muertos:skull_and_crossbones: -Nivel de riesgo: *China ᴍᴜʏ ᴀʟᴛᴏ ↑ ↑ ↑ *Nivel regional ᴀʟᴛᴏ ↑ *Nivel global ᴀʟᴛᴏ ↑ Pero eso no quiere decir que constituya un PHEIC ( emergencia de salud pública de preocupación internacional). ⠀⠀⠀⠀⠀⠀⠀⠀⠀ :pushpin: El Gobierno de España a través del Ministerio de Sanidad recuerda que con la información disponible el riesgo de contagio en España es ʙᴀᴊᴏ:down_arrow:. ⠀⠀⠀⠀⠀⠀⠀⠀⠀ https://www.mscbs.gob.es/profesionales/saludPublica/ccayes/alertasActual/nCov-China/documentos/Actualizacion_10_2019-nCoV_China.pdf :pushpin:Y ha hecho una serie de recomendaciones para los viajeros que se dirijan a China https://www.mscbs.gob.es/profesionales/saludPublica/sanidadExterior/salud/pdf/NI_RecomendacionesSanitarias-Viajeros_WuhanHUBEI(China)-CORONAVIRUS2019-nCoV(Enero2020)_DEF.pdf
2231606257319323895; 0; False; 1580248218; #ElEjeMatutino Vaya que la mañanera dio temas para reflexionar: cómo es el boleto para el avión presidencial, la preparación para la llegada del #coronavirus y cómo va la resistencia al #Insabi. #Entérate. Dale clic al enlace que se encuentra en nuestra bio. . . . #amlo #conferencia #mañanera #gobierno #government #mexico #avionpresidencial #salud #comic
2231606238118304641; 0; False; 1580248215; Yo this shit scares the shit out of me #dankmemes #dirtymemes #dirty #dirtyhumor #corona #coronavirus #coronarender #funnymemes #sickmemes #funny #memesdaily #memepage #darkmemes #darkhumor #laugh #comedy #savagememes #savage #likeforlikes #followforfollowback #offensivememes #wtfmemes #spicymemes #deepfriedmemes #fortnite #depression #lmao #nsfw #depressionmemes #spicymemes #twistedmemes
2231606228503873312; 0; False; 1580248214; STOP EAT DI F:face_vomiting:KRY..more to come etc.:globe_showing_Asia-Australia: #NewYorkTimes:newspaper: We Made the #Coronavirus #Epidemic :face_with_medical_mask: It may have started with a bat in a cave, but human activity set it loose. By #DavidQuammen https://www.nytimes.com/2020/01/28/opinion/coronavirus-china.html #Leviticus11 :open_book: "For I am #JAH your #God: ye shall therefore sanctify yourselves, and ye shall be holy; for I am holy: neither shall ye defile yourselves with any manner of creeping thing that creepeth upon the earth. For I am Jah that bringeth you up out of the land of Egypt, to be your God: ye shall therefore be holy, for I am holy.. #Spiritual #Holy :folded_hands_dark_skin_tone:
2231606187888170386; 0; False; 1580248209; Énorme !#coronavirus
2231606115299311539; 3; False; 1580248201; #slowpoke #pokemon #pokemongo #coronavirus #corona #photooftheday
2231606105704203205; 0; False; 1580248200; CAPTION THIS #coronavirus #ww3 #kobe #ripkobebryant #iwillmissyou #prayforchina
2231605916917087925; 14; False; 1580248177; ALERTA NA SAÚDE :warning:O Ministério da saúde informou que agora são 3 os casos suspeitos de coronavírus no Brasil. Além da jovem de 22 anos em Minas, também são investigados casos em Curitiba (PR) e Porto Alegre (RS). Os pacientes apresentam sintomas da doença e estiveram recentemente na China. #noarnacbn #coronavirus #saude
2231605345152022882; 0; False; 1580248170; :night_with_stars: Un espectáculo de luces tiene lugar este 28 de enero en la ciudad #china de Wuhan, el epicentro del mortal #coronavirus. :right_arrow: La exhibición busca trasladar palabras de aliento a la población en cuarentena. . . . #CholilaOnline #CoronavirusChino
2231605855144689272; 201; False; 1580248170; Roblott’s Discount Warehouse in Toronto is one of the only stores with in-demand N95 masks still in stock :face_with_medical_mask: #Toronto #Adelaide #RoblottsDiscountWarehouse #N95Mask #Coronavirus - :camera_with_flash: @hctrvqz
2231605853994377657; 0; False; 1580248170; :pushpin:Bugünlerde en fazla gündemde olan halk arasında Çin gribi olarak adı geçen enfeksiyon #Coronavirus adındaki bir virüsün özellikle 2019 yılı Aralık ayı sonundan itibaren özellikle Çin’de yaptığı bir salgındır. #koronavirüs de diğer solunum yolu virüsleri gibi insandan insana solunum yolu salgıları ile bulaşıyor. Solunum yolu enfeksiyonu bulguları yanı sıra ishal de yapabiliyor. En önemli özelliği bazı hastalarda akciğerlerde ağır zatürre (#pnömoni) gelişmesi ve akut solunum yetmezliği ile ölüme neden olabilmesidir. :pushpin:Dünya Sağlık Örgütü Çin’deki salgınla ilgili herhangi bir seyahat veya ticaret kısıtlamasını şu an gerekli görmediğini, el yıkamaya özen gösterilip solunum yolu enfeksiyonlarından standart korunma yöntemlerine dikkat edilmesini öneriyor. Ayrıca et ve yumurta da iyi pişirilmiş olarak yenilmeli. Şu anda coronavirüse karşı etkili bir ilaç veya aşı yok. :pushpin:Sağlık Bakanımız da şu an için ülkemizde bu virüsün bir tehdit olmadığını açıkladı :folded_hands: :double_exclamation_mark:Risk grubunda kimler var? 5 yaş altı çocuklar 65 yaş üstü erişkinler Kronik hastalığı olanlar Hamileler Benim önerim sağlıklı beslenin, el yıkamaya özen gösterin ve hasta kişilerle çocukların temas etmesine elden geldiğince engel olun. Faydalanmasını istediğiniz kişileri etiketlemeyi unutmayın... Sağlıklı günler dilerim :smiling_face_with_3_hearts: #yenidoğan #bebek #çocuk #çingribi #koronavirus #coronavirus #grip #gripaşısı #who #dünyasağlıkörgütü #çocukdoktoruizmir . #Repost @prof.dr.esraozer with @make_repost ・・・
2231605841025602568; 0; False; 1580248168; Lifesaving tip for Corona virus #coronavirus #china #virus #europeanstyle #instaeu #europetour #continentoftheday #europeantour #eu #european #city #europhoto #daily #sightseeings #instaeuro #moments #visiting #instaeurope #europeanboy #europa #europeangirl #prilaga #igerseurope #igeurope #europeanvacation #tourists #europe
2231605835255287873; 0; False; 1580248167; . . . . . #memy #humorobrazkowy #pasjonaciubogiegozartu #virus #china #coronavirus
2231605747947398557; 55; False; 1580248157; For ya’ll who haven’t played this game - it's basically about virus outbreak that sweeps the whole world. Just let that sink in... Gamers have also been startled to discover that there is a biological research lab near the city where the outbreak originated has a familiar logo. Shanghai Ruilan Bao Hu San Biotech Limited seems to be linked to the Umbrella Corporation from Resident Evil. It has also been pointed out that Corona is an anagram of ‘Racoon’, fans of Resident Evil will know that the original outbreak in the game started in Raccoon city. -- -- #populationcontrol #staywoke #nwo #population #newworldorder #elite #explorepage #pinealgland #wakeuppeople #truthseeker #thirdeye #wakeupsheeple #anonymous #conscious #secretsocieties #mindcontrol #consciousawareness #politics #selfaware #freedomthinker #illuminati #truthseeker #conscious #awareness #peoplepower #depopulation #conspiracy #wakeup #coronavirus #news #newsflash #breakingnews
2231602091403265723; 2; False; 1580248154; The finally life of China became stay your room and cook your Food and don’t go outside to get Coronavirus. Even u scared with your close friend. Wtf :face_with_rolling_eyes::broken_heart: Finally #hangzhouchina is closed every shop and supermarket Because of #coronavirus, here is nearby my apartment and no one is here , #hangzhoucity #hangzhouchina #chinatown #chinese #chinesenewyear #wuhan #wuhanvirus #wuhanpneumonia #wuhanchina #wuhancity
2231605725969110690; 1; False; 1580248154; :hand_with_fingers_splayed: Creemos en el arte de la videografía . . . . . . . . #videogram #awesomevideo #videoshoot #videoclip #tweegram #videooftheday #videography #branddevelopment #imageconsulting #management #cinematography #videoworkshop #videographer #coronavirus #weddingvideo #wedding #trailer #lovestory #sweetbride #brides #instawedding #creativedesign #traveling #lightroom #digitalimaging #dslr #cameraporn #filmmaking
2231604184871129094; 11; False; 1580248146; #ULTIMAHORA #BREAKINGNEWS #ALERTA #CORONAVIRUS Se descubrió el origen del #corona #virus que ha afectado a millones de personas alrededor del mundo. Sus raíces provienen del mercado de #Wuhan, en donde ratas, serpientes, murciélagos, monos y otros animales son vendidos para actividades culinarias. Este mismo mercado dio inició a la enfermedad llamada Sars que inició en el 2003 y mato a 800 personas. El gobierno de #China debe implementar severas regulaciones en contra del tráfico de animales exóticos para su alimentación, por lo menos que pasen por un control de sanidad. #ChavezVive #Patria @presidencialven @nicolasmaduro @vicevenezuela @delcyrodriguezven @maduroguerra @partidopsuv @juventudpsuv Síguenos en @patriachavista
2231605640361529139; 0; False; 1580248144; INFÓRMATE | Te invitamos a conocer más sobre el #Coronavirus y a mantenerte informado por los canales oficiales. No extiendas rumores, aún no existen casos confirmados en Ecuador. #QuitoSaludableOtraVez
2231605584537602003; 0; False; 1580248138; Prevención: disminuir las probabilidades de que algo ocurra. Actualmente lo que más está preocupando es la posible llegada de este virus al país... . :right_arrow:No te preocupes, OCÚPATE:double_exclamation_mark: . :thinking_face:Más información al +56991781243 . . . #prevencion #virus #coronavirus #mejorprevenirquecurar #mantentesano #lasaludesloprimero #saludprimero #nutricioninteligente #oroliquido #omniplus
2231605449077506101; 0; False; 1580248137; People randomly fall in the street, for a collapse, and there's someone who broke his nose and bleed out layed down. Hope something is gonna happen :folded_hands_light_skin_tone:. Gods safe us. #helpwuhan #coronavirus #wuhan #virus #china #panic #god
2231605540127961032; 0; False; 1580248132; Nossa imunidade está sempre em altos e baixos e para piorar a cada momento surgem novas doenças, novos vírus e novas formas de piorar cada dia mais essa imunidade. Então como resolver? COMENDO COMIDA DE VERDADE. Mas alguém alimentos possuem alguns nutrientes chaves para dar aquele up na #imunidade. . :pushpin:zinco - carne vermelha, frango, peixes, semente de abóbora, oleaginosas, espinafre, abacate; :pushpin:Complexo B - vísceras de animais, leguminosas, legumes verde escuros; :pushpin:Vitamina C - frutas, principalmente cítricas; :pushpin:Vitamina A - vísceras, peixes, laticínios, ovos, legumes e frutas amarelos, alaranjados e verde escuros; :pushpin:Vitamina E - azeite e castanhas de todos os tipos; :pushpin:vitamina D - exposição solar acompanhada de boa ingestão de outras vitaminas e minerais; :pushpin:Compostos bioativos - própolis (extrato alcoólico), alho cru (azeite temperado pra salada com alho, chá de alho), gengibre (chá de gengibre, raspas de gengibre na água ou em sucos), cúrcuma com pimenta de reino (tempero de comida), canela (chá de canela, canela mas frutas ou vitaminas). . Sem mistérios, qualquer dúvida deixa um comentário aqui que a nutri responde :winking_face::face_blowing_a_kiss: . . . . . . . #virus #coronavirus #virose #saude #gripe #resfriado #temperatura #comidadeverdade #nutricao #dieta #foco #frutas #abacaxi #carnaval2020 #fantasiadecarnaval #petropolis #petropolisrj #rj #cidadeimperial
2231605509131940515; 67; False; 1580248129; Çin'in #coronavirus için özel olarak yaptığı hastanenin inşaatı, 48 saatte tamamlandı. . İkinci binanın inşaatı devam ediyor. . #toplumsalgündem
2231605347080288884; 1; False; 1580248109; God damn coronavirus • Follow @zestiest_memes for more!
2231605342652107496; 2; False; 1580248109; WAY OUT to fight with virus! #coronavirus #wuhan #wuhanvirus #wuhanchina
2231605320613749230; 0; False; 1580248106; :loudspeaker: Ministerio de Salud descarta caso de #coronavirus en joven proveniente de Taiwan, informó el director de Vigilancia de la Salud, el Dr. Guillermo Sequera. . :pushpin: El joven presentaba un cuadro respiratorio y fue asistido en un sanatorio privado. #R800AM. . :mobile_phone_with_arrow: Enterate más en www.launion.com.py :backhand_index_pointing_left_medium-light_skin_tone:
2231605114909323070; 0; False; 1580248082; #coronavirus #novocoronavírus @minsaude
2231605085597731505; 0; False; 1580248078; #CORONAVIRUS Ante los casos detectados en distintos países, la OMS Argentina y la OPS (Organización Panamericana de Salud) recomienda los siguientes cuidados a fin de reducir el riesgo de contagio. #Prevención
2231604467744376781; 2; False; 1580248074; As the #Wuhan #coronavirus continues to spread, it’s important to take proper precautions while trying your best remain calm:⁣ ⁣ Wash your hands often, avoid close contact with those who are sick, and maintain a healthy lifestyle to help strengthen your immune system!⁣ ⁣ Thanks for having me @foxfriendsfirst @foxnews @carleyshimkus!
2231604954477424780; 0; False; 1580248062; in #Bayern wurden drei weitere Fälle des #Coronavirus bestätigt: derchotv.de/2020/01/28/drei-weitere-coronavirus-faelle-in-bayern-bestaetigt/
2231604818322380295; 6; False; 1580248046; CORONAVIRUS ANTIVIRUS is..⠀ ⠀ critical thinking.⠀ ⠀ 1. It's near 320,000 types of viruses exist that infect mammals alone, according to a study published in 2013 in the journal American Society for Microbiology, and there are many more unknown and dangerous viruses than the corona:crown: thing that can kill you anytime.⠀ ⠀ 2. The "normal" flu or Influenza is causing between 12,000 – 61,000 deaths annually since 2010. So before, why didn't you carry your mask and sanitizer everytime you went out?⠀ ⠀ 3. By the way, have you ever heard that if you'll be frightened by something bad to happen it will actually happen to you? In case with #coronavirus it can be true. If you'll worry and overthink about this virus thing you'll make your body anxious. It's also proven that anxiety can cause the fall of immune system which makes you even more vulnerable to the corona virus (or any other illness).⠀ ⠀ 4. With everything being said above, ask yourself one more thing. Do you or someone you know have/has the corona virus diagnosis or symptoms? If not, then being anxious about the thing is a waste of time and your immune strength.⠀ ⠀ It's just one more virus among 320,000 or more!!⠀ ⠀ Don't make your immune system overwhelmed, go to the gym or park, eat your salad or fruits, drink you coffee or tea.⠀ ⠀ Just live your fear through, doing normal things.⠀ ⠀ ⠀ ⠀ ⠀ ⠀ #coronavirusantivirus #criticalthinking #spreadthevirus #viro #psychology #mentalhealth #anxiety #fear #immunesystem #anxietyawareness
2231604804781402081; 0; False; 1580248045; В конце декабря китайские власти сообщили о вспышке пневмонии неизвестного происхождения в густонаселенном городе Ухань (провинция Хубэй). Эксперты установили, что возбудителем заболевания стал новый тип коронавируса — 2019-nCoV, который передается от человека к человеку. Ученые Национального центра по профилактике и контролю заболеваний КНР провели анализ проб среды и заявили, что вероятный источник 2019-nCoV — оптовый рынок Хуанань в Ухане. Кроме того, он схож с коронавирусом из организма летучей мыши, обитающей в городе Чжоушань провинции Чжэцзян. Однако другие исследователи опровергли связь рынка с эпидемией новой болезни. #coronavirus#china#китай#китайскийвирус#вирус#followforfollowback#like4likes#news
2231604769164931179; 0; False; 1580248044; For Immediate Release - Possible #Coronavirus Cases in Ohio: https://buff.ly/310Mstj⠀ ⠀ CINCINNATI – The @cdcgov (CDC) is closely monitoring an outbreak of respiratory illness caused by a novel (new) coronavirus named 2019-nCoV. The outbreak first started in Wuhan, China, but cases have been identified in a growing number of other international locations, including the United States.⠀ ⠀ People Under Investigation in 26 states across the U.S.:⠀ Positive – 5⠀ Negative – 32⠀ Pending* – 73⠀ Total – 110⠀ ⠀ * Includes specimens received and awaiting testing, as well as specimens in route to CDC. Latest case totals can be found here.⠀ ⠀ The State of Ohio currently has 2 people under investigation located in Butler County, Ohio. Both possible cases had recently traveled and returned from China. These individuals are currently isolated while awaiting test results. Their symptoms did not require hospitalization.⠀ ⠀ It is important to remember that in outbreak situations, information is constantly evolving. The CDC says the disease is not spreading in the U.S., so the overall risk to the American Public is considered low at this time.⠀ ⠀ Local emergency response officials, hospitals, and local health departments train and prepare for incidents like this. Multi-agency partnerships and exercises keep our region safe. Best practice during flu season is to stay home when you aren’t feeling well, washing your hands regularly, and covering your mouth and nose when you cough or sneeze.⠀ ⠀ For additional information please visit:⠀ @OhioDepartmentofHealth⠀ @cdcgov⠀ Butler County General Health District⠀ @Statedept⠀ ⠀ -###-⠀ About The Health Collaborative: The Health Collaborative is a non-profit organization that leads data-driven improvements that result in healthier people, better care and lower costs. For more information about The Health Collaborative, visit https://buff.ly/2CGK6W3.
2231602840890087087; 0; False; 1580248042; Comedy ya netiZen di persilahkan >>>> #pubgindonesia #pubgmobileindonesia #pubgfunny #pointblankindonesia #indonesia #coronavirus #memeindonesia #mobilelegends #pubgmemes
2231604637142923350; 2; False; 1580248037; #memes #mem #memes:face_with_tears_of_joy: #meme #lol #kek #pablic #coronavirus #memestagram #memepage #memelife #memua #memru #ukraine #lalka #instagram #life #cool #nice #instalike #witcher #video #videostar #videos
2231604727152408885; 0; False; 1580248035; INFÓRMATE | Te invitamos a conocer más sobre el #Coronavirus y a mantenerte informado por los canales oficiales. No extiendas rumores, aún no existen casos confirmados en Ecuador. #QuitoSaludableOtraVez
2231604693992572196; 0; False; 1580248031; Estas salvado flaco :flexed_biceps_light_skin_tone::syringe::China: . . . . . #meme #ElProfeta #coronavirus #dragonballz #Cell
2231604657175966516; 0; False; 1580248027; #Salud Vía :backhand_index_pointing_right: @pictoline El coronavirus de Wuhan, China :face_with_medical_mask::globe_showing_Europe-Africa: Si no has estado al tanto de lo ocurrido en la última semana, estos son los datos más recientes: #coronavirus #wuhan #china #salud #virus - #NoticiasIslaTV
2231603941090967893; 0; False; 1580248016; Salute to News anchors/news producers who are wordsmiths, The Corona Virus and The Karate Kid musical make the Top 3 this week. This is Tony's Top 3! #newsanchors #newsproducers #coronavirus #karatekid #musical #cobrakai #like4like #follow #instagood #trending #follow #like #actor #improv #funny #comedy #trending #albuquerque #abq #newmexico #santafe #tonytshow #radio #mix1051 #mymix1051
2231603859896234416; 0; False; 1580248009; #greek #reportage #from #china #coronavirus #our #buddy #is #safe
2231604441757696863; 119; False; 1580248001; For ya’ll who haven’t played this game - its basically about virus outbreak that sweeps the whole world. Just let that sink in... — Gamers have also been startled to discover that there is a biological research lab near the city where the outbreak originated has a familiar logo. Shanghai Ruilan Bao Hu San Biotech Limited seems to be linked to the Umbrella Corporation from Resident Evil. It has also been pointed out that Corona is an anagram of ‘Racoon’, fans of Resident Evil will know that the original outbreak in the game started in Raccoon city. Follow my personal :backhand_index_pointing_right_medium_skin_tone: @itsazeem Follow my other :backhand_index_pointing_right_medium_skin_tone: @foundverity —— #populationcontrol #staywoke #nwo #population #newworldorder #elite #explorepage #pinealgland #wakeuppeople #truthseeker #thirdeye #wakeupsheeple #anonymous #conscious #secretsocieties #mindcontrol #consciousawareness #politics #selfaware #freedomthinker #illuminati #truthseeker #conscious #awareness #peoplepower #depopulation #conspiracy #wakeup #coronavirus #news #newsflash #breakingnews
2231604441017992160; 3; False; 1580248001; :warning: MAS DOUTORA, E O CORONAVÍRUS? :warning: . Mamães e papais, muita calma nessa hora! :fearful_face: Há 4 dias, o @hosp_einstein divulgou esse informativo super esclarecedor sobre o coronavírus, e resolvi compartilhar com vocês. . Nele, é informado que apenas 5 casos suspeitos de síndromes respiratórias foram notificados no Brasil, mas :right_arrow: NENHUM SE ENQUADROU :left_arrow: nas definições do coronavírus. . Ou seja, vamos respirar aliviados e ficar atentas e atentos às fake news, pois nesse momento de desespero, muita gente se aproveita do sofrimento alheio pra se aparecer. :face_with_steam_from_nose: . Créditos: @hosp_einstein #coronavirus
2231603239812363973; 2; False; 1580247993; CORONAVIRUS effects . . The number of coronavirus infections — and fatalities — has jumped in recent days. The pneumonia-causing illness that infects the respiratory tract is now responsible for 106 deaths in China as of Tuesday, up from 82 the day before, and more than 4,600 infections, up from 2,744 on Monday, the biggest rise in one day since the virus was first diagnosed in December, health officials in China said #coronavirus #virus #videos #wuhan #chinavirus #viruschina #deadlyvirus #warningvideos
2231604363768265446; 0; False; 1580247992; #UPDATE Lo último que se sabe del #Coronavirus :frowning_face_with_open_mouth::face_with_medical_mask::sneezing_face: :artist_palette:: @pictoline
2231604349641242315; 0; False; 1580247990; Bud Light Knight is our only hope #bud #budlight #knight #budlightknight #virus #sick #china #corona #coronavirus
2231604341974929526; 0; False; 1580247989; CoronaVirus mappa in tempo reale https://gisanddata.maps.arcgis.com/apps/opsdashboard/index.html#/bda7594740fd40299423467b48e9ecf6 #coronavirus
2231604310727057302; 9; False; 1580247986; Mana nih para offlaner jagat Land of Dawn :downwards_button::downwards_button::downwards_button::downwards_button::downwards_button::downwards_button::downwards_button::downwards_button::downwards_button::downwards_button::downwards_button::downwards_button: @maskmanxgaming @maskmanmlbb #lesleymobilelegends #choumobilelegends #justkidding #justjokes #mobilelegends #indopride #coronavirus #mobilelegendbangbang #moba #wildrift #kobebryant #lunarnewyear #leagueoflegends #aov #DOTA2 #mobilelegendssavage #gongxifacai #odettemobilelegends #mashamobilelegends #dyrrothmobilelegends #xborgmobilelegends #paidpromote #evosroar #meme #mobilelegendsmeme #marvelsuperwar #ripkobe
2231604270076359221; 0; False; 1580247981; The man needs some to chill #corona #coronavirus #memes #meme #spongebobmemes #spongebob
2231604160494488593; 1; False; 1580247968; Muitas pessoas têm assistido os noticiários e se perguntado: o que é o coronavírus? . A China está em estado de alerta por decorrência do coronavírus, uma doença misteriosa que fez 100 vítimas e infectou mais de 4,5 mil pessoas em 16 países. . O vírus pode afetar gravemente o sistema respiratório, causando pneumonia, sobretudo em indivíduos muito novos ou muito velhos, em portadores de doenças cardiopulmonares ou em pessoas com sistema imunológico debilitado. . Vale o alerta: se for viajar para fora do país, tome as devidas precauções conforme orienta o Ministério da Saúde: https://mla.bs/3cd41e66 . #animacentrohospitalar #coronavirus #corona #saude #hospital #hospitalanapolis #anapolis
2231604139429753097; 0; False; 1580247965; Wuhan woes... #CoronaVirus :microbe::petri_dish:
2231604118190254115; 1; False; 1580247963; . . . . . . #memespacman #memesrandom #memesvenezuela #virus #viral #youtuber #coronavirus #memeschistosos #memessad #memes:face_with_tears_of_joy: #darkhumor #boys #hongkong #china #repost #videosgraciosos #y #thebest #thuglife
2231603277794310243; 0; False; 1580247960; No need to panic. There is no case or suspected case of the coronavirus in Jamaica at this time. Health Minister, Dr. Christopher Tufton reiterated a short while ago in a press conference held at the Ministry of Health and Wellness Headquarters that there's NO suspected case of the Corona virus in Jamaica at this time. Out of an abundance of caution, tests are being carried out on an individual who came from China about two weeks ago and has been experiencing flu like symptoms; however, the patient shows no symptoms of the #CoronaVirus.
2231604068606277502; 1; False; 1580247957; #CoronaVirus Um novo vírus que ataca o sistema respiratório e se espalhou a partir da região de Wuhan, na China, preocupa o planeta. Ele pertence à família dos coronavírus, um grupo que reúne desde agentes infecciosos que provocam sintomas de resfriado até outros com manifestações mais graves, como os causadores da Sars (sigla em inglês para Síndrome Respiratória Aguda Grave) e da Mers (Síndrome Respiratória do Oriente Médio). O período de incubação é de 2 a 14 dias. Os sintomas podem envolver coriza, tosse, dor de garganta e febre. Esses vírus algumas vezes podem causar infecção das vias respiratórias, como pneumonia. A transmissão do vírus pode se dar: Por meio de tosse ou espirro; Contato pessoal próximo, como toque ou aperto de mão; Contato com objetos ou superfícies contaminadas, seguido então de contato com a boca, nariz ou olhos. . . Gostou de saber mais sobre esse vírus? Curte e comenta. :yellow_heart: . . #Farmacia #Corona #Farmaceutico #Microbiologia #virus #belohorizonte #news #saúde #curiosidades #brasil
2231604043834565366; 1; False; 1580247954; Are you freaking out about the coronavirus right now? Are you a woman over 40? 50? 60? Our immune systems may not be as strong as we get older and it is important that we take responsibility for our own health. Here is a natural way to boost your immune system to deal with viruses. This is an article my niece Brittany Darling who is a nutritionist and herbalist. She has some good advice. Check it out. #midlife #menopause #thrivingmenopause #coronavirus #health #women #naturalremedies https://www.wholefoodhealing.com.au/so/73M-giqHF?cid=f253200c-58d9-4e7e-8f73-604698b81847#/main
2231603687965768262; 0; False; 1580247934; Encuentra información y las respuesta a las preguntas frecuentes respecto a #Coronavirus en nuestro sitio web https://saludresponde.minsal.cl/coronavirus/ ⁠ Si tienes dudas consúltanos⁠ :telephone_receiver:@Salud_Responde 6003607777 ⁠ :mobile_phone:Twitter @Salud_Responde⁠ :laptop_computer:Facebook https://facebook.com/SaludRespondeC
2231602204388994464; 0; False; 1580247930; VIRUS CORONA . 𝗟𝗜𝗞𝗘 𝗗𝗔𝗡 𝗙𝗢𝗟𝗟𝗢𝗪 𝗞𝗔𝗠𝗜 𝗕𝗜𝗔𝗥 𝗧𝗜𝗗𝗔𝗞 𝗞𝗘𝗧𝗜𝗡𝗚𝗚𝗔𝗟𝗔𝗡 𝗕𝗘𝗥𝗕𝗔𝗚𝗔𝗜 𝗞𝗢𝗡𝗧𝗘𝗡 𝗦𝗘𝗥𝗨 𝗟𝗔𝗜𝗡𝗬𝗔 . #coronavirus #coronaviruschina #infoterkini #infosurabaya #infobandung #infoindonesia #beritaterkini #berita #beritaterbaru #beritaviral #beritaindonesia #beritaharian #beritanasional #beritahariini #beritapolisi #beritamedan #kecelakaan #lalulintas #infosurabaya #infomedan #infokalteng #chinavirus #viruscorona #kalimantanselatan #viruscoronachina #infokalimantan :wavy_dash::wavy_dash::wavy_dash::wavy_dash::wavy_dash::wavy_dash::wavy_dash::wavy_dash::wavy_dash::wavy_dash::wavy_dash::wavy_dash: :white_medium_star:Bantu, support Follow juga ya:backhand_index_pointing_down: @atfashione Like dan komen postinganya :smiling_face_with_smiling_eyes: Terimakasih.
2231603839303666926; 0; False; 1580247929; Just some tips to avoid the #coronavirus. Avoid packages from China.. just some common sense
2231603816225326120; 1; False; 1580247927; Maldita sea, al menos llegó bien...:face_with_tears_of_joy::face_with_tears_of_joy::face_with_medical_mask: . . . . . #meme #ElProfeta #virus #china #coronavirus #humor
2231602570735364759; 0; False; 1580247926; Just some tips to avoid the #coronavirus. Avoid packages from China.. just some common sense
2231602904752579543; 1; False; 1580247922; #jamaica daki depremde öğrencilerin panik anı!! Deprem anında ilk yapmamız gerekenleri öğrenmeliyiz! Video from @primerimpacto - : . . . . . Daha fazlası için @dijitalmedyahaber . #bilim #bilimsel #inovasyon #virus #coronavirus #teknoloji #digitalartwork #digitalart #sağlık #takip #takipet . #çin #wuhan . #deprem . #elazığ #earthquake #göçük #bina . #cuba #cübadeprem #cubaearthquake #jamaica .
2231603545585486921; 0; False; 1580247917; Mas q claro de donde vino el corona...// Seguirme para más: @_de.todo_un_poco_ . . . #humor #viejas #mayores #tv #corona #coronavirus #chinosecond #chinas #asqueroso #viejo #ciencia #atomo #gracioso #lais #laisla #humor #tele5
2231603619036378629; 0; False; 1580247911; Faith brothers: @schwarzer_als_baumwolle @schwarzesladekabel @der_schwarzfahrer_ Tags: #meme #schwarzerhumor #funny #blackhumor #humor #likes #911 #911memes #worldtradecenter #wtc #minecraft #christmas #endgame #avengersendgame #dominospizza #edgymemes #mac #apple #tech #new #technics #computer #pc #imac #imacpro #kobebryant #worldwar3 #ww3 #ww3memes #coronavirus
2231603446600367937; 1; False; 1580247910; Yarasa yiyen bir Çinli :grimacing_face: #coronavirüsü #coronavirus
2231603660558018894; 0; False; 1580247908; #coronavirus #nuclear_medicine_dept @hilidis
2231603543388032636; 3; False; 1580247904; “At Hong Kong customs. People from Guangzhou and Shenzhen trying to flee to HK to escape the coronavirus.”⁣ ⁣ 香港關口，这样下去要出事的 昨天廣州深圳人開始逃亡香港⁣ ⁣ From 曾錚 Jennifer Zeng (jenniferatntd) on Twitter.⁣ ⁣ #news #breakingnews⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣ #worldnews⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣ #coronavirus #wuhanvirus #wuhancoronavirusoutbreak #WuhanCoronavirus⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣ #coronavirusoutbreak #corona #ncov2019 #ncov⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣ #武漢肺炎 #武汉疫情⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣ #China #Wuhan⁣⁣⁣⁣⁣ #StandWithWuhan⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣ #LunarNewYear #NewYear #SpringFestival⁣⁣ ⁣
2231603580497022242; 0; False; 1580247899; REAL HERO This man deserves our endless respect. Dr. Liang Wudong, who was treating patients of corona virus in Wuhan, China, gets infected while treating patients and becomes the first doctor to die from the new Coronavirus. :crying_face: A reminder that while everyone else is trying to avoid it, frontline medical staff are risking their lives to cure and save others. This is undoubtedly the beauty of this profession. RIP, Doc. Reposting. From: FunnyDoctors #doctor #doctors #hero #realhero #doctorofmedicine #medical #medicalstaff #coronavirus #virus #medicalschool #medicalstudent #medlife #medstudent #premed #healthcare #appreciation #md #physician #doktor #treat #cure #respect #rip #medisina
2231603559644011567; 0; False; 1580247896; Save us #budlightknight @budlight #DBFollowTrain #drinkingbros #meme #memes #BRCC #gruntstyle #DBfollow #goodnight #gruntstyle #truestory #beautiful #facts #dbfollow #hunting #shooting #pewpew #pewpewtime #camping #outside #nature #guns #fail #fun #funny #bud #budlight #budknight #corona #coronavirus
2231603533562541430; 1; False; 1580247893; nyc++coronavirus++devil*:skull_and_crossbones:
2231603440040137403; 0; False; 1580247890; Tyler1 Faith brothers: @schwarzer_als_baumwolle @schwarzesladekabel @der_schwarzfahrer_ Tags: #meme #schwarzerhumor #funny #blackhumor #humor #likes #911 #911memes #worldtradecenter #wtc #minecraft #christmas #endgame #avengersendgame #dominospizza #edgymemes #mac #apple #tech #new #technics #computer #pc #imac #imacpro #kobebryant #worldwar3 #ww3 #ww3memes #coronavirus
2231603492526846889; 0; False; 1580247888; Someone just turned on the real life mode in Plague Inc - - - - - - - - - - - - - - - - - - - - - - - - - - #funnymemes #bestmemes #epicmemes #funnymemes #funniestmemes #greatmemes #dankmemes #funnyvideos #edgymeme #memecentral #memesforlife #memesdaily #dailymemes #memes #edgymeme #offensivememesmatter #memesquad #memes2good #memes4days #memeforlife #plague #disease #corona #coronavirus #edgiestmemes #virus #viralpost #xmen #wolverine #comics #news #currentnews
2231603443393561154; 0; False; 1580247882; INFÓRMATE | Te invitamos a conocer más sobre el #Coronavirus y a mantenerte informado por los canales oficiales. No extiendas rumores, aún no existen casos confirmados en Ecuador. #QuitoSaludableOtraVez
2231603440275295565; 0; False; 1580247882; El gobierno Chino informó que el número de fallecidos por el coronavirus aumentó a al menos 100 personas . Mientras que los infectados se habrían multiplicado casi llegando a 4.500 . Además se confirmó un nuevo caso en Alemania y cuatro posibles casos sospechosos en Perú, que se suman a los ya confirmados en Francia, Australia, Estados Unidos y otros países de Asía . Debido a la gran tensión que se ha creado en base a este virus, Farmacia Juku se une a la campaña de Autocuidado . Es por esto que te informamos de las formas de contagio y como prevenirlo . Formas de contagio: ●De manera respiratoria ●Contacto con personas infectadas . Para prevenir esto recomendamos el uso de mascarillas en lugares públicos y en especial el uso de Alcohol Gel luego de contacto con objetos de uso masivo, como los pasamanos o los objetos del transporte publico . Déjanos saber en los comentarios que opinas acerca del #Coronavirus y si tienes alguna otra recomendación que puedas darnos para el Autocuidado . . . #Arica #Chile #BoulevardCityCenter #Farmaciasjuku
2231603441414572437; 3; False; 1580247882; #coronavirus #coronavarios #luisaw
2231603370236333734; 0; False; 1580247874; Çində gərkin vəziyyət davam edir 20 nəfərdə artiq düniyasin dəyişdi #coronavirus #aztagram #baku #cin #çin #aztagram #baku #azerbaycan:Azerbaijan: #koronavirus #coronavirus
2231603360975729525; 0; False; 1580247872; @who :round_pushpin::round_pushpin::round_pushpin::round_pushpin::round_pushpin: 1339 ~ Take care www.gfn.or.kr 12:10- 2pm KST :ON!_arrow::ON!_arrow::ON!_arrow: Live your best life. 내일 봐용. #광주영어방송 :man_tipping_hand_medium_skin_tone: JD와 함께하는 The Afternoon Show #The_Afternoon_Show_with_JD #GFN 98.7fm in Gwangju 93.7 in Yeosu www.gfn.or.kr :person_bowing_medium_skin_tone::person_bowing_medium_skin_tone::person_bowing_medium_skin_tone::person_bowing_medium_skin_tone::person_bowing_medium_skin_tone: #safety #라디오 #방송 #radio #music #coronavirus #gwangju #광주 #코로나바이러스
2231602825675392460; 0; False; 1580247868; Shood up Faith brothers: @schwarzer_als_baumwolle @schwarzesladekabel @der_schwarzfahrer_ Tags: #meme #schwarzerhumor #funny #blackhumor #humor #likes #911 #911memes #worldtradecenter #wtc #minecraft #christmas #endgame #avengersendgame #dominospizza #edgymemes #mac #apple #tech #new #technics #computer #pc #imac #imacpro #kobebryant #worldwar3 #ww3 #ww3memes #coronavirus
2231603295478896066; 0; False; 1580247865; Estamos vendo várias notícias sobre um vírus que está afetando a China, esse virus é conhecido como coronavírus. Os coronavírus correspondem a uma família de vírus pertencentes à familia Coronaviridae que são responsáveis por infecções respiratórias que podem ser leves ou bastante graves, dependendo do coronavírus responsável pela infecção. Até hoje eram conhechidos 6 tipos de coronavírus, agora esse que surgiu na China é o sétimo vírus conhecido. Os coronavírus podem ser transmitidos de animais para pessoas, o que é mais comum, mas também podem ser transmitidos de pessoas para pessoas como é o caso do 2019-nCoV. Os sintomas são semelhantes aos da gripe, no entando nos casos dos vírus transmitidos de animais para pessoas, podem surgir sintoma gastrointestinais, e formas mais graves. O coronavírus que apareceu na China, parece passar de animais para pessoas, por isso é um vírus um pouco mais grave, e pode precisar de internação em hospital. Não existe um tratamento específico para o coronavírus, não existe um antiviral capaz de eliminar o vírus, e nem uma vacina capaz de prevenir o vírus, então o importante é fortalecer nossos sistema imunológico, para que nosso corpo consiga eliminar esse vírus. Devemos nos alimentar corretamente, com alimentos saudáveis, beber muita água, evitar o contato com animais doentes, higienizar sempre as mãos, evitar locais fechados, com aglomerados de pessoas. A homeopatia como trabalha muito com sistema imunológico, e também pode ser usada para previnir a infeção pelo vírus, sendo muito indicada para pessoas que irão para as regiões de risco. Até o momento existem casos confirmando na Àsia e nos Estados Unidos. Nenhum caso no Brasil. O vírus deve estar chegando na América do Sul, provavelmente entrando pela Venezuela, onde eles não estão tendo o menor controle sobre a entrada de chineses. Se alimentem bem, cuidem do sistema imunológico de vocês, tomem precauções de higine em locais públicos, se apresentarem tosse, desconforto respiratório dentro de um período de 14 dias dias após uma viagem para a China ou alguma área ee risco, procurem um médico e informem sobre a viagem. #coronavirus#saudepublica #medicina
2231603219888625204; 4; False; 1580247856; #UPDATE Lo último que se sabe del #Coronavirus :frowning_face_with_open_mouth::face_with_medical_mask::sneezing_face: :artist_palette:: @pictoline
2231603164725701047; 0; False; 1580247849; Quick car meet at the walk in clinic :face_with_tears_of_joy: I guess both our trucks are “sick” :double_exclamation_mark::nauseated_face::face_with_tears_of_joy::face_with_tears_of_joy::face_with_tears_of_joy: •••••••••••••••••••••••••••••••••••••••• :exclamation_mark:Follow:exclamation_mark: • :backhand_index_pointing_right: @GreystarJeep :backhand_index_pointing_right: @GreystarJeep :backhand_index_pointing_right: @GreystarJeep • ••••••••••••••••••••••••••••••••••••••• #jeep #jeepwrangler #jeepher #offroading #jku #jk #jl #gladiator #ruggedridge #roughcountry #mopar #fox #foxshocks #dv8 #offroad #overland #lifted #liftedtruck #liftedjeep #jeeps #Chrysler #Brabus #mercedes #4x4 #sicktruck #Ram #ram1500 #Sick #gclass #coronavirus ••••••••••••••••••••••••••••••••••••••••
2231603110584001981; 0; False; 1580247843; I'm sorry what was that last rule.... WTAF............... :face_with_tears_of_joy: :face_with_tears_of_joy: :face_with_tears_of_joy: :face_with_tears_of_joy: :face_with_tears_of_joy: Honestly..... Who does use protection pmsl :face_with_tears_of_joy: :face_with_tears_of_joy: :face_with_tears_of_joy: #worldhealthadvice #coronavirus #useprotection #wildanimals #rules #keepsafe
2231603086257250886; 0; False; 1580247840; @who :round_pushpin::round_pushpin::round_pushpin::round_pushpin::round_pushpin: 1339 ~ Take care www.gfn.or.kr 12:10- 2pm KST :ON!_arrow::ON!_arrow::ON!_arrow: Live your best life. 내일 봐용. #광주영어방송 :man_tipping_hand_medium_skin_tone: JD와 함께하는 The Afternoon Show #The_Afternoon_Show_with_JD #GFN 98.7fm in Gwangju 93.7 in Yeosu www.gfn.or.kr :person_bowing_medium_skin_tone::person_bowing_medium_skin_tone::person_bowing_medium_skin_tone::person_bowing_medium_skin_tone::person_bowing_medium_skin_tone: #safety #라디오 #방송 #radio #music #coronavirus #gwangju #광주 #코로나바이러스
2231603083547560999; 1; False; 1580247839; #wuhan #coronavirus #wuhancoronavirus
2231594889588622477; 3; False; 1580247830; I asked about Taiwan and the World Health Organization. I got an answer about China. - • • • #coronavirus #worldhealthorganization #cdnpoli #taiwan #china #houseofcommons #parliament
2231602964227973329; 0; False; 1580247825; #CORONAVIRUS ... Ya tienen cura para el corona virus #tingis #marocco:Morocco: #happy #beautiful #españa:Spain: #usa:United_States: #canada:Canada: #francia:France: #london:United_Kingdom: #love #coronavirus
2231599042455381831; 3; False; 1580247822; La desinformación en las redes sociales se acrecienta en tiempos de crisis, cuando se trata de temas coyunturales, como el #coronavirus, y los flujos de información son mayores. Guiseppe Marzano, decano de la facultad de posgrados de la Universidad de Las Américas (UDLA), comparte con EXPRESO sus tips para mantenernos alejados de las #fakenews
2231602872089115333; 0; False; 1580247814; O vírus chegou ao Brasil, possível caso de coronavirus no estado de MG. Sintomas do vírus são parecidos com da gripe. . . . . . .https://veja.abril.com.br/saude/ministerio-saude-investigacao-coronavirus/ . . . #noticias#virus#coronavirus#japão#Minasgerais#Brasil#veja#g1globo#noticiasbrasil#gripe#epidemia#saude#saudepublica#likeforlike#mortes#2020#doencas#like4like#mundo#OMS#ONU
2231602846370105249; 0; False; 1580247811; WOOKS are immune to the Coronavirus :face_screaming_in_fear: #wooks #coronavirus #wookflu
2231602796147234048; 0; False; 1580247805; #coronavirus
2231601918800013064; 1; False; 1580247802; There is a very valid point here, regardless of how you think/feel to the contrary. EDIT: this is in no way meant to be disrespectful to the citizens of China or their culture. This is an opinion of the current political state there of. #coronavirus #wuhan #2020isthenew1984 #provemewrong #sorrynotsorry #getthestrap
2231602738540914057; 0; False; 1580247798; @who :round_pushpin::round_pushpin::round_pushpin::round_pushpin::round_pushpin: 1339 ~ Take care www.gfn.or.kr 12:10- 2pm KST :ON!_arrow::ON!_arrow::ON!_arrow: Live your best life. 내일 봐용. #광주영어방송 :man_tipping_hand_medium_skin_tone: JD와 함께하는 The Afternoon Show #The_Afternoon_Show_with_JD #GFN 98.7fm in Gwangju 93.7 in Yeosu www.gfn.or.kr :person_bowing_medium_skin_tone::person_bowing_medium_skin_tone::person_bowing_medium_skin_tone::person_bowing_medium_skin_tone::person_bowing_medium_skin_tone: #safety #라디오 #방송 #radio #music #coronavirus #gwangju #광주 #코로나바이러스
2231602464234460448; 2; False; 1580247795; I love you all ~Gray . . . . . #dankmemes #earrapememes #memes #funnymemes #offensive #cringeymeme #education #freeniggatwerk #minecraft #stolenmemes #deepfriedmemes #oof #minecraftmemes #edgymemesdaily #worldwar3 #edgymemes #fortnite #meme #freeniggatwerk #simp #spicymemes #earrapememe #ww3 #deepfriedmeme #gamersriseup #earrape #coronavirus#funny #fashion #tiktok
2231602676012330785; 0; False; 1580247791; #repost @surrealhk ・・・ The HK govt refuses to close completely the border with mainland China to contain the coronavirus, so you better wear a mask, wash your hands and pray! 一日香港政府唔全面封關邊境, 大家只可以戴好口罩洗手同求佛保佑啦! #coronavirus #wuhan #WARS #mask #staysafe #bigbuddha #photoshop #art #photomanipulation #creativecloud_clarity #standwithhongkong #武漢肺炎
2231602676701653579; 0; False; 1580247791; 我家魔笛，一到晚上就要进卧室，一到早上就吵着要出去。:person_shrugging_light_skin_tone: #金毛 #goldenretriever #coronavirus
2231602669477977837; 0; False; 1580247790; :police_car_light: #Coronavirus | Todo viajero procedente de China que ingrese a territorio paraguayo deberá: Utilizar tapaboca por un lapso de 14 días Evitar desplazamientos y limitar contacto con personas En caso de presentar fiebre, tos, dificultad respiratoria contactar al (0983) 87 92 75 #650AM #Paraguay #mundo #china #coronavirus
2231602648079786304; 0; False; 1580247787; Artwork:sparkles: By Me:fire: #corona#virus#art#artwork#anti#antivirus#coronavirus#hollyshit#designer#usanews#chinanews#madeinchina#artwork
2231602589038853850; 0; False; 1580247780; With the recent case of the coronavirus confirmed in Toronto, please take the proper precautions to prevent the spread of this outbreak. These infographics from the @who provide tips on how to mitigate the spread of the virus. . . . #richmondhill #onpoli #carmineperrelli #ontario #politics #richmondhillontario #yorkregion #community #cityofrichmondhill #coronavirus #who
2231602555360488992; 1; False; 1580247776; For visitors to Japan, seeing people out and about in surgical masks can be a bit alarming. Here are some reasons why people wear face masks, which became more common after the SARS virus health scare in 2003: . 1. They’re sick and wear masks to be considerate of others to help contain the spread of germs. 2. They’re afraid of getting sick from others. 3. They have allergies during pollen season. 4. They worry about facial recognition technology and want to hide their face/identity. 5. They’re socially awkward and hiding their faces in public allows them to draw away from interacting with society. 6. They want to keep their face warm during winter. 7. They didn’t put on makeup or didn’t shave their beards and want to hide it. 8. They’re making a fashion statement with the variety of cutesy face mask options available. But do these masks offer effective protection against the coronavirus? Viruses, including the coronavirus, are so tiny that they can easily pass through such barriers. Several studies even have shown that surgical masks fail to prevent transmission of the much larger mycobacterium tuberculosis, which causes TB. Wearing surgical masks outdoors, where virus-laden particles easily disperse, has even less value. . #coronavirus #flu #masks #facemask #facemasks #virus #日本 #japan #japan:Japan: #:Japan: #japanese #japon #nihon #nippon #japantravel #travelasia #japanstyle #instagramjapan #japan_of_insta #thisisjapan #visitjapan #visitjapanjp #lovejapan #ilovejapan #sick #illness #sickness #wuhan #wuhanvirus
2231602548104434790; 1; False; 1580247776; None
2231599368358616148; 0; False; 1580247774; Best to take all precautions necessary! #whoisshe #alwayshere #checkuptime #fluseason #coronavirus #
2231602514246389690; 1; False; 1580247772; #sickhumor #humor #corona #coronavirus #icouldnthelpmyself :face_with_hand_over_mouth::face_with_hand_over_mouth::face_with_hand_over_mouth:
2231602519262779267; 0; False; 1580247772; :warning:"El Gobierno decretó el alerta por el coronavirus y preocupación por el sarampión y el dengue" :dna: A través de Cancillería tomamos contacto con los ciudadanos argentinos que están viviendo o de paso por la zona de cuarentena de la Argentina y están todos bien y sin síntomas”, aseguró Ginés González García en reunión con Alberto Fernández Más info en www.eltribuno.com/jujuy . . . . . . #coronavirus #alerta #casadegobierno #eltribunodejujuy #jujuy:cactus:
2231602497562413657; 0; False; 1580247770; Langkah pencegahan penularan Novel #coronavirus (#2019nCoV) bagi barangan dari China. #WuhanCoronovirus https://t.co/NEd7qJLzrn
2231602464610909570; 0; False; 1580247766; @who :round_pushpin::round_pushpin::round_pushpin::round_pushpin::round_pushpin: 1339 ~ Take care www.gfn.or.kr 12:10- 2pm KST :ON!_arrow::ON!_arrow::ON!_arrow: Live your best life. 내일 봐용. #광주영어방송 :man_tipping_hand_medium_skin_tone: JD와 함께하는 The Afternoon Show #The_Afternoon_Show_with_JD #GFN 98.7fm in Gwangju 93.7 in Yeosu www.gfn.or.kr :person_bowing_medium_skin_tone::person_bowing_medium_skin_tone::person_bowing_medium_skin_tone::person_bowing_medium_skin_tone::person_bowing_medium_skin_tone: #safety #라디오 #방송 #radio #music #coronavirus #gwangju #광주 #코로나바이러스
2231602451130684348; 0; False; 1580247764; Update 28th Jan 2020 #china #coronavirus #corona #wuhan #hubei
2231601810081190987; 4; False; 1580247763; Tag a Chinese friend:down_arrow::rolling_on_the_floor_laughing: Follow me @ohhhpakii
2231602398082660215; 0; False; 1580247758; :microbe: :face_with_medical_mask::yawning_face::grinning_face_with_sweat: . . . . . #memesespañol #meme #risasaseguradas #funtimes #funnymeme #folowme #instafun #funnyvideo #humorespañol #humor #bestvideosdaily #instagramers #instahumor #imagenesgraciosas #risasmil #bestmemes #topmemes #memesdaily #memes:face_with_tears_of_joy: #bestsmile #humorquotes #sinexcusas #memepage #memelandia #imageneschistosas #bestvideooftheday #virus #china #coronavirus
2231602376245369923; 0; False; 1580247755; Bizde sorgusuz sualsiz hepsini içeri alıyoruz . . . #wuhan #wuhancoronavirus #pekin #beijing #pekin #çin #hospital #sleep #china #hubei #virus #enfected #coronavirus #coronavirüsü
2231602285465465113; 1; False; 1580247744; #assuntodomomento - por @ednnamaria.pontes - Uma inteligência artificial criada pelos canadenses da BlueDot conseguiu prever o alcance da epidemia que está aterrorizando a Ásia e já chegou à Europa: o coronavírus. Antes disso tudo começar, a BlueDot já sabia o que estava por vir. A empresa usa inteligência artificial para prever a chegada de doenças. Ela foi capaz de prever a chegada do vírus Zika à Flórida, nos EUA. . .:pill: Utilizando uma IA depois que o coronavírus surgiu em Wuhan, ela foi capaz de prever por onde o vírus passaria. Bangkok, Seul, Taipei e Tóquio estão entre as cidades previstas, os casos já passam de 2886 com 81 mortes. . .#pandemia #coronavirus #epidemia #doenças #morte #vírus #saleteemsociedade
2231602212247788658; 2; False; 1580247736; The 2020 plague tier list. #coronavirus #wuhan #china #america #fascist #socialism #libertarian #liberal #conservative
2231602196688375909; 4; False; 1580247734; Shit went downhill ~Gray . . . . . #dankmemes #earrapememes #memes #funnymemes #offensive #cringeymeme #education #freeniggatwerk #minecraft #stolenmemes #deepfriedmemes #oof #minecraftmemes #edgymemesdaily #worldwar3 #edgymemes #fortnite #meme #freeniggatwerk #simp #spicymemes #earrapememe #ww3 #deepfriedmeme #gamersriseup #earrape #coronavirus#funny #fashion #tiktok
2231601992183442952; 4; False; 1580247727; Este viernes sacamos el Show de TRÍGIDO, VAMOS A REIRNOS DE TODA LA MIERDA que nos atormenta en la prensa..:face_savoring_food::rolling_on_the_floor_laughing: Este viernes.. CORONA VIRUS!! :face_vomiting:... PD. @alejobatyi . . . #reir #pensamientopositivo #rietechile #trigido #quetrigido #television #informativo #hoy #chilegram #informate #actualidad #humoristas #instachile #buenosdias #ayuwoki #producer #weones #farandula #youtube #youtuber #santiagodechile #coronavirus #standup #productor #informacion #vivir #sieschilenoesbueno #chile
2231602080271665795; 0; False; 1580247720; #2020 #worstyear #wellplayed #elonmusk #badidea #newyear #badyear #michaelreeves #michaelreevesmemes #war #virus #kobe #coronavirusmemes #coronavirus #2020memes #wordtyearmemes #meme #memes #like #comment #follow #share
2231602052304072226; 0; False; 1580247716; #coronavirus #corona #epedemie #schweiz #meme
2231602028555858524; 1; False; 1580247714; None
2231602008498370412; 0; False; 1580247711; Send in The GÍÂŃT ~Gray . . . . . #dankmemes #earrapememes #memes #funnymemes #offensive #cringeymeme #education #freeniggatwerk #minecraft #stolenmemes #deepfriedmemes #oof #minecraftmemes #edgymemesdaily #worldwar3 #edgymemes #fortnite #meme #freeniggatwerk #simp #spicymemes #earrapememe #ww3 #deepfriedmeme #gamersriseup #earrape #coronavirus#funny #fashion #tiktok
2231601601081276138; 4; False; 1580247701; Mods del getea . . . . . . . . . . . . . .. . . . . . . . . . . . . . . . . . . #DANKMEME #shitpost #meme #momo #momoz #momos #jaidefinichon #goth #anime #shitposting #otaku #laweachistosa #coronavirus
2231601530616104221; 0; False; 1580247699; Spam W’s in the comments :smiling_face_with_horns: ! ! ! ! ! ! #relatablememes #offensive #hilarious #hilariousmemes #offensivememes #lmao #spicymemes #sus #gaymemes #funnymemes #funny #oc #explorepage #explore #viral #original #dankmemes #hood #darkhumor #darkmemes #coronavirus #corona
2231601880052800559; 9; False; 1580247696; Zon unoz babozos cabroz ~ RG Migraña - Síguenos para mas contenido :green_heart: - - - - #memesdaily #elgoth #meme #memesgraciosos #memesenespañol #memesespañol #memes:face_with_tears_of_joy: #memes #goth #siguemeytesigo #gothjaidefinichon #chileanmemes #jaidefinichongoth #china #coronavirus #gatitos #kakarot #dylantero #instagram #instamemes #simpsonsmemes
2231601864255517138; 1; False; 1580247694; . #shitpost #shitposting #memes #random #buenardo #dank #memechile #chileposting #dylanteromeme #dankmemes #shitpostespañol #dylantero #chileno #dankchileanmeme #shitpost #posting #dankchile #dylanteromeme #memes #memechile #coronavirus #dankmemesargentina #dankargentina
2231601801208519750; 1; False; 1580247687; :warning:O Ministério da Saúde investiga um caso suspeito de coronavírus em Minas Gerais. Nesta terça-feira (28), o ministro da Saúde, Luiz Henrique Mandetta, informou que a pasta investiga uma paciente que apresentou sintomas "compatíveis" com os da doença. . . :right_arrow:Trata-se de uma estudante de 22 anos que viajou para Wuhan, na China. Ela chegou em território brasileiro no dia 24 de janeiro. Segundo o ministro, a estudante está num hospital de alta organização na área de infectologia. Todas as 14 pessoas que tiveram contato com a estudante também estão sendo "monitoradas". _________________________________________________________________ :busts_in_silhouette: Marque um amigo(a). :right_arrow:Siga @resumedii para mais conteúdos.
2231601074947318831; 0; False; 1580247685; Salute to News anchors/news producers who are wordsmiths, The Corona Virus and The Karate Kid musical make the Top 3 this week. This is Tony's Top 3! #newsanchors #newsproducers #coronavirus #karatekid #musical #cobrakai #like4like #follow #instagood #trending #follow #like #actor #improv #funny #comedy #trending #albuquerque #abq #newmexico #santafe #tonytshow #radio #mix1051 #mymix1051
2231601768700491811; 0; False; 1580247683; фразы, которые помогут с китайским коронавирусом :China: Подпишись чтобы быть в курсе последних новостей. #coronavirus #koronavirus #virus #china #news #китай #коронавирус #пневмония #смерть #ухань #wohan
2231601743167060268; 0; False; 1580247680; Os coronavírus humanos causam infecções respiratórias brandas a moderadas, de curta duração.Alguns coronavírus podem causar doenças graves com impacto importante em termos de saúde pública, como a Síndrome Respiratória Aguda Grave (SARS), identificada em 2002 e a Síndrome Respiratória do Oriente Médio (MERS), identificada em 2012. Os sintomas mais comuns são tosse, dor de garganta, coriza e febre. Em pessoas com doenças cardiopulmonares, com sistema imunológico comprometido ou bebês e idosos existe a possibilidade de o vírus causar infecções das vias aéreas inferiores, como pneumonia. Qual o modo de transmissão? As investigações sobre transmissão do novo coronavírus ainda estão em andamento, mas a disseminação de pessoa para pessoa, ou seja, a contaminação por contato, está ocorrendo. É importante observar que a disseminação de pessoa para pessoa pode ocorrer de forma continuada. Ainda não está claro com que facilidade o novo coronavírus se espalha de pessoa para pessoa. Apesar disso, a transmissão dos coronavírus costuma ocorrer pelo ar ou por contato pessoal com secreções contaminadas, como principal forma de transmissão dos coronavírus se dá por contato próximo de pessoa a pessoa. Existe tratamento? Não existe um tratamento específico. É recomendado procurar um médico para avaliar os sintomas e acompanhar a evolução do quadro. Como prevenir? Não existe vacina contra os coronavírus. Para reduzir a chance de contaminação, sugere-se evitar o contato com pessoas doentes, lavar com regularidade as mãos por pelo menos 20 segundos, utilizando água e sabão, e evitar tocar nos olhos, no nariz e na boca. Fonte: www.anvisa.gov.br #coronavirus #epidemiologia #saudepublica #farmacia #virologia
2231601626918195321; 3; False; 1580247666; #coronavirus
2231601564431554513; 0; False; 1580247658; Información de interés#colfarmbb#salud#prevencion#coronavirus#farmacia#farmaceutico#bahiablanca#enfermedadestransmisibles
2231601542015207238; 5; False; 1580247656; :warning:WARNING GRAPHIC IMAGES:warning: Please share this URGENT post about the coronavirus epidemic with your followers as the origin of the virus has been traced to the zone of the Wuhan market where live wild animals like snakes, rats, bats and monkeys were traded before China instituted a temporary ban yesterday. But a temporary ban is NOT enough, WE MUST use our social media platforms to spread awareness and BAN WILD ANIMAL TRADING WORLDWIDE as this is EXACTLY what caused the SARS virus that killed nearly 800 people in 2003! SARS was 17 years ago and yet these markets are doing the exact same thing, selling live wild animals in unhygienic conditions that create diseases with devastating consequences for the entire human race! This new virus, which has no vaccine, has killed 82 people with 2,887 confirmed cases in 15 countries, numbers which have increased 50% SINCE YESTERDAY and 60 million more people are on lockdown to prevent further spreading. To stay updated in real-time our US followers can now text us at 323-310-1679 and also follow @bringing.awareness on Instagram too. Please pray for the world and share this URGENT post with your followers and tag people, celebrities, influencers and news media that need to see this and let’s work together to PERMANENTLY ban the trading of wild animals that create these deadly viruses! #coronavirus #endanimalcruelty #coronavirusoutbreak #karmagawa
2231601502623757033; 0; False; 1580247651; Importante información sobre el Coronavirus, hasta ahora reportados casos en China, uno en EE.UU., uno en Japón y uno en Corea del Sur y en Tailandia 2 casos! México en espera de confirmación! ~ ~ ~ #Repost @culturizando ~ ¿Has leído sobre el nuevo virus originado en China? Es importante que te mantengas bien informado y que también compartas datos de manera responsable. ¡Te mostramos TODO lo que deberías saber acerca del #Coronavirus de Wuhan! ~ #Informacion #InformacioImportante #Salud #OMS #Prevencion #InformacionEsPoder #Virus #Epidemias #Odontologia #Dentistas #OdontoPorAmor
2231601431497245508; 0; False; 1580247642; Johns hopkins hastanesi corona virüs vakalarını takip ediyor. #coronavirus
2231601428803561620; 0; False; 1580247642; The internet don't stop :loudly_crying_face::loudly_crying_face::loudly_crying_face: . . . . . #lymedisease #instagood #lime #coronavirusmemes #beer #photooftheday #instamood #iphonesia #tweegram #picoftheday #igers #fresh #beautiful #instadaily #summer #instagramhub #iphoneonly #follow #morethanmemes #bestoftheday #happy #memes #tagblender #corona #alcohol #nofilter #coronavirus #followme #funnymemes #morethanmemez
2231587316370157923; 0; False; 1580246024; . :backhand_index_pointing_right:Ya son 106 los muertos por el coronavirus. @ginesggarcia explicó el protocolo de seguridad que se va a aplicar en los aeropuertos por el @msalnacion . Ante el primer síntoma febril que posea una persona que viene del continente oriental o turista que haya viajado a Oriente, se tiene que practicar rápidamente el sistema de seguridad para no contagiar a otras personas en el caso que contenga la enfermedad:backhand_index_pointing_left: . . #coronavirus #china #argentina #Salud #saludpublica #oms
2231563174896162150; 0; False; 1580243086; Calvo #memes #memesespañol #memesdiarios #momazos #xd #viral #risas #risasaseguradas #risa #brutal #brutalmemes #coronavirus
2231395217439833354; 6; False; 1580223060; OMNIPLUS (PRODUCTO ESTRELLA DE OMNILIFE) - Ayuda a mejorar la respuesta inmune y corrigiendo alteraciones como el #asma, las #alergias, la #rinitis, la #bronquitis, el #resfriado común, #sinusitis, entre otros. - Sus nutrientes ayudan a regular la presión sanguínea y permiten un correcto funcionamiento de las vías respiratorias. - Debido a su aporte en vitaminas micelizadas ayuda a combatir rápidamente alergias y #anemia. - Facilita la recuperación de personas que padecen de #desnutrición. - Retarda el envejecimiento al ser un regenerador celular. - Tiene un efecto anti inflamatorio y antirreumático, por lo que es un excelente alivio para la #artritis y la #artrosis. - Al tener vitamina C interviene en la síntesis del #colageno, el cual ayuda en la reparación de tejidos, paredes de venas y arterias, así como cuidado de la piel, cabello y uñas. Ideal para: - Toda la familia :mobile_phone_with_arrow: WhatsApp en la Biografía . #omnilife #gym #gimnasio #omniplus #gripe #coronavirus #virus #defensas
2231389449357647749; 0; False; 1580222372; Empezamos bien #memes #memesespañol #memesdiarios #momazos #xd #viral #risas #risasaseguradas #risa #brutal #brutalmemes #coronavirus
2231007666493524475; 0; False; 1580176860; Same . #coronavirus #coronavirusmemes
2231601403285291256; 0; False; 1580247639; #wuhan #coronavirus #governmentcoverup
2231601141995814739; 0; False; 1580247608; Miami- com seu grande número de viajantes internacionais – é uma das 20 cidades dos Estados Unidos escolhida para ter uma estação de quarentena do coronavírus no Aeroporto Internacional da cidade. O surto do misterioso coronavírus está se espalhando rapidamente e nesta terça-feira, 28, as autoridades de saúde pública dos Centros de Controle e Prevenção de Doenças adicionaram Miami à crescente lista de cidades que possuem estações de quarentena em seus aeroportos para conter o surto. Agora, além dos cinco iniciais que já estavam fazendo exames nos passageiros, outros 20 aeroportos e também entradas por vias terrestres irão fazer. Saiba quais e mais informações sobre a epidemia pelo vírus na matéria completa no site gazetanews.com Acesse link na bio ou pelos stories. #coronavirus #china #aeroportomiami #mia #epidemiaglobal #viruschina #saude #cuidados #quarentena #testevirus #passageirosflorida
2231601114028338904; 0; False; 1580247605; Stumbled upon some of Hiroto Ikeuchi designs and combined them with some click bait. (The normal flu kills 291000 to 646000 people each year.) #ikeuchihiroto #coronavirus #draw #drawing #sketch #sketching #artpractise #2d #art #freehand #illustration #illustrate #artwork #paint #painting #portrait #timelapse #procreate #digitalart #ipadpro #madebyryell
2231600332008712038; 0; False; 1580247594; Про коронавирус лучше этой истории уже, может, не будет: это наш с вами соотечественник застрял в Китае. Включите звук, послушайте родную речь с далёкой чужбины о том, как тяжко живётся туристу в это непростое время карантинов #китай #ухань #коронавирус #вирус #coronavirus
2231601000943107756; 2; False; 1580247591; Protect yourselves!!! #coronavirus
2231600845208522913; 0; False; 1580247582; Wtf . . . . . . . . . . #dank #dankmemes #dankmemesdaily #funnymemes #funny #funnyvideos #deepfriedmemes #coronavirus #stolenmemes
2231600900984009482; 0; False; 1580247579; Who else has a cold/ allergies. #allergies #sanantonio #bronks #nyc #london #queen #elizabethwarren #ranch #coronavirus #sick #helpme
2231600880548818292; 0; False; 1580247577; Cryptocurrency and blockchain firms have united their efforts to donate in support of the victims of the coronavirus in Wuhan, China. #china #coronavirus #explorepage #bitcoin #crypto #invest
2231600854746343980; 143; False; 1580247574; Daha Fazla Güncel Bilgi İçin Bizi Takip Etmeyi Unutmayın @ilgincbilgilerkitabi
2231600836037918186; 0; False; 1580247571; CURVA DE RENDIMIENTO INVERTIDO. Rene Pineda Un fenómeno del mercado de bonos vigilado de cerca ha por primera vez ha sucedido este año, pero la mayoria de inversores le han prestado poca atencion. Los rendimientos de la nota del #Tesoro a 10 años cayeron brevemente por debajo de los de 3 meses, el dia martes bajaron por primera vez desde octubre, por las preocupaciones sobre el impacto económico del #coronavirus. Históricamente, una curva de rendimiento invertida ha sido un indicador de una #recesión inminente, ya que tiende a reflejar las preocupaciones sobre el crecimiento futuro entre los inversores en #bonos.
2231600805613762899; 0; False; 1580247568; El #coronavirus es uno de los mas recientes virus que tiene en vigilia a la población debido a su propagación y contagio. Según reportes de la Organización Mundial de la Salud, este virus tiene su origen en animales, y los brotes comenzaron a darse a conocer desde Diciembre 2019, en la ciudad de Wuhan, China. #alertacoronavirus #Salud #OMS #Prevención
2231600801745573080; 0; False; 1580247567; :flushed_face::man_shrugging_light_skin_tone::face_with_hand_over_mouth::China:к нам гость не жданный :sneezing_face: Posted @withregram • @vancouvercaption The B.C. Centre for Disease Control said one patient appears to be infected with the newly discovered coronavirus and is currently in isolation at home.⁣ ⁣ The individual is a 40-year-old male who travels to China regularly and was in Wuhan city on his most recent trip, officials said. He lives in the Vancouver Coastal Health region.⁣ ⁣ The man contacted a health-care provider on Jan. 26 to let them known he had travelled to Wuhan and was experiencing symptoms. ⁣ ⁣ That health-care provider gave a diagnostic test, which came back positive on Monday night. ⁣ ⁣ A news release from the ministry of health said, "Regular handwashing, coughing or sneezing into your elbow sleeve, disposing of tissues appropriately and avoiding contact with sick people are important ways to prevent the spread of respiratory illness generally." ⁣ ⁣ Travellers passing through Vancouver International Airport are also being screened when they arrive at the airport, particularly if they've visited Wuhan, China, where the virus is believed to have originated.⁣ ⁣ Source: Alyse Kotyk/CTV News⁣ Image: CNN⁣ ⁣ #coronavirus #vancouvereats #vancouverfoodie #vancouver #vancouverisland #vancouverbc #vancouverphotographer #vancouvernews #vancouverfashion #vancouvermodel #vancouverlife #robson #coronavirusvancouver #downtownvancouver #westend #kitsilano #grousemountain #richmondbc #vancouvernature #vancouverphotography #gastown #whistler #yaletown #coquitlam #cypressmountain #seymourmountain #granvilleisland #northvan #ubc #yvr
2231600618672302503; 30; False; 1580247564; Today Jamaica had a #Coronavirus scare, tremors from a serious #earthquake and a #tsunami warning... and we are making memes... mi love unu:exclamation_mark: . . . #yaadman #876 #jamaicancomedy #jamaican #jamaicansbelike #jamaicans #funnyvideos #comedy #youlaughyoulose #jamaicajamaica #caribbeanstrong #yardie #westindiemade #locs #loclivin #dreadlocks #dreads #rasta #youtuber #youtube #contentcreator
2231600746466706023; 1; False; 1580247561; Nah, you can have it #coronavirus #animalcrossing #animalcrossingmemes #meme #nintendo
2231600704672405271; 4; False; 1580247556; Me rike dat - - - - - - #wuflu #wuhan #kungflu #coronaviruses #coronavirus #china #pandemic #epidemic #crisis #germs #disease #contagion #contageous #china #chinese #hongkong #taiwan #uhoh #asian #asia #meme #memes #npc #npcmeme #npcmemes #dangerous #quarantine #quarantined #sick #batsoup #kathyzhu
2231599350325028303; 0; False; 1580247552; How does the #coronavirus effect the stock market? Joel Shulman discusses what investors need to consider on #foxnews. #stockmarket #investing #entrepreneurship
2231600648747952028; 0; False; 1580247549; CORONAVIRUS SPREAD I think it’s fair to conclude that eating meat is fast become the single biggest reason for the development and spread of new diseases today. With each iteration, the pathogens becomes stronger, and modern medicines become ineffective in a matter of a few weeks. The problem is bigger than what we might perceive and acknowledge it at. I come from a meat eating family, and a culture that had meat as a staple in two meals a day. That’s been my childhood, my up bringing. A lot of people do not eat meat due to social/ religious belief, or compassion towards animals, or health reasons, or just personal preference. My reason to leave meat, like a lot of you out there, was just the way NOT eating meat made my life- improved my thoughts, feelings, health, and outlook towards everything when combined with the right amount of meditation and yoga. Not everyone in the world will stop eating meat. And we are no one to tell them to. But it’s a point in our own life and times where the proposition begs a good ponder :red_heart: #coronavirus #stopeatinganimals #savetheplanet #saveyourself #healthylifestyle
2231600576698126413; 0; False; 1580247541; IMPORTANTE | @msp_ecuador informa sobre condiciones de salud del paciente asiático sospechoso de portar #coronavirus en #Ecuador
2231600555138293186; 0; False; 1580247538; A few hours ago, the New York Times published an interesting story about how #China’s population, known for assiduously self-censoring their speech online, is refusing to be silent in the face of the rapidly accelerating novel #coronavirus. The deluge of #critical posts, along with clever tricks to dodge censors, are making it nearly impossible for #Beijing to control the narrative on the mainland. Earlier, we mentioned how doctors, nurses and residents in #Wuhan have demanded that their “useless” mayor follow through on an offer to resign for sluggishness in confronting the #outbreak. But that’s not all: though reports claimed #Beijing made an effort to remove #horrifying videos of the situation on the ground in #Wuhan (videos that showed what appeared to be dead bodies lying in hospital hallways), according to #NYT, the censors have now been completely overwhelmed Savanah Hernandez joins Tom to report on the ingenuity of the #Chinese people as they struggle to get news and updates about the Coronavirus out to the rest of the world. Some posters evade censors by referring to President #Xi as “Trump”, or by comparing the outbreak to the Chernobyl nuclear disaster.
2231600478138253748; 0; False; 1580247529; Información sobre el #Coronavirus
2231600408269921268; 9; False; 1580247520; FOLLOW @joketheoak FOLLOW @joketheoak
2231598847736418362; 0; False; 1580247513; Well I’m back guys #coronavirus #china #fuckjakepaul #follow #desperate #memes #free
2231600337253427239; 0; False; 1580247512; 2020 starts tough, but always have faith for the future:folded_hands:. Greetings from Bali :sunrise_over_mountains:. · · #TheBeachHZ #airbnb #hangzhou #China #beach #homedecor #house #home #event #activities #travelgram #instagram #picoftheday #instapic #expatlife #newyear #2020 #toughtimes #faith #coronavirus #kobe #hope #future #happynewyear #havefaith #bali #balisunset #sunsetvibes #sunofbeach
2231600336487973951; 0; False; 1580247512; 3 new Corona viruses have been detected in Germany. And the number of viruses increased to 5. #china #wuhan #changzhou #beijing #coronavirus #Corona #spread #quarantine #hubei #beijing #germany
2231599684139871988; 0; False; 1580247510; (BAŞTAN DİYORUM EĞER BANA ABONE OLMAZSAN SANADA BULAŞIRIM. SONRA SÖYLEMEDİ DEME) #coronavirus #coronaviña #coronavirus2020 #koronavirüsü #koronavirus #koronavirüs
2231600308036121241; 0; False; 1580247509; • • • • • • • • • #corona #coronavirus #coronavirusmemes #corona:beer_mug:
2231600297346841264; 2; False; 1580247507; Çin'in 4 gün önce yapımına başladığı 1000 yataklı hastanenin yapımı bugün sona erdi. . . . . . . #china #coronavirus #sondakikahaberler
2231598034242809814; 7; False; 1580247504; Every 60 seconds in Africa is a minute:upside-down_face: Dts: @1c0nic.mp3 @xg1oxmy @lucasfilm.s @_elxio_ @twevils @dobrikdoe @uwariia.mp4 _ _ _ #omg #edits #edit #viral #viralvideos #manu #manurios #editaudios #playboicarti #idk #explore #explorepage #2020 #coronavirus
2231600236514258831; 0; False; 1580247500; Etiqueten a su amigo el chino :face_with_tears_of_joy::face_with_tears_of_joy:. . . . . . . . . . . . #memesespañol #lifestyle #meme #corona #coronacumpleaños #coronavirus #confesioneshot #memehot #anonimo #ozuna #frentedeanuel #hastaelinfinitoymasalla #venecia #donde #messi
2231599091501436972; 0; False; 1580247493; Listen in for a few thoughts on #coronavirus, #pandemics, #disclosure and #businesscontinuity.
2231600147744473207; 2; False; 1580247489; Sembla que la cosa se’ns complica pel que fa el coronavirus:microbe::hear-no-evil_monkey:…. :white_small_square::white_small_square::white_small_square::white_small_square::white_small_square::white_small_square::white_small_square::white_small_square::white_small_square::white_small_square::white_small_square::white_small_square::white_small_square::white_small_square::white_small_square::white_small_square::white_small_square::white_small_square: De de l’inici del brot fins ahir (27 de gener), s’havien registrat 2783 casos confirmats:double_exclamation_mark:, 2744 a la Xina i 39 casos en altres països: Tailàndia, Japó, Corea del Sud, Taiwan, Vietnam, Singapur, Nepal, Malàsia, Australia, França i EEEUU. :white_small_square::white_small_square::white_small_square::white_small_square::white_small_square::white_small_square::white_small_square::white_small_square::white_small_square::white_small_square::white_small_square::white_small_square::white_small_square::white_small_square::white_small_square::white_small_square::white_small_square::white_small_square: Tots aquests casos van ser importats de Wuhanm. :white_small_square::white_small_square::white_small_square::white_small_square::white_small_square::white_small_square::white_small_square::white_small_square::white_small_square::white_small_square::white_small_square::white_small_square::white_small_square::white_small_square::white_small_square::white_small_square::white_small_square::white_small_square: A dia d’avui, 461 casos estan en estat greu i han mort 80 persones des de l’inici del brot. (taxa de letalitat al voltant del 3%):double_exclamation_mark::double_exclamation_mark::double_exclamation_mark: :white_small_square::white_small_square::white_small_square::white_small_square::white_small_square::white_small_square::white_small_square::white_small_square::white_small_square::white_small_square::white_small_square::white_small_square::white_small_square::white_small_square::white_small_square::white_small_square::white_small_square::white_small_square: El dia 20 de gener les autoritats xineses van confirmar la transmissió de persona a persona del 2019-nCoV :white_small_square::white_small_square::white_small_square::white_small_square::white_small_square::white_small_square::white_small_square::white_small_square::white_small_square::white_small_square::white_small_square::white_small_square::white_small_square::white_small_square::white_small_square::white_small_square::white_small_square::white_small_square: Per similitud amb altres coronavirus :microbe:coneguts es pensa que el 2019-nCoV es transmet principalment per les gotes respiratòries :sweat_droplets:de més de 5 micres i pel contacte directe :folded_hands:amb les secrecions infectades. El període d’incubació de la malaltia dels primers casos s’ha estimat entre 2 i 12 dies. :white_small_square::white_small_square::white_small_square::white_small_square::white_small_square::white_small_square::white_small_square::white_small_square::white_small_square::white_small_square::white_small_square::white_small_square::white_small_square::white_small_square::white_small_square::white_small_square::white_small_square: A Catalunya, tot i que de moment el risc es considera baix, ja s’ha establert el procediment:winking_face: de detecció , notifiació i maneig de les infeccions. :white_small_square::white_small_square::white_small_square::white_small_square::white_small_square::white_small_square::white_small_square::white_small_square::white_small_square::white_small_square::white_small_square::white_small_square::white_small_square::white_small_square::white_small_square::white_small_square::white_small_square::white_small_square: Podeu accedir a l’enllaç http://salutpublica.gencat.cat/web/.content/minisite/aspcat/vigilancia_salut_publica/alertes_salut_publica/Nou-coronavirus-2019-nCoV/Procediment-actuacio-nCoV.pdf #coronavirus #virus #consellfarmaceutic #atenciofarmaceutica #latevafarmacideconfiança #artesadesegre #noguera
2231600085577093967; 0; False; 1580247482; 𝐃𝐄𝐒𝐓𝐀𝐂𝐀𝐃𝐎 | :Paraguay: . La autoridad aeroportuaria de Paraguay sigue coordinando de forma detallada con las compañías aéreas que operan en el país los protocolos de prevención ante casos de pasajeros con síntomas de padecer el coronavirus, que ya ha acabado con la vida de más de un centenar de personas en China. . El director de aeropuertos, Óscar Cubilla, dijo este martes en una rueda de prensa que han comenzado a reunirse con las aerolíneas para «afinar detalles» sobre los protocolos sanitarios ya establecidos para la prevención de un problema sanitario que ya es global. . Añadió que se trata de incidir en el trabajo de información y coordinación con las tripulaciones y personal de tierra si se detectan casos de riesgo. . #Destacado #Economía #Salud #Coronavirus #Cuarentena #Seguridad #Control #Prevención #China #Brote #Virulencia #SARS #Vacunas #Paraguay #RevistaPLUSpy :memo:Lee más noticias en @RevistaPLUSpy – link en BIO :pushpin:
2231600051478970828; 1; False; 1580247478; Interactive map produced by #johnshopkinsuniversity tracking the #coronavirus
2231600016246605466; 0; False; 1580247474; :rolling_on_the_floor_laughing::rolling_on_the_floor_laughing::rolling_on_the_floor_laughing::rolling_on_the_floor_laughing::rolling_on_the_floor_laughing::rolling_on_the_floor_laughing::rolling_on_the_floor_laughing:- Sígueme - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -- #memeroskings #memes #memesforlife #memesdeporvida #memes #memesespañol #memesgraciosos #memesdaily #memestagram #memeaccount #memes4days #dailymeme #gracia #gracioso #memegracioso #risa #risasaseguradas #risagraciosa #memepage #coronavirus #memesenespañol #instameme #memesbuenos #buenosmemes #risasmil #memeteam #muybueno #muygracioso #sigueme #followme #meme4days
2231599911537800657; 0; False; 1580247461; Cara mencegah penularan Corona virus #apotekplasma #coronavirus #penularancoronavirus
2231599900709544970; 5; False; 1580247460; #coronavirus #coronavirusoutbreak
2231599873722155283; 0; False; 1580247460; Tesla is offering free supercharging in China, during coronavirus outbreak . . Read more on alexandtomstech.com . . #Tesla #Coronavirus #TeslaChina
2231599896364617914; 0; False; 1580247459; #aviso #importante #ministerio #psuv #chavistas #coronavirus
2231599839078781974; 0; False; 1580247453; ‪Preparing for the Corona Virus. UnmincedWords.com hopes you’re ready! #coronavirus #corona #safety #wellness #beer #corona #coronabeer #liquor #drinking #drunk #stoned #college #party #unminced #jesus #religion #humor #funny #collegehumor #theonion #lol #funny ‬
2231599822260004349; 0; False; 1580247451; #coronavirus #virus #prevenzione #informazionisicure #consigliutili #salute #info #nurse
2231599762591684996; 0; False; 1580247443; Concerned about the #coronavirus in China? We’re closely monitoring the situation along with @cdcgov. The immediate risk is considered low here in the United States, unless you have recently traveled to Wuhan, China. Stay informed. Find more information about the coronavirus at www.cdc.gov/nCoV.
2231599755947683718; 0; False; 1580247443; You can’t get the corona-virus when you only drink cruisers :winking_face::index_pointing_up: . . . #corona #corona:beer_mug: #coronamemes #coronavirus #coronavirusoutbreak #coronavirusmemes #coronaviruses #coronaviruschina #coronavirusmeme #getthisshitoffme #tyler1 #tyler1memes #tyler1meme #tyler1autism #tyler1rage #gamingmemesmp4 #kobe #ww3memes #kobememes #kobebryant24 #ripkobe #animememes #animememesdaily #animememe #spicyhentaimemes #darkhumormemes #darkhumorjokes #darkhumoristhebesthumor #minecraftbuilds #cloutymemes
2231599635613591800; 12; False; 1580247428; :eyes: . . . #photo #lyon #ville #apocalypsemood #coronavirus #gris
2231599634823096241; 0; False; 1580247428; #coronavirus Onset :heavy_minus_sign: (negative), Latter :heavy_plus_sign: (positive): : :female_sign:, 49, fever - headache; :hospital:Jan21. Tested at :hospital:, local CDC. Jan23 CDC: :heavy_minus_sign: Jan25 CDC: weak :heavy_plus_sign: :hospital:: :heavy_minus_sign: Jan27 CDC: :heavy_plus_sign: . : :hospital:The 5th Affiliated Hospital of Sun Yat-Sen University.
2231599210024280773; 1; False; 1580247427; +++ATTENZIONE ATTENZIONE+++ . . . . . . . . . #niconese #nicoart #followme #follow #lecco #madeinitaly #italianguy #dude #virus #corona #cure #tg #attenzione #man #italianman #love #madeinitaly #cartoon #sicilia #tbt #postoftheday #photooftheday #videooftheday #coronavirus #vaccino #friends #fun #cartonimorti
2231599530043105718; 0; False; 1580247416; Reversible face mask for sale! only $7.50! https://etsy.me/3aQefkz . . . . . #accessories #etsy #reversiblemask #outerspacefacemask #bluefacemask #galaxyfacemask #kpopfacemask #medicalfacemask #surgicalmask #surgicalfacemask #allergyfacemask #allergymask #facemask #facemaskkpop #facemaskhomemade #kpop #kpoper #kpopmask #virus #coronavirus #illness #sick #galaxy #space #outerspace
2231599533247009975; 0; False; 1580247416; The possibility of human extinction by coronavirus ? . #humanbeing #nature #coronavirus #humanextinction
2231599454662463002; 4; False; 1580247407; Yorulan çin doktorları .... Çin/Hubei'de gerçekleşen karga istilasında Corvus cinsi kargaların hassas bir koku alma duyusuna sahip olduğu ve cesetlerden yayılan hafif kokuları uzun mesafeden koklayabilecekleri, cesetlere ulaşmak için yarışabilecekleri söyleniyor. Yabani hayvanlar vuruluyor. Hastalarını teslim etmeyen halk Ülkedeki koruyucu stokları bittiği için halk ne yapacağını şaşırdı ... #koronavirüsü #koronavirus #çinvirüsü #sondakika #sondakika #önemli #china #news #breakingnews #breaking #haber #gündem #coronavirus#sondakika #önemli #haber #gündem #karantina #coronavirüsü #koronavirus #koronavirüsü #Wuhan kentindeki sağlık çalışmaları yetmiyor. Çin'de karantina altına alınan şehir sayısı yükseliyor. Daha fazlası için takip etmeyi unutmayın :red_heart: @saglikbakanligi Daha fazlası için takip etmeyi unutmayın :red_heart: #corona #coronavirus #türkiye #tsk #hastalik #istanbul:Turkey: #kolombiya #istanbul #saglikbakanligi #cin #çin #woman #coronavirus #abd #trump #salgın #virus #
2231599438562976583; 1; False; 1580247405; #repost ..... :woman_health_worker: ..... #coronavirus #enfermagem #enfermagemporamor #enfermagemavançada #socorristas #tecenfermafem
2231599389751478468; 0; False; 1580247399; #coronavirus #coronavirusoutbreak #wuhanvirus #virus #tips #protectyourself #information #love #beaware #diseaseprevention #disease #donteatbats #unity #pray :folded_hands::flexed_biceps::raised_fist::face_with_medical_mask:
2231599363470022711; 1; False; 1580247396; #coronavirus #coronavirusoutbreak #wuhanvirus #virus #tips #protectyourself #information #love #beaware #diseaseprevention #disease #donteatbats #unity #pray :folded_hands::flexed_biceps::raised_fist::face_with_medical_mask:
2231599326021629792; 4; False; 1580247391; @fresh.themeemer brace yourself! The virus is coming. I'll bring the #corona:beer_mug: . - - :warning:Follow @bamf.memes for more. :warning: - - #ricardomemes #virus #coronavirus #news #currentevents #currentmemes #dankmemes #dankmemesdaily #meme #offensivememes #offensive #china #sick #staystrong #staysafe #followmenow #followtrain #likeforlikes #likeforfollow #lmao #darkmemes #like4likes #followers #
2231599244845113890; 0; False; 1580247382; Poster 245: are we in danger? designed with: #sparkpost #designoneposteraday #posterdesign #design #poster #challenge #bright #graphicdesign #graphic #challenge #posterchallenge #designspiration #corona #coronavirus #danger #bacteria #virus
2231598171371618629; 0; False; 1580247381; @doctormedicine_ YES THANK YOU, we’re all in this together, guys! Just traveled over 20,000 miles and all I can say is... #shit #godivadamn Wearing a mask over one earlobe says: “Get into this immune system, you nasty virus you...” #bedroomeyes #medschool #nursingschool #science #hospital #ER #EMT #nurses #physicianassistant #emtmemes #scrublife #doctors #doctormemes #palife #medical #medicine #medschoolmemes #gradschoolmemes #medschool #nursingschool #paschool #dentalschool #graduate #memes #schoolmemes #health #nurse #traumanurse #memes #coronavirus #travel
2231599184455474365; 0; False; 1580247375; @cnn The death toll from the Wuhan coronavirus outbreak rose to 106 people on Tuesday. There are now more than 4,500 total reported cases in mainland China, a figure that jumped 65% between Sunday and Monday. More than a dozen countries have confirmed cases of the virus, including five in the US. . . @reuters Pictures uploaded to social media on January 25, 2020 by the Central Hospital of Wuhan show medical staff attending to patients, in Wuhan, China. THE CENTRAL HOSPITAL OF WUHAN VIA WEIBO /via REUTERS #wuhan #coronavirus #hospital #health #reuters . . @chinaxinhuanews Good news! A company in Wuqing District, north China's Tianjin Municipality, has delivered its first batch of the 2019-nCoV detection reagent boxes for 10,000 people. These products have been sent to Wuhan for free. :camera:Ma Ping #coronavirus #detectionreagentbox #reagent #medicalresearch #medicine #Wuhan #medicalaid . . @9news What are the symptoms of #coronavirus, and how can you protect yourself? Here’s what to look out for. #9News . . @straits_times Experts in Singapore have said that it is better to use surgical masks instead of N95 masks to guard against the Wuhan virus. Here are some pointers when using them. Link in bio @straits_times #wuhan #wuhanvirus #coronavirus #StraitsTimes . . @who Stay healthy while travelling! :airplane::mountain_railway::automobile::ship::oncoming_bus: :pot_of_food: Eat only well-cooked food :drooling_face: Avoid spitting in public :paw_prints: Avoid close contact and travel with animals that are sick . . :clapper_board: @bbcnews Residents in Wuhan, China are shouting encouragement and singing songs from their apartment windows to boost morale amidst the coronavirus quarantine. :speaker_medium_volume: Wuhan is the centre of the deadly outbreak, and all 11 million residents have been advised to stay at home. Click the link in the bio to find out more. :backhand_index_pointing_up: #china #coronavirus #wuhan #bbcnews
2231599186873299547; 0; False; 1580247375; Follow me (@wacky_memes.wav) for more! • • • • • [shh] • • • • • • • #memepage #memes #meme #dankmemes #memesdaily #funnymemes #funny #memestagram #memer #lol #dank #memez #lmao #edgymemes #memeaccount #shitpost #offensivememes #dankmeme #dailymemes #follow #bestmemes #memesquad #funnymeme #memelife #spicymemes #humor #funnyvideos #worldwar3memes #edgy #coronavirus
2231599160399177107; 0; False; 1580247372; :no_entry: #ATENCIÓN :no_entry: Ministerio de salud desmiente que ciudadano sospechoso de #coronavirus haya fallecido, sin embargo, informa que su situación es crítica.
2231599135652482663; 0; False; 1580247369; Follow me (@wacky_memes.wav) for more! • • • • • [shh] • • • • • • • #memepage #memes #meme #dankmemes #memesdaily #funnymemes #funny #memestagram #memer #lol #dank #memez #lmao #edgymemes #memeaccount #shitpost #offensivememes #dankmeme #dailymemes #follow #bestmemes #memesquad #funnymeme #memelife #spicymemes #humor #funnyvideos #worldwar3memes #edgy #coronavirus
2231599049484756750; 0; False; 1580247358; :face_with_tears_of_joy::face_with_tears_of_joy::face_with_tears_of_joy::face_with_tears_of_joy::face_with_tears_of_joy::face_with_tears_of_joy::face_with_tears_of_joy::face_with_tears_of_joy::face_with_tears_of_joy::face_with_tears_of_joy::face_with_tears_of_joy::face_with_tears_of_joy::face_with_tears_of_joy: :OK_hand_medium-dark_skin_tone:Follow: @laugh.therapy :thumbs_up_medium-dark_skin_tone:Double tap :folded_hands_medium-dark_skin_tone:Tag friends :raised_fist_medium-dark_skin_tone:Share #lol #bruh #nochill #funnymemes #memes #laugh #lmfao #fun #memesdaily #trump #WWIII #iran #russia #coronavirus #australia #australianfire #january2020 #LTmemes
2231599045323950052; 0; False; 1580247358; Follow me (@wacky_memes.wav) for more! • • • • • [shh] • • • • • • • #memepage #memes #meme #dankmemes #memesdaily #funnymemes #funny #memestagram #memer #lol #dank #memez #lmao #edgymemes #memeaccount #shitpost #offensivememes #dankmeme #dailymemes #follow #bestmemes #memesquad #funnymeme #memelife #spicymemes #humor #funnyvideos #worldwar3memes #edgy #coronavirus
2231598980639356652; 0; False; 1580247350; Follow me (@wacky_memes.wav) for more! • • • • • [shh] • • • • • • • #memepage #memes #meme #dankmemes #memesdaily #funnymemes #funny #memestagram #memer #lol #dank #memez #lmao #edgymemes #memeaccount #shitpost #offensivememes #dankmeme #dailymemes #follow #bestmemes #memesquad #funnymeme #memelife #spicymemes #humor #funnyvideos #worldwar3memes #edgy #coronavirus
2231598930827760686; 0; False; 1580247344; Follow me (@wacky_memes.wav) for more! • • • • • [shh] • • • • • • • #memepage #memes #meme #dankmemes #memesdaily #funnymemes #funny #memestagram #memer #lol #dank #memez #lmao #edgymemes #memeaccount #shitpost #offensivememes #dankmeme #dailymemes #follow #bestmemes #memesquad #funnymeme #memelife #spicymemes #humor #funnyvideos #worldwar3memes #edgy #coronavirus
2231598924358448179; 74; False; 1580247344; Díganme exagerado o lo que sea pero yo no sé :man_shrugging_light_skin_tone: #FueraDeJodaCuidateDelCoronaVirus #coronavirus #MasValePrevenirQueLamentar #YaChau
2231598906206861211; 0; False; 1580247341; #coronavirus #nuclearwar #filter my kids also have masks.
2231598894253736107; 0; False; 1580247340; Bruh ~JDawg . . . (Ignore dem tagz) #memes #dank #dankmemes #newmemepage #ocmemes #oc #funny #lol #Memeslave__ #Memeslave #edgy #edgymemes #lmao #rofl #dailymemes #dankmemesdaily #coronavirus #corona #coronavirusmemes #cursedimage #ww3 #wwiii #codmemes #zombiesmemes #zombies
2231597542387157984; 1; False; 1580247336; Not to live or be in Fear but to be AWARE! 5 cases so far in USA. There is a censorship going on about how dangerous this is. And China is lying about the severity. It sounds like morgellons in the sense that it’s an “intelligent virus” in a robotic type nature. It’s airborne- causing a cough or flu like symptoms orally. It is confirmed from mucus of the eyes also. Sounds a bit like the bird box? But some people have the virus and don’t know. This was man made virus in the Wuhan Laboratories in China where they work with biological warfare “Institute of Virology”. All their government officials fled the country. They are randomly ineffectively spraying down Wuhan with pesticides on the streets. They have known about the virus for months. The first case confirmed was a month ago so they say? So why did they not warn their own people and the rest of Gaia??? Only until MF’s were dropping dead on the streets!!!! Whether or not it was let out by accident or purpose we don’t know. But what we do know they can not seem to contain it - the virus has mutated. Which means no cure or understanding of it. It’s taking people out hard. I believe it is worse than they say it is. Vibe high friends!!!! Wear :face_with_medical_mask:mask /goggles:goggles: & gloves:gloves:. Stay in good health- be as POSITIVE (keep your frequency high) in your life as possible and stay away from certain areas or large crowds. NYC people should wear mask & gloves on subway. We don’t know who has it until a month from now. They have been letting planes go from around the world fly with Zero protection no masks or anything???? People don’t get sick until a few days later!!!.:heart_suit: It’s also not letting post this whole video... 14min long as a TV . check out @thehomedoctorz for full version #heartcentered #wildwomen #empowerment #mothergaia #fractaluniverse #sacredenergy #unapologetic #selfcare #nourishment #theportal #Galacticrealm #divinefeminine #divinemasculine #DNAactivation #healingenergy #Multiverse #starseed #vibrationalreality #lifeforceenergy #magicalbeings #whitewitch #cannabismedicine #GalacticEmpire #Coronavirus #Omniverse #Infinitenature #hippie #innerverse #Plantbased #Akashicrecords
2231598749356137872; 0; False; 1580247323; Ya Valimos:skull:⠀ ---⠀ #MemesPulentos #Instachile #Pulento #PedroelMono #CoronaVirus
2231596219059528731; 2; False; 1580247323; #CHINA - Algunos internautas compartieron videos que muestran muchos cuervos que vuelan por el cielo en Jingzhou y Yichang en la provincia de Hubei. Ambas ciudades se encuentran a una distancia promedio de Wuhan de 250 kilómetros. ⁠ Crédito del vídeo @hk.epochtimes ⁠ #Wuhan #WuhanCoronavirus #WuhanSARS #WuhanOutbreak #WuhanPneumonia #WuhanVirus #SARSvirus #SARS2020 #SarsCov #CoronaVirus #Pneumonia #China #nuevocoronavirus ⁠#neumonia #virus #spanishnews #noticias #Hubei #Epochtimes
2231598702020483691; 2; False; 1580247317; Y vamos sumando :crying_face: ~ RG Migraña - Síguenos para mas contenido :green_heart: - - - - #memesdaily #elgoth #meme #memesgraciosos #memesenespañol #memesespañol #memes:face_with_tears_of_joy: #memes #goth #siguemeytesigo #gothjaidefinichon #chileanmemes #jaidefinichongoth #china #coronavirus #gatitos #kakarot #dylantero #instagram #instamemes #simpsonsmemes
2231598644591516247; 0; False; 1580247313; Fuck you say to me bitch #corona #coronavirus
2231598637182512936; 0; False; 1580247309; Nomor hotline tentang Corona virus #apotekplasma #coronavirus #hotlinecoronavirus
2231598595801866822; 0; False; 1580247304; #coronavirus on va tout mourir
2231598313820854895; 3; False; 1580247303; Depremlerden ve salgin hastaliklardan sonra kurşun döktürüyoruz Allah korusun. #mizah #kurşun#animasyon#dünya#yalandünya #depremler #salgın #coronavirus #sıkıntılar#sallanma#hacamat#astroloji#uzaylı #kaygı#depresyon#geceyebirsözbırak #aydin#izmir#efeler#aydinanneleri #incirliova#guzelcamli#turkiye#manisa#elazig#denizli#mugla #kuşadası #mucizedoktor #dua
2231598550320761181; 0; False; 1580247299; yup , thanks karen #hypocrisy #coronavirus
2231598523803995968; 33; False; 1580247296; Talking about coronavirus while millions of people are at threat from it, is completely inappropriate, the Prime Minister says. Asked this morning what his government was doing to prepare for a possible outbreak of the virus, Mr Morrison said “No, sorry not today,” before taking a question about Australia’s chances in the upcoming T20 series in South Africa. Pressed further for an explanation, Mr Morrison said it was insensitive to victims and those at risk to talk about potential solutions. “Once all of this is over and Australia has been devastated by this virus, then let’s talk about how we might address it. But to talk about how we might combat this now, before the virus has even properly taken hold, is frankly inappropriate”. He sent his thoughts and prayers to those affected. #auspol #coronavirus #scottmorrison
2231598520162652810; 0; False; 1580247295; #salud #coronavirus #epidemia #cuidadosdiarios #prevención
2231598499248678385; 0; False; 1580247293; Die Prophezeiung Katastrophen der Endzeit der Bibel hat sich erfüllt | Die Tage Noahs sind gekommen Vor zweitausend Jahren, als die Jünger des Herrn Jesus Ihn fragten, was das Zeichen Seiner Ankunft und des Endes der Welt sein würde, antwortete der Herr Jesus: „Ihr werdet hören Kriege und Geschrei von Kriegen; sehet zu und erschreckt euch nicht. Das muß zum ersten alles geschehen; aber es ist noch nicht das Ende da. Denn es wird sich empören ein Volk wider das andere und ein Königreich gegen das andere, und werden sein Pestilenz und teure Zeit und Erdbeben hin und wieder. Da wird sich allererst die Not anheben“ (Matthäus 24,6-8). Wenn Sie genau das Video sehen , werden Ihnen gute helfen ! :sparkling_heart::sparkling_heart::sparkling_heart::down_arrow::sparkling_heart::down_arrow::sparkling_heart::down_arrow::sparkling_heart: https://www.bibel-de.org/Die-Tage-Noahs.html #Prophezeiung #Katastrophen #Endzeit #Bibel #Evangelium #Gott #Segen #EvangeliumVideo #China #Neues #Corona #Virus #Coronavirus
2231598422058544487; 0; False; 1580247284; :small_blue_diamond::small_blue_diamond:Help #prevent the spread of #coronavirus by taking these actions:backhand_index_pointing_down_medium_skin_tone: .. .. .. :small_blue_diamond::backhand_index_pointing_right_medium-dark_skin_tone:Reduce risk from #coronavirus infection: ‭:backhand_index_pointing_right_medium-dark_skin_tone:hand hygiene‬ ‭:backhand_index_pointing_right_medium-dark_skin_tone:cover mouth & nose when :backhand_index_pointing_right_medium-dark_skin_tone:coughing & sneezing‬ ‭:backhand_index_pointing_right_medium-dark_skin_tone:thoroughly cook meat &eggs‬ ‭:backhand_index_pointing_right_medium-dark_skin_tone:avoid close contact with anyone with respiratory illness‬ ‭:backhand_index_pointing_right_medium-dark_skin_tone:avoid close contact with wild or live farm animals‬ .. .. .. :small_blue_diamond:Avoid the repeat of #ebola outbreak by taking the necessary precautions :backhand_index_pointing_up_medium-light_skin_tone:#prevention is key! .. .. .. #publichealth #coronavirus #epidemiology #outbreak #awareness #healtheducation #healthpromotion #support
2231598404358723716; 0; False; 1580247282; #meme #china #coronavirus
2231598383982859468; 0; False; 1580247279; La psychose #coronavirus #chine #virus
2231598333047209323; 0; False; 1580247273; La psychose #coronavirus #chine #virus
2231598319608842450; 0; False; 1580247271; They eat everything out there #virus #corona #coronavirus #memes #meme #spongebobmemes #spongebob #china #chinesefood
2231598313761431867; 0; False; 1580247271; Type in Code “GG” for discounts on all CBD products. Link in bio #CBD #coronavirus #health #cancer #cures #pets #cbdoil #vapes :shushing_face::see-no-evil_monkey::hear-no-evil_monkey::speak-no-evil_monkey: PAY ATTENTION :eyes::eye::eyes::eye::eyes: A compound made by #cannabis plants has been found to wipe out drug-resistant bacteria, raising hopes of a new weapon in the fight against #superbugs. Scientists screened five cannabis compounds for their antibiotic properties and found that one, cannabigerol (CBG), was particularly potent at killing methicillin-resistant Staphylococcus aureus (#MRSA), one of the most common hospital #superbugs. Tests in the lab showed that CBG, which is not psychoactive, killed common MRSA microbes and "persister" cells that are especially resistant to antibiotics and that often drive repeat infections. The compound also cleared up hard-to-shift "biofilms" of MRSA that can form on the skin and on medical implants. Having seen how effective the substance was against bacteria in the lab, the researchers decided to test CBG's ability to treat infections in animals. In a study that has not yet been published, they found that CBG cured mice of MRSA infections as effectively as vancomycin, a drug widely considered to be the last line of defence against drug-resistant microbes. The study is under review at the ACS Infectious Diseases journal. Eric Brown, a microbiologist who led the work at #McMasterUniversity in #Hamilton, #Ontario, said cannabinoids were "clearly great drug-like compounds", but noted it was early days in assessing the compounds for use in the clinic. "There is much work to do to explore the potential of the cannabinoids as antibiotics from the safety standpoint," he said. Antibiotic resistance has become a major threat to public health. #England's former chief medical officer Dame Sally Davies has said the loss of effective antibiotics would lead to "apocalyptic scenarios", with patients dying from routine infections and many operations becoming too risky to perform. In the study, the researchers describe how the rapid global spread of drug resistance, caused by microbes developing mutations that protect them against antibiotics, has driven an urgent need to explore new sources of drugs.
2231598308350776041; 0; False; 1580247270; Friendly remind: Please don't go to the Markham - T&T Supermarket, Woodbine & 16th Ave. Because of the second coronavirus patient :face_with_medical_mask: had been there before. Don’t go to Markville Mall. One of the employee who works at the Chinese Jewelry Store is now under quarantine after working for 3 days (without protection) upon returning from Wuhan. Be vigilant. The virus is here and is spreading. #coronavirus
2231598273261522946; 0; False; 1580247266; La psychose #coronavirus #chine #virus
2231598076999844795; 0; False; 1580247263; #Չինաստանում 1000 մարդու համար նախատեսված հիվանդանոց են կառուցում՝ Քորոնավիրուսի դեմ պայքարելու համար ​China Built New Hospital in Wuhan to Battle #Coronavirus
2231598239403367655; 344; False; 1580247262; In a major global breakthrough, Australian scientists have developed a lab-grown version of coronavirus. :wavy_dash: Scientists at Melbourne's Peter Doherty Institute for Infection and Immunity will now share it with the World Health Organisation in Europe, which will in turn share it with labs worldwide involved in the race to develop a vaccine. :wavy_dash: The team of scientists grew the virus from a patient who had been infected since Friday. The discovery will enable researchers to develop a test to identify people who might be infected with the virus, even before they show any symptoms. :wavy_dash: The ABC was in the lab the moment scientists discovered they had successfully grown the virus. Mike Catton, the co-deputy director of the Doherty Institute, confirming it with three words: "We got it.” :wavy_dash: Doherty Institute lead scientist Julian Druce said the discovery was a significant development in the global understanding of the virus, and for the response to it. "This will be a game-changer for other labs within Australia," Dr Druce said. :wavy_dash: :camera_with_flash: ABC News: Loretta Florance :wavy_dash: #abcnews #news #breakingnews #newsupdate #australia #coronavirus #breakthrough #science #health
2231598193593612263; 43; False; 1580247256; Os países melhores e piores preparados para uma epidemia! Em outubro de 2019 o Índice Global de Segurança Sanitária foi lançado e avaliou os níveis de segurança global em saúde em 195 países. Ele analisou especificamente os níveis de preparação, concentrando-se em saber se os países possuem as ferramentas adequadas para lidar com surtos graves de doenças. Os países foram pontuados em uma escala de 0 a 100, onde 100 é o nível mais alto de preparação. Os EUA :U.S._Outlying_Islands: foram nomeados como o país com as medidas mais fortes em vigor e ficaram em primeiro lugar com 83,5 em 100. O Reino Unido :United_Kingdom: ficou em segundo com 77,9, seguido pelos Países Baixos :Netherlands: com 75,6. A China :China:, que iniciou uma série de bloqueios em resposta ao surto do Coronavírus, ocupa a 51ª posição com 48,2 pontos. No mapa que mostra os níveis de preparação em todo o mundo, a vulnerabilidade da África é imediatamente perceptível. O continente lutou contra doenças graves no passado e, em 2014, um grande surto de Ebola deixou partes devastadas da África Ocidental, matando mais de 10.000 pessoas. Até agora, nenhum país da África relatou um caso confirmado de coronavírus. No entanto, o continente tem alguns dos países mais fracos quando se trata de conter doenças, sendo a Guiné Equatorial :Equatorial_Guinea: (16.2) e a Somália :Somalia: (16.6) os países com pior pontuação no Índice Global de Segurança Sanitária. Acesso ao relatório do Índice Global de Segurança Sanitária: https://www.ghsindex.org/ Acesso à matéria do @statista: https://www.statista.com/chart/20629/ability-to-respond-to-an-epidemic-or-pandemic/ #geografiageral #geografia #geography #saude #medicina #coronavirus #atualidades #mapamundi #worldmap
2231598178470698837; 1; False; 1580247255; #mdr #lol #ptdr #fun #funny #publication #drole #blague #école #rigolo #rigoler #rigole #humour #francais #hilarant #marrant #tresmarrant #tropmarrant #amusant #tresdrole #tropdrole #humouristique #:face_with_tears_of_joy: #:face_with_tears_of_joy::face_with_tears_of_joy::face_with_tears_of_joy::face_with_tears_of_joy::face_with_tears_of_joy::face_with_tears_of_joy::face_with_tears_of_joy::face_with_tears_of_joy::face_with_tears_of_joy::face_with_tears_of_joy::face_with_tears_of_joy::face_with_tears_of_joy::face_with_tears_of_joy::face_with_tears_of_joy::face_with_tears_of_joy::face_with_tears_of_joy::face_with_tears_of_joy::face_with_tears_of_joy::face_with_tears_of_joy::face_with_tears_of_joy::face_with_tears_of_joy::face_with_tears_of_joy::face_with_tears_of_joy::face_with_tears_of_joy::face_with_tears_of_joy::face_with_tears_of_joy::face_with_tears_of_joy::face_with_tears_of_joy::face_with_tears_of_joy::face_with_tears_of_joy::face_with_tears_of_joy::face_with_tears_of_joy::face_with_tears_of_joy::face_with_tears_of_joy: #:loudly_crying_face: #desbarres #jpp #troppourmoi #xptdrlol #coronavirus
2231598179248530581; 0; False; 1580247255; #Coronavirus #update #outbreak @strikesurvival @strike_survival @strikesurvivalllc
2231598149966053540; 0; False; 1580247251; #Coronavirus #update #outbreak @strikesurvival @strike_survival @strikesurvivalllc
2231598119280676407; 0; False; 1580247248; #Coronavirus #update #outbreak @strikesurvival @strike_survival @strikesurvivalllc
2231598018130550189; 1; False; 1580247236; 》》C O R O N A《《 • • • :biohazard: #corona #china #wuhan #coronavirus #virus #pandemic #epidemie #sars #biohazard #composing #photoshop #digitalartist #dodgeandburn #adobe #angst #2019nCoV
2231598001788652231; 3; False; 1580247234; #wijzijnerklaarvoor #coronavirus #werkenindezorg @manonie1972
2231597940543537796; 0; False; 1580247232; Tremors of Earthquake in Jamaica #earthquake #jamaica #cuba #caymanislands #coronavirus #wuhan #china #amazing #turkey #storm #duststorm #explosion #attack #gun #fire #blast #bomb #sea #water #animals #news #world #incident #viral #trending #watch #food #fashion #photo #today
2231597972620174661; 0; False; 1580247230; O que é o novo corona Vírus? É um novo vírus que tem causado doença respiratória pelo agente coronavírus, com casos recentemente registrados na China. Importante saber que os coronavírus são uma grande família viral, conhecidos desde meados de 1960, que causam infecções respiratórias em seres humanos e em animais. Geralmente, infecções por coronavírus causam doenças respiratórias leves a moderadas, semelhantes a um resfriado comum. Alguns coronavírus podem causar doenças graves com impacto importante em termos de saúde pública, como a Síndrome Respiratória Aguda Grave (SARS), identificada em 2002 e a Síndrome Respiratória do Oriente Médio (MERS), identificada em 2012. Como previnir ? O Ministério da Saúde orienta cuidados básicos para reduzir o risco geral de contrair ou transmitir infecções respiratórias agudas, incluindo o novo coronavírus. Entre as medidas estão: evitar contato próximo com pessoas que sofrem de infecções respiratórias agudas; realizar lavagem frequente das mãos, especialmente após contato direto com pessoas doentes ou com o meio ambiente; utilizar lenço descartável para higiene nasal; cobrir nariz e boca quando espirrar ou tossir; evitar tocar mucosas de olhos, nariz e boca; higienizar as mãos após tossir ou espirrar; não compartilhar objetos de uso pessoal, como talheres, pratos, copos ou garrafas; manter os ambientes bem ventilados; evitar contato próximo a pessoas que apresentem sinais ou sintomas da doença; evitar contato próximo com animais selvagens e animais doentes em fazendas ou criações. Profissionais de saúde devem utilizar medidas de precaução padrão, de contato e de gotículas (mascára cirúrgica, luvas, avental não estéril e óculos de proteção). . . . . #Compartilhe #saude #previnirémelhorquetratar #coronavirus Fonte: Ministério da Saúde
2231596563134663827; 0; False; 1580247220; :memo:|Kapital Al Día| Hoy Aryam Pereira (@aryampereira) nos habla del desarrollo del Coronavirus de China y cómo ha sido impacto en los mercados financieros globales. · · Para mayor información, sígannos por nuestras redes sociales @Kapitalconsultores · · · · #Coronavirus #CoronavirusEnLosMercados #mercadosfinancieros #finanzas
2231597850852438261; 1; False; 1580247216; A brasileira Reisi Liao mudou-se em novembro para Wuhan, cidade em que, hoje, 11 milhões estão em quarentena. Há uma semana, ela praticamente não sai de casa e, com um bebê de dois anos, evita inclusive descer para as áreas comuns do condomínio para manter o filho longe do vírus. Apenas algumas farmácias e supermercados continuam abertos. Leia o relato de Reise @bbcbrasil #BBCBrasil #Coronavirus #Saude
2231597829671774995; 0; False; 1580247213; #DailyNotable #EnglishNewsPaper Wednesday, 29, January, 2020 #News #CMPUNJAB #CoronaVirus #ForInformationAndQueries #Notable #EditorInChief #DrATTAULWADOOD dailynotable@gmail.com Contact +923451439999 www.thedailynotable.com
2231597817860005811; 0; False; 1580247212; We are surviving, but this has been going on for far too much My neighbourhood has turned into a ghost city,:microbe:#CoronaVirus
2231597715636449499; 2; False; 1580247199; Alttaki yorum dkdkfkfk #geceyebirsözbırak #sözsokakta #sözmühendisi #kısasözler #icsesiniogren #coronavirus
2231597569633794239; 0; False; 1580247182; Tengo la corona virus yo :zany_face::zany_face::zany_face: #coronavirus #purapinchecorona #ChingaSuMadre #kerrvilletx
2231597531757699963; 4; False; 1580247180; #ElMundoHOY El gobernador de este estado, donde reside cerca de un millón de dominicanos, informó este lunes que de nueve personas enviadas a los Centros para el Control y la Prevención de Enfermedades (CDC) cinco son sospechosas de estar contagiadas por la mortal enfermedad #coronavirus. (Busque la noticia completa en el link de la bio) #PeriódicoHOY
2231597543746062802; 2; False; 1580247179; Santa Catarina NÃO tem casos do novo coronavírus, mas o estado já está preparado para atender e identificar casos suspeitos. ⠀ ATENÇÃO para as medidas de prevenção: :heavy_check_mark: lavar as mãos com água e sabão com frequência :heavy_check_mark: evitar tocar os olhos, nariz e boca com as mãos não lavadas :heavy_check_mark: evitar contato próximo com pessoas doentes :heavy_check_mark: ficar em casa quando estiver doente :heavy_check_mark: cobrir a boca e o nariz ao tossir ou espirrar com um lenço de papel e jogar no lixo :heavy_check_mark: limpar e desinfetar objetos e superfícies tocados com frequência ⠀ RECOMENDAÇÕES: :heavy_check_mark: Evitar viagens à China :heavy_check_mark: Pessoas que viajaram nos últimos 14 dias para China devem ficar atentas a sintomas como febre, tosse e dificuldade para respirar. ⠀ ⠀ Saiba mais: www.dive.sc.gov.br ⠀ #CoronaVirus #Prevencao #SaudeSC #DiveSC #governosc
2231597478298715295; 4; False; 1580247171; Etiqueten cabrossssss :face_with_tears_of_joy: ~ RG Migraña - Síguenos para mas contenido :green_heart: - - - - #memesdaily #elgoth #meme #memesgraciosos #memesenespañol #memesespañol #memes:face_with_tears_of_joy: #memes #goth #siguemeytesigo #gothjaidefinichon #chileanmemes #jaidefinichongoth #china #coronavirus #gatitos #kakarot #dylantero #instagram #instamemes
2231597445824360193; 0; False; 1580247167; #oe #andes #besando #cualquier #piensa #virus #coronavirus #llego #peru #larica #chicha #peruana
2231160786559224796; 0; False; 1580247161; Panic spreads in Wuhan, China #CoronaVirus
2231597322270493883; 0; False; 1580247153; #Repost @hcphtx with @get_repost ・・・ #Prevention matters. Although there have been no confirmed cases of #coronavirus #nCoV in our community, we are still in #fluseason. As a reminder, we recommend everyday #preventative actions to help avoid the spread of #respiratory viruses. Stay #healthy& keep your family safe.
2231597240674630728; 3; False; 1580247143; Safety first people, the Coronavirus is legit. #coronavirus #wutangclan #putalimeinit #alcohol #hightemps #sweatitout #wecanhelpyou #getsome
2231597234340587184; 3; False; 1580247142; My iconic bag in spain 1:Spain: • • • • • • #spain #spain:Spain: #spaintravel #espagne:Spain: #espana #es #espagnol #españa:Spain: #plazadeespaña #plazadeespana #giralda #kobebryant #kobe #nba #corona #coronavirus #spaingram #myiconicbag #ismybag #yourfavoritebagstore #moulaga #grossemoula #travel #travelphotography #travelgram #paysage #paysagemagnifique #viajar #paisaje #voyage
2231597079661386035; 0; False; 1580247140; Too many people dyin lately man #cancerousmemes #offensivememes #gay #relateable #coronavirus #corona #relatablememes #stolenmemes #china #stolenmemesforstolenkids #offensivememes:sweat_droplets::eyes::hundred_points::face_with_tears_of_joy::face_with_tears_of_joy::gem_stone::fire::face_with_steam_from_nose::sweat_droplets::OK_hand::hundred_points::face_with_tears_of_joy::folded_hands::face_with_tears_of_joy::face_with_tears_of_joy::gem_stone::gem_stone::fire::face_with_steam_from_nose::sweat_droplets::eyes::eyes: #dankmemes #meme #pronouncingthingsincorrectly #jetfuelcantmeltsteelbeams #lmao #tiktoksexy #tiktokmemes #twittermemes#twitterquotes #redditmemes #gaming
2231597209315688355; 0; False; 1580247139; :face_with_tears_of_joy::face_with_tears_of_joy::face_with_tears_of_joy: #particka #richardgenzer #michalsuchanek #igorchmela #michalnovotny #mariancurko #ludekstanek #party : #babybox #psinoha #coronavirus #laugh #familytime
2231597185309194856; 68; False; 1580247136; EN ESTADO CRÍTICO En esas condiciones se encuentra el paciente asiático sospechoso de portar #coronavirus en Quito - Ecuador. @teleamazonasec
2231597141879767269; 0; False; 1580247131; Tenias idea de todos los beneficios que tan solo la crema antibacterial puede llegar a hacer?! :clapping_hands_medium_skin_tone::face_screaming_in_fear: es espectacular! 100% natural , sin alcohol, libre de parabenos :smiling_face: #seytu #seytucosmética #seytú_ecuador #gel #antibacterial #lubricante #barros #germenes #coronavirus #gelantibacterial #virus #gripe #protección #natural #cosmeticanatural
2231597109684236300; 0; False; 1580247127; Just to keep things in perspective with the #coronavirus. So far the good old American #flu has killed more people this season. :flushed_face::flushed_face::flushed_face:
2231595779402220844; 1; False; 1580247116; DESESPERACIÓN . Así se encuentra la frontera terrestre de #HongKong luego que las autoridades anunciaran que algunas de sus fronteras con China continental, donde se originó el brote de #Coronavirus, serán cerradas temporalmente y limitará la entrada de visitantes procedentes de allí. . Ante esta medida, se van a suspender, de forma temporal, el servicio de trenes, varios ferries y algunos vuelos serán cancelados. . Cortesía: @miamidiario . #Desesperación #Coronavirus #China #chamoenchilecl #venezolanosenelexilio #venezolanosporelmundo #venezolanosxelmundo #venezolanosenhouston #venezolanosenfrancia #venezolanosenespaña #venezolanosenchile #venezolanoenelexterior #venezolanosenecuador #venezolanosenmiami #venezolanosenperu #venezolanosenargentina #venezolanoseneldoral #venezolanosenmexico #venezolanosencolombia #venezolanosenmadrid #venezolanosencostarica #Venezolanoseneuropa #venezolanosencostarica #Viral #videoviral #Venezuela #caracas #venezuelalucha #usa #EEUU
2231596192918705774; 0; False; 1580247114; Le coronavirus il arrive a Paris Faites vos dernières courses à Carrefour :face_with_tears_of_joy::face_with_tears_of_joy::face_with_tears_of_joy: #humour #fail #bledard #blédard #lmao #funnyvideos #funny #love #video #instagood #tweet #tweetdrole #videodrole #drole #paris #dehka #dz #maroc #tunisie #algerie #marrant #ptdr #dehkarebeu #coronavirus #france #french
2231596982195375844; 5; False; 1580247112; Esto se va a poner feo... #coronavirus #residentevil
2231596966786314598; 0; False; 1580247110; Swipe et tabonne-toi - - - - - - - - - - - #coronavirus #china #hôpital #bactérie #virus #europe #info #santé #clamerde #like #mdr #drole #lol
2231596844252115007; 7; False; 1580247109; I say we deport him back to China #cancerousmemes #offensivememes #gay #relateable #coronavirus #corona #relatablememes #stolenmemes #china #stolenmemesforstolenkids #offensivememes:sweat_droplets::eyes::hundred_points::face_with_tears_of_joy::face_with_tears_of_joy::gem_stone::fire::face_with_steam_from_nose::sweat_droplets::OK_hand::hundred_points::face_with_tears_of_joy::folded_hands::face_with_tears_of_joy::face_with_tears_of_joy::gem_stone::gem_stone::fire::face_with_steam_from_nose::sweat_droplets::eyes::eyes: #dankmemes #meme #pronouncingthingsincorrectly #jetfuelcantmeltsteelbeams #lmao #tiktoksexy #tiktokmemes #twittermemes#twitterquotes #redditmemes #gaming
2231596940898166848; 0; False; 1580247107; :cyclone::takeout_box:woof woof and meow meow:cyclone: •⁣ Send this to a friend:cyclone: •⁣ •⁣ #meme #memes #ps4 #wshh #hood #coronavirus #funny #xbox #dankmemes #offensivememes #edgymemes #spicymemes #69 #memepage #gaming #dank #memesdaily #shitpost #dankmeme420 #hiphop #witcher #worldstar #grapejuiceboys #playstation #worldwar3 #sexy #corona #weed #reddit #420
2231596940804694308; 0; False; 1580247107; Kenali tanda dan gejala virus Corona #apotekplasma #coronavirus #gejalacoronavirus
2231596928584432970; 0; False; 1580247106; Aereo mezzo vuoto, alcuni passeggeri con mascherine, ogni starnuto uno sgomento generale, in più turbolenze e vuoti d'aria violenti e io..... bevo. Cin :clinking_glasses: #fuckit #travel #coronavirus #wine #Britishairways
2231596905187853818; 0; False; 1580247103; Yo aquí alimentándo mi estres psicosomático... :face_with_medical_mask: #coronavirus #france24 #noticias #psicosomatico #estresado #life #findelmundo #elsalvador #tayuca #miedo
2231595990586850376; 201; False; 1580247091; #coronavirus #coronavirusmemes
2231596777639520271; 1; False; 1580247088; Santa Catarina NÃO tem casos do novo coronavírus, mas o estado já está preparado para atender e identificar casos suspeitos. ⠀ ATENÇÃO para as medidas de prevenção: :heavy_check_mark: lavar as mãos com água e sabão com frequência :heavy_check_mark: evitar tocar os olhos, nariz e boca com as mãos não lavadas :heavy_check_mark: evitar contato próximo com pessoas doentes :heavy_check_mark: ficar em casa quando estiver doente :heavy_check_mark: cobrir a boca e o nariz ao tossir ou espirrar com um lenço de papel e jogar no lixo :heavy_check_mark: limpar e desinfetar objetos e superfícies tocados com frequência ⠀ Saiba mais: www.dive.sc.gov.br ⠀ #CoronaVirus #Prevencao #SaudeSC #DiveSC #GovernoSC
2231596760105591640; 0; False; 1580247086; #coronavirus or #kobe got you down? Well laughter is the best medicine so come down to the @americancomedyco #tonight for the GREAT Gaslamp Open Mic This is the only mic where if you kill it you could be opening for nationally known headliners on the weekend!!! #showtime 8pm #freeshow $5 #HappyHour #allnight #raffle #tickets to #preform given 7 to 730 #sandiego #socal #sandiegoevents #sandiegoshows #thingtodoinsandiego #funny #standup #Comedy #live #liveart
2231596758244552046; 0; False; 1580247085; I found the #coronavirus cure #dietarylaws #cure
2231596744612194645; 0; False; 1580247084; #coronavirus
2231596740410550421; 1; False; 1580247083; Just in time for the #coronavirus epidemic, my @katsubot balaclava arrives direct from #Moscow via @a_d_e_d_
2231596729730761322; 0; False; 1580247082; Parece até que a gente já viveu 3 meses apenas em janeiro... . . . #kobebryant #coronavirus #3guerramundial #enem2020
2231596656707712641; 0; False; 1580247073; Issue #150 of Market Pulse is here! Health and wealth are intrinsically linked in this issue as Jeff looks at how a viral outbreak in China affects markets, and people, all over the world. ⁣ ⁣ Read the full article on our LinkedIn: Mortgage Solutions Financial⁣ ⁣ #politics #economy #finance #coronavirus #china #globalmarkets #marketnews #financenews #economics #health #wealth #virus #largeeconomy #chineseeconomy #sharemarket #stockmarket #dow #fomc #chinagdp #forecasting #economicforecast #msfmarketpulse #mortgagesolutionsfinancial
2231596414421305892; 4; False; 1580247071; Uno de los infectados por el Coronavirus de Wuhan intenta escapar partiendo el vidrio donde había sido aislado para más estudios #28Ene . . . . . . . . . . . . . . #noticias #coronavirus #donaldtrump #virus #latierra #wuhan #venezuelalibre:Venezuela: #jguaido #oscarpérez #venezuelalibreysoberana #venezuelalamejor #venezuelasindictadura #venezolanosenusa #venezolanosarrechos #venezolanosenlima:yellow_heart::blue_heart::red_heart: #venezolanosenmiami #venezolanosenpanama #oscarperezsomostodos #caracas #venezolanosenmadrid #sancristobal #sisepuede #venezolanosenespaña #barinas #maracay #maracaibo #maduroconoetumadre
2231466627061594144; 1; False; 1580231572; Jurgo! :face_with_hand_over_mouth::face_with_hand_over_mouth::face_with_hand_over_mouth: . #EnamorateDeSanJuanNepo :smiling_face_with_heart-eyes: :camera_with_flash: @qnota_online :globe_showing_Americas: El Nepo . #RetratosDeMiPueblo #SoySanjuanero #CeroPoliticaPorFavor #YoTeMuestroSanJuanNepo #CostumbresDeMiPueblo #SanJuanNepoSomosTodos . . #Enero #AñoNuevo #SanJuanNepomuceno #MontesDeMaria #Travel #Colombia #colombiatravel #photography #pueblitoscolombianos #IDSanjuanera #coronavirus #SoySanjuaneroStore #pueblo #colombiagrafia #LosColorados #IDcaribe #meme #Resiliencia #LaGenteDelPueblo #CasitasDelNepo #SoyDePuebloSoyDeSanJuanNepo #Dios
2231442503655465417; 4; False; 1580228697; YAAAAAS PREACH I LOVE KOBE TOO BUT YALL SOOOO DISTRACTED RN! THEY KNOW WHAT THEYRE DOING. WAKE UP OR DIE IN YOUR SLEEP FOLLOWING YOUR AMERICAN DREAM #RIP #Kobe #BlackMamba #WakeUp #Senate #Coronavirus #corona #impeach #trump #2020 #depopulation
2231410971147460933; 0; False; 1580225113; AAAAAAAAAAAAAAAAAAAAAAAA!!! . . . . . . . . . . . . . .. . . . . . . . . . . . . . . . . . . #DANKMEME #shitpost #meme #momo #momoz #momos #jaidefinichon #goth #anime #shitposting #otaku #laweachistosa #coronavirus
2231364542876142527; 0; True; 1580219403; Le coronavirus: - Virus dangereux qui a déjà fait 100 mots en Chine. - Plus de quinze villes je crois en quarantaine - Les gens ont peurs, ils sont tristes Et vous, oui je parle bien de VOUS je pense que certains/certaines vont se reconnaître. Cette situation, n’est pas des plus simple, cette situation est délicate pour tout le monde. Et des gens ne pensent qu’à pointer du doigt ! Le racisme contre les chinois est présent. Pourquoi ? Pourquoi ? Juste parce qu’une personne l’as dit. Je vous applaudis vous être tous des moutons. Cependant je ne vous juge, non je ne vous juge je constate. Oui, je constate juste que l’être humain est d’une bêtise, d’une connerie. Dès que quelque chose ne va pas il faut pointer du doigt, il faut haïr alors que non il faut soutenir ! Je ne crois pas savoir que le fait de haïr, harceler est changer quelque chose, parfois il faut juste apprendre à se tenir tranquille. Sachez qu’insulter quelqu’un ne fait pas de vous une personne plus forte ou autre , non ça fait juste de vous une personne de plus qui se cache derrière ses mots violents. #chine #coronavirusfrance #coronavirus #racisme #soutien #Theworld #monde #jenesuispaslevirus #liberté #mort #moral #humain #jenesuispasunvirus #coronavirus2020
2230973846857396254; 0; False; 1580172829; #selfridgeslondon your #windowdisplay looks remarkably like the #coronavirus Great timing! :)
2230343815537271985; 4; False; 1580097723; #sureis
2229269603657681624; 0; False; 1579969715; Coronavirus... #coronavirus #china #lamonalista
2231596587738964341; 0; False; 1580247065; #Repost @hcphtx with @get_repost ・・・ Although there have been no confirmed cases of #coronavirus in our community, we are still in #fluseason. As a reminder, we recommend everyday preventative actions to help avoid the spread of respiratory viruses. Stay healthy and keep your family safe . For information and updates, continue to visit our #coronavirus page www.hcphtx.org/nCoV link in bio too!
2231596538134691794; 135; False; 1580247059; :warning:WARNING GRAPHIC IMAGES:warning: Please share this URGENT post about the coronavirus epidemic with your followers as the origin of the virus has been traced to the zone of the Wuhan market where live wild animals like snakes, rats, bats and monkeys were traded before China instituted a temporary ban yesterday. But a temporary ban is NOT enough, WE MUST use our social media platforms to spread awareness and BAN WILD ANIMAL TRADING WORLDWIDE as this is EXACTLY what caused the SARS virus that killed nearly 800 people in 2003! SARS was 17 years ago and yet these markets are doing the exact same thing, selling live wild animals in unhygienic conditions that create diseases with devastating consequences for the entire human race! This new virus, which has no vaccine, has killed 82 people with 2,887 confirmed cases in 15 countries, numbers which have increased 50% SINCE YESTERDAY and 60 million more people are on lockdown to prevent further spreading. To stay updated in real-time our US followers can now text us at 323-310-1679 and also follow @planetaverdeoficiall on Instagram too. Please pray for the world and share this URGENT post with your followers and tag people, celebrities, influencers and news media that need to see this and let’s work together to PERMANENTLY ban the trading of wild animals that create these deadly viruses! #coronavirus #endanimalcruelty#coronavirusoutbreak #karmagawa
2231596530042088329; 0; False; 1580247058; Corona virüsünün yayıldığı bölgeler #coronavirus
2231596503616775262; 182; False; 1580247055; Ginés González García, el ministro de Salud de la Nación, sobre el coronavirus: "Hoy el riesgo en Argentina es lejano" | . . . #argentina #coronavirus
2231596487780171240; 1; False; 1580247053; Molim?? Ha?? . . #coronavirus
2231596469465784464; 0; False; 1580247051; Oh no el #coronavirus :rolling_on_the_floor_laughing::rolling_on_the_floor_laughing::face_with_tears_of_joy::rolling_on_the_floor_laughing::rolling_on_the_floor_laughing: #coronavirusmemes @coronavirusmemes @memes.coronavirus #memesespañol #memesgraciosos @memeroslatinos @originalmemeflix @memeroskings @memesdecolombiaoficial @memesscolombianoss @memecolombianos @memes_colombia_pagina_oficial
2231596182224638682; 0; False; 1580247048; #blairwitch #blairwitchproject #coronavirus c'était moi !! #maladie #enrhumée #coronavirusoutbreak #onvatouscrever #dead #bad
2231596435768379064; 2; False; 1580247047; Another YYZ:right_arrow:LGA... This time, with a sick passenger who was taken off the plane on a stretcher to an awaiting ambulance. Yikes :microbe: :face_with_medical_mask:. . . . . . . . . #nyc #newyorkcity #lga #yyz #toronto #aircanada #coronavirus
2231596413748719349; 1; False; 1580247044; I'm feeling so lost by all the bad news happening recently. I cant even talk about Kobe and I'm so devastated hearing about what is happening with the coronavirus and concerned over how much worse it could get... What is also extremely concerning, are some of the comments coming from young people regarding this virus. :hushed_face: I'm hearing racists remarks, inappropriate jokes and hurtful comments. :pensive_face: Are you noticing the same? Goodness forbid anyone sneezes or coughs right now... So I'm sharing a free lesson for you to help teach students not only the facts about the virus, but also what is an appropriate reaction and how empathy and kindness is what is needed most right now. :purple_heart: I urge you to watch the videos on slide 9 first to make sure they're appropriate for your kids. It's pretty sad to see the things some kids are saying right now. :weary_face: All the text is editable in case you need to change anything too! Hope this helps if you choose to use it in your classroom or assembly. #coronavirus #coronaviruslesson #lifeskills #iteachteens #iteachtoo #teacherlife #teachersfollowteachers #teachersresourceforce #teachersofinsta #teachersofthegram #teachersrock #charactereducation #teachingempathy #tacklingracism #schoolassembly #wuhancoronavirus #iteachsecondary #iteachhighschool #iteachmiddleschool
2231596396333691680; 3; False; 1580247042; What are your thoughts on the backlash of this virus? #unlearn #coronavirus #CoronaVirusCanada #coronarvirues #besafe #toronto #ontario #canada
2231596297022740467; 0; False; 1580247041; Así es la construcción de un hospital para tratar a los pacientes con el coronavirus en China Ya se completó y en un tiempo récord la construcción en Wuhan del hospital Huoshenshan para tratar a los pacientes infectados con el coronavirus. En el vide tomado de #RT muestra la construcción del hospital prefabricado que tendrá capacidad para aproximadamente 1.000 pacientes y dispondrá de un centro de cuarentena. Recordemos que la ciudad es el epicentro del brote de coronavirus que ha causado 81 muertes e infectado a más de 2.800 personas en China, y del que se han detectado casos en más de una decena de países. #NoticiasPorElMedio #Coronavirus #RT #Virus #Salud #Infección #Muerte #China #Huoshenshan #Hospital #Martes
2231596287451205745; 1; False; 1580247038; Cuando anuncian que el #coronavirus ha llegado a tu ciudad :weary_face:
2231596307239639289; 0; False; 1580247037; Had to do it •⁣ Send this to a friend:cyclone: •⁣ •⁣ #meme #memes #ps4 #wshh #hood #coronavirus #funny #xbox #dankmemes #offensivememes #edgymemes #spicymemes #69 #memepage #gaming #dank #memesdaily #shitpost #dankmeme420 #hiphop #witcher #worldstar #grapejuiceboys #playstation #worldwar3 #sexy #corona #weed #reddit #420
2231596142763024613; 0; False; 1580247021; Corona virus #funny #lmao #edgymemes #dank #memes #edgy #dankmemes #lmao #china #coronavirus
2231596216542381011; 0; False; 1580247021; Ooooh hell nooo! #coronavirus #hellnaw
2231596197559008410; 0; False; 1580247021; SUMAN 106 MUERTOS POR CORONAVIRUS EN CHINA #Coronavirus #Muertos #China (Excelsior) China reportó que el número de muertos por el nuevo coronavirus aumentó a 106. Asimismo, las autoridades chinas reportan casi 1,300 nuevos casos confirmados. Las autoridades sanitarias de la provincia de Hubei (centro), donde comenzó la epidemia, afirmaron que el virus había causado 24 muertos más e infectado a otras 1,291 personas, lo que eleva el número de pacientes confirmados a más de 4,000 en toda China.
2231595362228119852; 0; False; 1580247008; Prezident koronavirusla bağlı tapşırıqlar verdi. #Dünya #China #Crisis #Coronavirus #azerbaijan #baku #haber #xeber #january #autolike #takipleş #gainwithmchina#takipçikazan #sigodevolta# # #chuva #sdv#geritakip # #cekilis #chuvadelikes30k#aktiv #beğeni #takipet #sdvtodos #aztagram#seguesigodevolta #followtrick #gaintrick #now
2231595456634688658; 58; False; 1580246990; "Diren Vuhan!": Koronavirüs salgını nedeniyle karantina altındaki Çin kentinde halk birlik oldu. Sesler bile ürpertici :exclamation_mark: #vuhan #Coronavirus #corona #china #çin #people #halk #world
2231595951647696335; 9; False; 1580246989; حقيقة تسجيل إصابات بـ #فيروس_كورونا في #ليبيا #coronavirusoutbreak #coronavirus #218TV
2231595919753069098; 1; False; 1580246985; Jesus. #WorldWarIII #WorldWar3 #AustraliaOnFire #AustraliaFires #CoronaVirus #WuhanVirus #BadCompany #KeichoNijimura #MagiciansRed #MuhammadAvdol #PurpleHaze #FugoPannacotta #JoJosBizarreAdventure #JoJoNoKimyōNaBōken #JoJosBizarreAdventureDiamondIsUnbreakable #JoJosBizarreAdventureStardustCrusaders #JoJosBizarreAdventureVentoAureo #JoJoNoKimyōNaBōkenDaiyamondoWaKudakenai #JoJoNoKimyōNaBōkenSutādasutoKuruseidāsu #JoJoNoKimyōNaBōkenО̄gonNoKaze
2231595792287028050; 0; False; 1580246984; #Repost @plentyofshade (@get_repost) ・・・ Y'all be careful with the #CoronaVirus...:face_with_medical_mask: (#KawhiLeonard memes)
2231595831185900724; 1; False; 1580246975; Sos inmune a todo!! #coronavirus #frases #insecticida #virus #bichos #cumbia
2231593795531860427; 0; False; 1580246966; #Repost @bbcmundo (@get_repost) ・・・ El gigante asiático quiere detener como sea la rápida expansión del coronavirus que ya ha matado más de 80 personas. La semana pasada tomó la medida de poner en cuarentena varias ciudades y ahora construye nuevos hospitales a toda velocidad. Lo hace para aislar y alojar los casos infectados. Se espera que el primero de ellos esté terminado el 1 de febrero. #coronavirus #bbcmundo #China #hospitales #salud
2231595685316477496; 0; False; 1580246965; Sinkholes after earthquake in Jamaica and Cuba #earthquake #jamaica #cuba #caymanislands #coronavirus #wuhan #china #amazing #turkey #storm #duststorm #explosion #attack #gun #fire #blast #bomb #sea #water #animals #news #world #incident #viral #trending #watch #food #fashion #photo #today
2231589069516084769; 0; False; 1580246949; Para las personas que no saben lo que es el CORONAVIRUS・・・ #Repost @marko ・・・ Menciona a toda tu familia 1 Dale repost, mientras más personas sepan mejor 2 Énvialo a tus grupos de Wsp 3 #coronavirus
2231595565987509437; 1; False; 1580246943; I wasn't gonna post again today... buuuut THAT face!!! :pleading_face::pleading_face: @french_0310 :folded_hands::folded_hands: #dragodaboss be safe furfriends!!! . . . #frenchiepuppy #puppy #frenchbulldog #frenchbulldogsofinstagram #frenchbulldoglife #thefrenchiepost #doglover #frenchiesociety #coronavirus #bulldog #frenchieoftheday #bluefrenchie #frenchies #puppies #frenchbulldogstagram #dailyfrenchie #frenchbulldoglovers #puppylove #frenchiesoverload #frenchie #frenchie #frenchbulldogs #wasyourhands #dogsofinstagram #frenchielife #french #frenchielove #frenchiepup #frenchbulldogpuppies #frenchiesofinstagram
2231595348009166988; 0; False; 1580246942; Que se queden en China o que lo traigan? ¿Que opinan? - - - - #eljevitotv #coronavirus #china
2231595501094728928; 69; False; 1580246935; O Ministério da Saúde confirmou a investigação de um caso suspeito de coronavírus no Rio Grande do Sul. O paciente em análise é um homem que mora na China e veio visitar parentes em São Leopoldo no dia 24 de janeiro. Os sintomas relatados foram febre e insuficiência respiratória, que estão entre os sinais provocados pela doença. Saiba mais no link da bio. . . :camera_with_flash: Roslan Rahman | AFP
2231595478829642867; 1; False; 1580246933; ‪Artificiële Intelligentie waarschuwde als eerste voor het coronavirus uit Wuhan. Hoe dat kan, lees je via de link in bio of copy/paste dit: https://wp.me/p9ywxK-18T‬
2231595454963914782; 862; False; 1580246930; El coronavirus de Wuhan, China :face_with_medical_mask::globe_showing_Europe-Africa: Si no has estado al tanto de lo ocurrido en la última semana, estos son los datos más recientes: #coronavirus #wuhan #china #salud #virus
2231595358706491350; 7; False; 1580246918; #cmonamiright . . . @lepetersworld They always find a new distraction lmao #FakeNews #Parkour Credit: :backhand_index_pointing_right_medium_skin_tone: @road2consciousness :face_with_tears_of_joy: Check out my Friends... :loudspeaker: @truth_speakers2017 @naturalworldorder @vegantierraplana @terraplanetruth For our Plane(t) :globe_showing_Americas: :raised_fist_medium_skin_tone: #hollyweird #weird #conspiracy #mindcontrol #xfiles #kanyewest #ww3 #mkultra #sheeple #wisdom #knowledge #awakening #conscious #nwo #newworldorder #illuminati #tv #chemtrails #flatearth #occult #instagram #strange #celebrity #celebrities #dumb #coronavirus #collectiveconsciousness
2231594464993260720; 0; False; 1580246917; being a passenger during the coronavirus outbreak be like.. :face_with_medical_mask: #coronavirus #wuhan #china #bats #batsofinstagram #cooking #foodie #foodporn #funnymemes #memes #chinesefood #wheninrome #wuhanflu #chineseflu #virus #contagion #news #dankmemes #memesdaily #memes:face_with_tears_of_joy: #memesquad #crewlife #chinese #chinesenewyear #lol #airplane #passenger #airline
2231595239074942029; 0; False; 1580246904; It’s one of our discussion on Epic Convo today. So we all agree that prevention is better than cure. Always remember that the greatest wealth is health. Stay healthy, everyone :) • • Source : CBC News #coronavirus#preventionisbetterthancure#stayhealthy#healthylifestyle#healthy#epicenglish#englishforadults#epicinspiration#inspirational#englishcoursejakarta#privateinggrisjakarta#epicconvo#commontopics#corona#besafe#behealthy#healthquotes#healthquote#inspirationalquotes#cbcnews :)
2231595188130838865; 0; False; 1580246898; Hati-hati nih.. di patok corona:beaming_face_with_smiling_eyes: . Tetap Jaga Kebersihan dan Selalu Makan-Makanan Sehat Bergizi yaa Kawan.. . #cegahwabah #coronavirus #ksrunwahas #pmijateng #pmiindonesia
2231594771444688687; 0; False; 1580246896; #meme #memes #memesquad #memesdaily #memes:face_with_tears_of_joy: #coronavirus
2231595122046116017; 0; False; 1580246890; I'm here #coronavirus#china#canada#france#germany:Germany:#southcorea#usa#likeforlikes#like4likes#followforfollowback
2231595106637286047; 0; False; 1580246888; 7- Çin'in Wuhan kentinde tanımlanamayan virüs dünya çapında paniğe yol açtı. Bulaştığı kişilerde akciğer rahatsızlıklarına yol açan ve şimdiden dört farklı ülkeye de yayılmış durumda olan virüs sebebiyle çok sayıda insan hayatını kaybetti. Dünya Sağlık Örgütü ise dünya çapında daha çok vakanın görüleceğini kaydetti. #coronavirus #2020 #dünya #sondakika #breakingnews #cursed #virus #world
2231595095153422498; 0; False; 1580246887; #coronavirus #virus #wuan #flu #usa #eu #europe #uk #germany #russia #turkey
2231595083962928336; 2; False; 1580246886; Discuss in the comments: . . . . . . . . . . . . . . . . . . . . #meme #memes #funny #dankmemes #lol #memesdaily #funnymemes #dank #virus #draft #horror #lmao #dankmeme #worldwar3 #drafted #edgymemes #humor #comedy #edgy #offensivememes #fun #plagueinc #cringe #coronavirus #art #plague #offensive #ww3 #minecraftmemes #minecraft
2231595058461426612; 0; False; 1580246883; #virus #corona #coronavirus #patent #wakeup #donttrustgovernment #pharmacy #pharma #makes #money #impfen #impfung #ruft #impflicht #panik #sos #panikmache #angst #geschäftsmodell #politik #kapitalismus #wirtschaft #awake
2231595023917374581; 0; False; 1580246879; She sat down AND THEN SLOWLY put on the mask. I coughed and she swiftly jerked away from me. I am not sick, I was just half clearing my throat. This lady really has some paranoia going down. . . . #paranoia #paranoidmuch #facemask #imnotcontagious #coronavirus #traincommute #metrotrains #pakenhamline
2231595008197592338; 1; False; 1580246877; This is most definitely the sad part . Dont mean to shit on anyone's funeral but there goes the truth strolling around. Thankful for people who see the whole bigger picture, not just a few colors. :raised_fist::raised_fist::raised_fist::raised_fist: Stand up for world peace and understanding. #nomorechemtrails #swipeitforward #ftp #forthepeople #ripkobebryant #kobebryant #geoengineering #warcasulties #ripmiddleeast #coronavirus #bioweapons #picoftheday
2231593024365021520; 0; False; 1580246875; ARKADAŞLARINIZI ETİKETLEYİN İNSANLARIN BİLİNÇLENMESİNE VESİLE OLUN :bust_in_silhouette: . . . . . #deprem#depremelazig#afad#umke#depremanındaneyapmalıyız#allah#dua#alim#saidnursi#sözler#sözlerköşkü#ömürdediğin#hayalhanemmersin#hayalhanemistanbul#çınaraltı#uhreistanbul#maksat114#keremönder#nureddinyıldız#cübbeliahmethoca#timurtaşhoca#huzmedeyiz#leylihulasa#esmaülhüsna#zikir#elbari#coronavirus#develerkatledildi
2231594982710619154; 0; False; 1580246874; #meme #gracioso #coronavirus #cerveza #beer #funny #lol #alcohol #corona #divertido
2231594503201285793; 0; False; 1580246868; #coronavirus #corona 14yy 'da Avrupa Nüfusunun yarısını ve Dünya Nüfusunun üçte birini öldüren #KaraÖlüm #BlackDeath diye adlandırılan #Veba salgınının, Corona Virüsünün yayılmaya başladığı aynı bölgeden başladığını ve dönemin ticaret yollarıyla Avrupaya gelerek her iki insandan birinin ölümüne neden olduğunu biliyor muydunuz? Do you know that the black death which disease killed almost one third of the earth population started from the same area where the corona virus spreaded.
2231594925015579105; 0; False; 1580246867; Do you think it's similar to the Black Death Plague?:thinking_face: - #follow4follow #l4l #followforfollow #fff #f4f #instalike #instalikesandfollowers4u #cute #tbt #like4like #followme #instagood #photography #photooftheday #likeforlike #love #instadaily #followback #lfl #picoftheday #germany #infection #coronavirus #virus #bavaria #confirmed #case #wuhan #china
2231594882963658289; 0; False; 1580246862; #coronavirus
2231594871655163973; 0; False; 1580246860; Haha :p:face_with_tears_of_joy::face_with_tears_of_joy: #lol #lmao #funny #meme #crona #coronavirus #china #chinavirus #virusmemes #introverts #oop #follow #me @random_af_memes____ #for #dailymemes #memesdaily #wholesomememes #funnymemes #dankmemes #allmemes #weirdmemes #relatablememes #foodmemes #retardedmemes #dirtymemes and
2231594286768405573; 1; False; 1580246860; Prezident koronavirusla bağlı tapşırıqlar verdi. #Dünya #China #Crisis #Coronavirus #azerbaijan #baku #haber #xeber #january #autolike #takipleş #gainwithmchina#takipçikazan #sigodevolta# # #chuva #sdv#geritakip # #cekilis #chuvadelikes30k#aktiv #beğeni #takipet #sdvtodos #aztagram#seguesigodevolta #followtrick #gaintrick #now
2231594844483152918; 0; False; 1580246857; When you can't get the corona virus cause you drink cruisers #memes #dankmemes #funnymemes #funny #funnyvideos #funnyshit #meme #twitch #streamer #streaming #fortnite #instagood #followers #coronavirus
2231593997663516875; 0; False; 1580246852; AZZIATA:face_with_medical_mask: . . . . . . . #LIKEFORFOLLOW #like4likes #followforfollowback #likeforfollow #followers #instagood #instagram #likeforlikes #tiktokmemes #tiktok #meme #video #funnyvideos #funny #china #corona #virus #coronavirus
2231594760783328788; 0; False; 1580246847; INFÓRMATE | Te invitamos a conocer más sobre el #Coronavirus y a mantenerte informado por los canales oficiales. No extiendas rumores, aún no existen casos confirmados en Ecuador. #QuitoSaludableOtraVez
2231594664222411839; 0; False; 1580246836; #inter#cinesi#coronavirus#eriksen#calcio#football#cina
2231594586921577833; 0; False; 1580246826; Científicos Chinos publican impactante imagen de un CoronaVirus. :face_with_tears_of_joy: #coronavirus
2231594511079809150; 0; False; 1580246826; Did himself dirty FOLLOW @dottedmuffin . . . . . . . #humor #memesdaily #memes #meme #fun #comedy #funnymemes #asian #student #coronavirus #dailymeme #dailymemes #lol #2020 #bruh #tiktok #dankmemes #dank
2231594544103771772; 0; False; 1580246821; INFÓRMATE | Te invitamos a conocer más sobre el #Coronavirus y a mantenerte informado por los canales oficiales. No extiendas rumores, aún no existen casos confirmados en Ecuador. #QuitoSaludableOtraVez
2231594189678162003; 3; False; 1580246821; Earthquake of 7.7 magnitude hits Jamaica and Cuba #earthquake #jamaica #cuba #coronavirus #wuhan #china #amazing #turkey #storm #duststorm #explosion #attack #gun #fire #blast #bomb #sea #water #animals #news #world #incident #viral #trending #watch #food #fashion #photo #today
2231594529409406634; 0; False; 1580246820; #china#eat#everything#no#travel#sick#lol#no#fuckit#corona#coronavirus
2231594524105382946; 0; False; 1580246819; Frente a los momentos que estamos viviendo en el país, me permito compartirte esta recomendación para mejorar tu sistema inmunológico :winking_face: Adicional recuerda: - Lavarte las manos constantemente. - Utilizar gel desinfectante. - Evitar el contacto con personas infectadas. Mandemos toda nuestra luz :dizzy:y buena energía para todas las personas afectadas, para las autoridades y para los científicos que están buscando la cura para el #coronavirus. Mantengámonos atentos y compartamos información únicamente de canales oficiales. #MaríaGabrielaCoach
2231594501600561385; 0; False; 1580246816; Hoje, terça-feira temos uma quadratura entre a Lua e Marte, e Netuno e Marte. Um dia que pode trazer muita oscilação de humor, períodos tensos, atritos desnecessários. Além disso, a objetividade em relação aos negócios e projetos pode ficar meio lenta e incerta. Netuno em aspecto não muito positivo com Marte pede também que cuidemos do nosso vigor e da nossa saúde. Esse trânsito favorece a dissipação de vírus e doenças. #astrologia #astrology #signos #planetas #horoscopo #coronavirus #mapaastral #marte #netuno #manualdodruidamoderno
2231594427604075428; 0; False; 1580246808; The B.C. Centre for Disease Control said one patient appears to be infected with the newly discovered coronavirus and is currently in isolation at home.⁣ ⁣ The individual is a 40-year-old male who travels to China regularly and was in Wuhan city on his most recent trip, officials said. He lives in the Vancouver Coastal Health region.⁣ ⁣ The man contacted a health-care provider on Jan. 26 to let them known he had travelled to Wuhan and was experiencing symptoms. ⁣ ⁣ That health-care provider gave a diagnostic test, which came back positive on Monday night. ⁣ ⁣ A news release from the ministry of health said, "Regular handwashing, coughing or sneezing into your elbow sleeve, disposing of tissues appropriately and avoiding contact with sick people are important ways to prevent the spread of respiratory illness generally." ⁣ ⁣ Travellers passing through Vancouver International Airport are also being screened when they arrive at the airport, particularly if they've visited Wuhan, China, where the virus is believed to have originated.⁣ ⁣ Source: Alyse Kotyk/CTV News⁣ Image: CNN⁣ ⁣ #coronavirus #vancouvereats #vancouverfoodie #vancouver #vancouverisland #vancouverbc #vancouverphotographer #vancouvernews #vancouverfashion #vancouvermodel #vancouverlife #robson #coronavirusvancouver #downtownvancouver #westend #kitsilano #grousemountain #richmondbc #vancouvernature #vancouverphotography #gastown #whistler #yaletown #coquitlam #cypressmountain #seymourmountain #granvilleisland #northvan #ubc #yvr
2231594030025649148; 0; False; 1580246804; فايروس كورونا المنتشر في الصين . في الفتره الاخيره انتشر الفيروس بصوره كبيره جدا بحيث اصاب الكثير من الناس بهذا الفايروس وادى الى قتل الكثير من الاشخاص ولم يجدوا الاطباء والعلماء علاج لهذا الفايروس الخطير فقد مات حوالي ٩٠ الف شخص بسببه . اكد العلماء ان السبب وراء هذا الفايروس هي المأكولات الحيه التي يتناولها الصينيون بشكل كبير ومنها حساء الخفافيش و اكلهم حيه بعد قتلهم مباشره او اكل كلاب وقطط واخطبوطات بحريه وغيرها . ولقد انتشر الفايروس لأول مره في سوق ووهان في الصين ، الذي هو عباره عن سوق للطيور والكائنات الحيه والكلاب والافاعي المختلفه حين يأكلوهم مباشره بعد قتلهم او يأكلوهن وهم احياء وفايروس كورونا الان ينتشر بشكل كبير وبصوره اسرع لهذا يجب على الاشخاص الوقايه من هذا الفايروس الخطر . نتابع اخبار الصين ونرى ماذا سيحدث وهو سيجدون علاج له ام ماذا ؟ #coronavirus #coronaviruschina
2231594387706727275; 0; False; 1580246803; INFÓRMATE | Te invitamos a conocer más sobre el #Coronavirus y a mantenerte informado por los canales oficiales. No extiendas rumores, aún no existen casos confirmados en Ecuador. #QuitoSaludableOtraVez
2231594385836034396; 0; False; 1580246803; INFÓRMATE | Te invitamos a conocer más sobre el #Coronavirus y a mantenerte informado por los canales oficiales. No extiendas rumores, aún no existen casos confirmados en Ecuador. #QuitoSaludableOtraVez
2231593727867385606; 2; False; 1580246802; Our first cartoon news video is released today....more information about the coronavirus will be updated throughout this week so stay tuned for the latest news... @mallu_news #mallunews#kerela#coronavirus#india#timesofindia
2231591954322700386; 1; False; 1580246798; #Pressplay #batsoup #chinese #government #tvhost #apologize #popular #coronavirus #coronavirusoutbreak #coronavirusmemes #coronaviruschina #tookmeout #iveseenitall #whatyouthink #wouldyoueatit #doyoueatit #nodisrespect #justasking #keysadvice #letstalkaboutit #celebritynewsblogger #celebritynews #thanksforviewing :victory_hand_medium_skin_tone:
2231594320499341507; 1; False; 1580246795; Our customers positive experience is the reason we love doing what we do. safe driving Justin!!!
2231593677938277959; 0; False; 1580246789; (BAŞTAN DİYORUM EĞER BANA ABONE OLMAZSAN SANADA BULAŞIRIM. SONRA SÖYLEMEDİ DEME) çinde takside öksürdükten sonra arabadan atıldı #coronavirus #coronaviña #coronavirus2020 #coronavirusoutbreak
2231594266073524341; 0; False; 1580246788; #coronavirus #corona #virus #lemons #meme #memes #memes_4daysbro
2231594199482906719; 0; False; 1580246780; INFÓRMATE | Te invitamos a conocer más sobre el #Coronavirus y a mantenerte informado por los canales oficiales. No extiendas rumores, aún no existen casos confirmados en Ecuador. #QuitoSaludableOtraVez
2231594188218009771; 2; False; 1580246779; British Columbia confirms first case or Coronavirus. The individual is a 40 year old male who regularly travels to Wuhan, China for work. The individual has isolated himself in his home as he started experiencing symptoms within 24 hours of his return from China. ⠀⠀ ⠀⠀ Follow us :backhand_index_pointing_right_light_skin_tone: @wuhanvirusnews ⠀⠀ ⠀⠀ ⠀⠀ #wuhanvirusnews #coronavirus #coronaviruses #coronavirusoutbreak #coronavirus2020 #wuhan #wuhanchina #china #coronaviruschina #wuhanvirus #outbreak #toronto #canada
2231593877461254915; 0; False; 1580246778; #coronavirus protect yourself, Link in Bio for dust masks. :shopping_bags: Nearly sold out everywhere!
2231594074922328308; 0; False; 1580246765; 6- 6 milyondan fazla hektar alanın yandığı, milyonlarca hayvanın yaşamını yitirdiği Avustralya'daki yangınların ardından bölge sel felaketi, kum fırtınası ve ceviz büyüklüğünde doluyla karşılaştı. #2020 #yangin #kiyamet #coronavirus #cursed #virus #sondakika #breakingnews #dünya
2231594047323254503; 1; False; 1580246762; Learning German isnt that difficult?!:Germany::beer_mug::snowflake::woman_shrugging_light_skin_tone:#PBtravel . . . . . . . . . . . . . . . . . . . . . . . #pritikabhansali #purple #forever21xme #forever21 #hm #forever21india #germany #koln #cologne #europe #travelphotograpghy #travel #wanderlust #worldtraveller #traveller #indian #infian #fashion #blogger #style #followforfollowback #fitness #model #influencer #bolywood #actress #actor #kobe #coronavirus
2231594024464405990; 3; False; 1580246759; Should I have had Tecate instead? #greenvestmemes #callinsick #corona #coronaextra #workmemes #retailmemes #yayday #coronavirus #customersmakemedrink #howispeantmydayoff
2231592975553473639; 16; False; 1580246756; Ye ye * * * * * * * * * * Tags: #memes #explorepage #twitter #dailymemes #lit #memesdaily #cute #repost #fashion #funny #trending #tiktok #life #lmao #rofl #food #edit #relate #coronavirus #savagememes #cringememes #explore #relatable #famous #celebrity #drake #fun #instadaily #twittermemes #kanyewest
2231593945912156691; 0; False; 1580246750; This man deserves our endless respect :red_heart: Dr. Liang Wudong, who was treating patients of corona virus in wuhan, china,gets infected while treating patients and become the first doctor to die from the new Coronavirus. :crying_face: A reminder that while everyone else is trying to avoid it, frontline medical staff are risking their lives to cure it and save others. This is undoubtedly the beauty of this profession. :red_heart: #Coronavirus #medicalprofessional #medicalstaff #treatment #china #wuhan RIP #Doctor
2231593858402410888; 4; False; 1580246747; #coronavirus
2231593881966067663; 3; False; 1580246742; — CORONAVIRUS — . . . :backhand_index_pointing_right_light_skin_tone: Mañana vamos estar entrevistando al Dr. Pablo Scapelatto Médico infectologo Jefe de unidad infectologia del hospital Santojanni . :backhand_index_pointing_right_light_skin_tone:Profesor titular de medicina de la universidad favaloro . :backhand_index_pointing_right_light_skin_tone:Miembro de la sociedad argentina de infectologia . . :face_with_monocle: que es el #coronavirus ? . :face_with_monocle: como se contagia? . :face_with_monocle: Como combatirlo? . . . Si tenes alguna pregunta para hacerle al Dr. podes dejarla acá abajo en los comentarios :backhand_index_pointing_down_light_skin_tone: . . #radio #vozanimal #radiozonica #animalistas #animales
2231593692334724701; 0; False; 1580246731; The #coronavirus, or 2019-nCoV, that first emerged in the city of Wuhan, China has been reported in confirmed cases in mainland China, Hong Kong, Japan, Macao, Singapore, South Korea, Taiwan, Thailand, Vietnam, and the U.S. Our special #EssentialIntelligence includes our analyses and insights on how the coronavirus may impact public health, the global economy, and commodity markets as the situation develops. Link in bio.
2231592432617768915; 1; False; 1580246729; People are collapsing from #coronavirus :exclamation_mark::microbe: • • • #virus #malware #windows #coronavirus #hiv #cybersecurity #bacteria #china #microbiology #hospital #science #wuhan #pediatr #cerrahginekoloq #program #ginekoloq #psixoloq #canli #sunimayalanma #ortoped #ginekoloqcerrah #qadinxestelikleri #erroziya #azerbaijan #urek #baku #travmatolo #xestexana #coronavirusoutbreak
2231593695573144731; 1; False; 1580246720; #futureprovespast #pizzagate #qanon #pizzagateisreal #maga #adrenochrome #wethepeople #draintheswamp #thegreatawakening #patriotsfight #wwg1wga #makespaingreatagain #protejamosalosniños #crimenescontralahumanidad #guerradememes #redpill #nativeamericansfortrump #amishfortrump #teoriadelaconspiracion #impeachment #BlacksForTrump #LatinosForTrump #womenfortrump #qanon8kun #spygate #HisNameWasSethRich #Bilderberg #democrats #coronavirus
2231593522129488243; 0; False; 1580246719; Great expectations #thankunext #coronavirus #who #vhs #camping #sezenaksu #abstractart #endoftheworld #spread #china #eatshit #contagion #h1n1 #plague #cam #billieeilish #ebola #giphy #gifart #corona #2020 #troll
2231593662203390650; 0; False; 1580246716; #coronavirus
2231593595109244125; 0; False; 1580246708; We got em’. #corona #memes #coronavirusmemes #coronavirus #werefucked
2231593453031388196; 2; False; 1580246708; #coronavirus
2231593558132144154; 0; False; 1580246704; Here is the rest of the pic. I didn't realize it had been cropped. What is this?? #coronavirus #wuhancoronavirus #biologicalweapon
2231593475741350696; 0; False; 1580246694; A relaxation exercise, but not sure what it is. Water? Corona virus? #drawing #watercolor #artistsoninstagram #art #water #coronavirus #cotfa #relaxation
2231593399002387239; 0; False; 1580246685; Nos habrá llegado la hora? #emiliodijo #severocanalla #comic #comics #historietas #historietas #tiracomoca #humorgrafico #coronavirus #virus #pandemia #findelmundo #ahorasinosllevóelputas #quiendijomiedo
2231591690376739457; 0; False; 1580246683; Recomendaciones para evitar el contagio y propagación del coronavirus. Evitar contacto con personas contagiadas o portadoras. Lavarse las manos constantemente. Tapar boca y nariz con una manga o pañuelo al estornudar. #TopRealEstate #Inmobiliaria #coronavirus #asesorinmobiliario #salud #instagood #repost
2231593356612606467; 0; False; 1580246680; :red_circle:İsrail'li istihbarat subayı Dany Shoham : Çin'deki virüs gizli silah programına bağlı bir laboratuvarda ortaya çıktı. Çin'de bulunan "Viroloji Enstitüsü" ölümcül virüslerle çalışılabilecek tek yer. @news.fromthere #breakingnews #sondakika #news #coronavirus
2231593337150795371; 0; False; 1580246678; Coverage of the latest Wuhan Coronavirus information has been posted on Earthfiles.com - Now including Johns Hopkins Interactive World Map. https://bit.ly/2O6fMt4 #earthfiles #downwithentropyupwithlight #realearthfiles #lindamoultonhowe #wednesdayswithlmh #realxfiles #aliens #earthfilestruthseekers #highstrangeness #cropcircles #antarctica #fulldisclosurenow #coronavirus
2231593282424873234; 3; False; 1580246671; :skull_and_crossbones: - - - - - - - - - - #memes #dankmemes #photography #corona #coronavirus #virus #viral #memepage #admin #canon #nikon #singersongwriter
2231593249448210882; 2; False; 1580246667; #CountryLawyer... taking #Precautions.. Heading backbto My #PrivateIsland Can't manage the #Coronavirus.. #Earthquake .. #StateOfEmergencies and #ZOSOs happening in Jamaica.. #PrivateIslandLife... to the rescue!!
2231593232060545162; 0; False; 1580246665; Nur noch mit Maske raus gehen:skull: Folgt @2metermann1 für mehr Teilt und Markiert eure Freunde :backhand_index_pointing_down_medium_skin_tone::backhand_index_pointing_down_medium_skin_tone::backhand_index_pointing_down_medium_skin_tone::backhand_index_pointing_down_medium_skin_tone::backhand_index_pointing_down_medium_skin_tone::backhand_index_pointing_down_medium_skin_tone::backhand_index_pointing_down_medium_skin_tone::backhand_index_pointing_down_medium_skin_tone::backhand_index_pointing_down_medium_skin_tone::backhand_index_pointing_down_medium_skin_tone: •••••••••••••••••••••••••••••••• * * * #meme #lustig #Lustigermeme #memes #like #deutschrap #glühwurm #mero #capo #eno #berlinwasgehtab #fortniteworldcup #xatar #capitalbra #samra #dardan #nimo #ufo361 #deutschlandgut #merkel #zuwild #Bayram #eidmubarak #täglicherkontent #berlin #schwarzerhumor #kmn #likeeinfach #coronavirus
2231593187516254764; 0; False; 1580246660; :warning: Consulte con el dentista :tooth: : Las encías enrojecen, se hinchan y sangran con facilidad.:syringe::drop_of_blood: #smile, #dentalfun #puppiesofinstagram #dentallife #dentalclinic #dentalhygienist #orthodontics #dientes #illustrations #design #mograph #artist #2D #artoftheday #digital #digitalart #Framebyframe #dynamics #motion #graphics #animation #coronavirus
2231593142040516207; 32; False; 1580246654; The #communist #Chinese government is keeping the official tally of “infected” coronavirus patients artificially low by limiting the supply of diagnostic testing kits, warns an independent journalist in #China, who leaked the information to The Epoch Times. “The outbreak of #Wuhancoronavirus is far bigger than the official figures released by Chinese public health authorities who cover up the severity by limiting the number of diagnosis kits to #Wuhan hospitals,” reports the independent news publisher: The insider and the independent journalist both say that diagnosis kits are only provided to certain “qualifying hospitals” and in very limited quantities. Medical personnel at these hospitals have said that the number of kits they are supplied is less than 10 percent of what they need to test patients. The means the official numbers from the Chinese government are likely just one-tenth the actual numbers. The current government figures claim 4,607 infected patients in mainland China, but if diagnostic testing kits are being artificially limited to just ten percent of the demand, the real number of infected patients may be something closer to 46,000. Interestingly, a team of researchers from #HongKongUniversity recently announced that, according to their research, at least 44,000 infected patients already exist in China. Further, they estimate the number of cases is doubling roughly every seven days. By early May, they predict China will be seeing 150,000 new cases each day, obviously overwhelming every laboratory, hospital and health care clinic in the entire country. China has already ordered schools closed until March, underscoring the urgency of the effort to try to bring this outbreak under control. Meanwhile, human-to-human transmission has already been observed in #Canada, and now #Taiwan is reporting the same thing. The official Chinese government figures have now reached 4,682 infected, a jump of nearly 50% from the day before. This means that even according to the Chinese government, #coronavirus infections exploded nearly 50% in one day: :hand_with_fingers_splayed_medium-dark_skin_tone:More in comments:backhand_index_pointing_down_medium-dark_skin_tone:
2231592877154502919; 0; False; 1580246638; damn rip #jetfuelcantmeltstealbeams #autismmemes #shitpost #memegod #spicymemes #esketit #pubg #memestar #memester #dank #feminism #offensivememes #nazi #jews #offensivecontent #bleech #dankmemes #niggasbelike #bushdid911whichcausedthecivilwarwhichmadekanyewestsaygeorgebushhatesblackpeople #liltay #memes #edgymemes #memepage #sukablyat #rdr2 #fortnite #picklechinassboy #picklechinahboi #coronavirus
2231589704650552914; 31; False; 1580246637; I got this from tik tok and a girl from Facebook :rolling_on_the_floor_laughing: . . . . . . . . . . . . . . . . . . . . #birdbox #coronavirus #ripkobe #roddyrich #grammys2020 #milklikedess:glass_of_milk: #tattoofordad #like #share #comment #explorepage #ysabelle #likenat #aliya #bitch #meganknees:rolling_on_the_floor_laughing: #beautifuldestinations #funnyvideos #dubsmash #tiktok
2231592942525936484; 1; False; 1580246630; According to the World Health Organization (WHO), coronaviruses are a family of viruses that cause illness ranging from the common cold to more severe diseases such as Middle East Respiratory Syndrome (MERS) and Severe Acute Respiratory Syndrome (SARS).
2231592896876852701; 7; False; 1580246625; Ho ordinato un portafoglio da 50 centesimi cazzo hah #meme #memes #funny #italy #memeita #italia #love #follow #ridere #instagram #memesdaily #risate #lol #like #followme #dank #funnymemes #tumblr #fun #picoftheday #instalike #citazioni #like4like #ridichetipassa #instadailyphotos:camera:instalike:thumbs_up:#virus #corona #coronavirus #wish
2231592793210289501; 0; False; 1580246623; #Repost @jornalbreveoficial (@get_repost) ・・・ #coronavirus #saude https://youtu.be/54t7nqd0b0c
2231592852264451318; 0; False; 1580246620; Breaking bad fans?. . . #meme #memes:face_with_tears_of_joy: #memes #offensivememe #lol #joke #dankmemes #dank #dankmemesdaily #dankmeme #funnymemes #fun #funnymemesdailyposts #dankmemesdailys #dank #memepage #naruto #narutomemes #sasuke #sasukememes #uchiha #wuhan #coronavirus #plagueinc #usvsiran
2231592849271613118; 2; False; 1580246619; Chissà come si scrive Crotone in cinese? . . . #satira #coronavirus #cina #crotone #calabria #pipareddrusjournal
2231586511719941996; 0; False; 1580246611; Corona Virüsünden Sonra sokakta yapılan sosyal deneyde insanların tepkileri :white_heavy_check_mark: #coronavirus #sosyaldeney #youtube #socialexperiment #keşfet #corona #tiktok #deney #tepki #epidemic #冠 #instagram #youtuber
2231592743012828216; 0; False; 1580246607; 6-Afganistan'da Ariana Afgan Havayolları'na ait bir uçağın Gazne bölgesinde düştüğü bildirildi, Kabil'e gittiği belirtilen uçakta kabin ekibi dahil 83 kişinin bulunduğu belirtiliyor. #2020 #kiyamet #sondakika #coronavirus #breakingnews #cursed
2231592719925495083; 6; False; 1580246604; Terminado el dibujo para espacio fanbu por su clase online ayer con @kindness.art en @espaciofanbu participando en el concurso. El concurso tenía que tener mascarilla por el coronavirus, tema de la rata por el año nuevo chino #challenge #añonuevo #añonuevochino #añonuevorata #coronavirus #digitalart #easypainttoolsai #newyear2020 #mask
2231592577446724004; 0; False; 1580246602; Wuhan belediye başkanı Zhou Xianwang : "bahar/yeni yıl tatili oncesi 5 milyon kişi şehirden ayrildi. Geriye kalan 9 milyon kişi ise nerde bilmiyorum, ama şehir bomboş." #coronarvirues #hubei #coronavirus #WuhanCoronovirus #bilgi #bilgiler#gündem #sondakika#haber
2231592031516336041; 0; False; 1580246597; #bbc #coronavirus #coronavirusoutbreak
2231592567135820107; 0; False; 1580246586; #coronavirus #viruscinese
2231592559159073381; 1; False; 1580246585; Bahaha :face_with_tears_of_joy:
2231591460703381793; 65; False; 1580246578; :police_car_light:Господа, Санкт-Петербург держись !!! Все самое интересное в нашем телеграм канале , ссылка в профиле @koronavirus_officiall :police_car_light: #коронавирус #coronavirus #russia #санктпетербург #питер #новости #вирус
2231592491002754587; 0; False; 1580246577; Ministro confirma primeiro caso suspeito de coronavírus no Brasil. O Ministério da Saúde confirmou hoje (28) o primeiro caso suspeito de coronavírus no país e elevou o nível de atenção para alerta de perigo iminente para a presença do vírus no país. De acordo com o ministro da Saúde, Luiz Henrique Mandetta, uma estudante de 22 anos que esteve na China está internada, em Belo Horizonte, em observação. SAIBA MAIS: www.abcagora.com.br #coronavirus #brasil #belohorizonte #chinatown #china
2231592491185151080; 0; False; 1580246577; #investimentos #coronavirus #crise #bovespa #ibovespacaindo #controlederiscos #operevendido #oportunidade #invistaemações #bluechips #ações
2231592301008541746; 0; False; 1580246575; Wuhan'da insanlar sokağa çıkamıyor, ama birbirine balkondan 'DAYAN WUHAN' diyerek destek vermeye çalışıyor. #bilgi #bilgiler#gündem #sondakika#haber #coronavirus #Koronavirüsü
2231590819052453694; 2; False; 1580246573; #Küba #coronavirüsü ne #Aşı bulmasın diye #Amerika #Deprem atıo [TemSili] #youshallnotpass #coronavirus #coronavirusoutbreak #wuhanvirus #wuhanchina #wuhanpneumonia #gandalf #china #blessed #2019ncov물러가 #besmele #şeytan #şeytaniracim @tamtersi
2231590063807062886; 0; False; 1580246565; #corona #coronavirus
2231592255651474143; 0; False; 1580246561; Bit late but funny seeing lenny henry on a vibe . . #uk #brum #ldn #lennyhenry #patternreport #grime #christmas #coronavirus #aitch #ww3 #funnymemes #funny #banter #best
2231592345852612051; 0; False; 1580246559; Pretty sure the watermark shows where I got this from #cancerousmemes #offensivememes #gay #relateable #coronavirus #corona #relatablememes #stolenmemes #china #stolenmemesforstolenkids #offensivememes:sweat_droplets::eyes::hundred_points::face_with_tears_of_joy::face_with_tears_of_joy::gem_stone::fire::face_with_steam_from_nose::sweat_droplets::OK_hand::hundred_points::face_with_tears_of_joy::folded_hands::face_with_tears_of_joy::face_with_tears_of_joy::gem_stone::gem_stone::fire::face_with_steam_from_nose::sweat_droplets::eyes::eyes: #dankmemes #meme #pronouncingthingsincorrectly #jetfuelcantmeltsteelbeams #lmao #tiktoksexy #tiktokmemes #twittermemes#twitterquotes #redditmemes #gaming
2231592333925092201; 1; False; 1580246558; #wuhanvirus #wuhan #governmentcoverup #coronavirus #coronavirusaustralia Interesting Bill Gates FUNDED the bioweapons lab where the virus escaped and the Lab that have recreated the virus to make the vaccine .....very interesting .....
2231592304128800869; 10; False; 1580246554; Live your life. But wash those hands/paws. #coronavirus :face_with_medical_mask:
2231592188249094416; 0; False; 1580246541; Jiang Ziya Legend of Deification the sequel to Ne Zha China's animated/fantasy Smash hit, has had its opening release put on hold in response to the Coronavirus in China. We can only hope this epidemic will be contained and treated soon. Our thoughts go out to all those affected. #coronavirus #prayer #china #anime #comingsoon #animation #follow
2231592124696833854; 0; False; 1580246533; Everyone be careful out there. . . #coronavirus #wuhan #virus #cruiseship #china #quarantine #mers #sars #vacation #cruiseport #handwashing #surgicalmask #stayhome #sickday #nocoughzone #vitaminc
2231592093716015137; 0; False; 1580246529; :police_car_light: Coronavirus:police_car_light: Aunque no se han confirmado casos de #coronavirus en Ecuador, es importante conocer y tomar medidas de precaución para evitar el contagio y la propagación del virus. En el Hospital Especializado San Juan de Dios Quito pensamos en tu salud, tomar en cuenta las siguientes recomendaciones para evitar su contagio. #Quito #Ecuador
2231589612240069589; 2; False; 1580246233; Nature is angry.. and it serves her right. It is more than time to end the bushmeat trade and the wildlife trade and the whale killing and the dolphin slaughter. If humans act like a parasite they will be treated as such. 2019-nCoV is not a pandemic. It is a consequence of crimes against nature and natural law. When you have a parasite inside you, what do you do? You take an antihelmintic to kill it... that’s what 2019-nCoV is... an antihelmintic created by Mother Earth to rid the planet of the number one parasite.... HUMANITY. Human beings can’t keep complaining about zoonosis (SARS, MERS, EBOLA, WUHAN Pneumonia) when they are abusing every living thing and eating Civet Cats, Cane Rats, Water Rats, Hedgehogs, Sharks, Monkeys, Turtles, Armadillos, Dogs, etc... A chaotic universe is a lie... the universe is one of inevitable cause and effect.. KARMA In London alone, an investigation conducted in 2007 found that a large amount of the meat samples they tested from a London meat market were wild meat (pangolins, Marsh buck, cane rat, and wild pig) #karma #civetcat #vegetarian #vegan #dogmeattrade #gaia #earth #nature #2019ncov #wuhan #endthewildlifetrade #bushmeat #mers #coronavirus
2231588544724256380; 1; False; 1580246106; Why did the CDC create a vaccine for a virus called the Coronavirus in 2015 :thinking_face::thinking_face::thinking_face: The :test_tube: CORONAVIRUS is a :petri_dish: lab created virus (which the CDC helped create) & was patented in 2015 but I’m a conspiracy theorist. :face_with_rolling_eyes::face_with_rolling_eyes::thinking_face: click the link and see for yourself. They are already creating a vaccine :syringe: for the very virus :microbe: they created in a lab. BTW. HIV/AIDS was also created in a lab :microscope: and spread through the polio vaccine. People need to wake up https://patentimages.storage.googleapis.com/1d/4e/4a/ac8914e765d645/EP3172319B1.pdf #coronavirus #populationcontrol #matrix #cdc #manmadr #virus
2231577336462373383; 11; False; 1580244770; Sur le tournage série avec Omar Sy " Arsène Lupin " Netflix, j'ai eu le Louvre et La Joconde pour moi seul :hugging_face::smiling_face_with_halo::smiling_face_with_halo::smiling_face_with_halo: @ladjly
2231575415604672205; 1; False; 1580244660; ・・・ I was hoping I was wrong .... LMAO !!! FUCK NO !!! — I LOVE IT WHEN I’M RIGHT !!!! •SUP FUCKERS ??!!!! EYE :eye: told you :backhand_index_pointing_right: #itsALLconnected #EpsteinDidntKillHimself or #EpsteinIsntDead • #KobeBryant #LebronJames #Qdrop why they hate #TRUMP2020 he got the drop on them all !!!! All Distractions !!!! #coronaVirus #Impeachment #covington crash head on • :rocket: 5 rockets hit embassy • Bolton’s book leaked • Kill Of #Kobe24 Bryant • ALL DISTRACTIONS !!! Also, all the #Colorado rape case was about was part of his deal with the #illuminati he was part of pizzagate #:pizza:- #JeffreyEpstein always recorded the sex acts of the #elite to black mail them later. What excludes your beloved KOBE ? • NOW DO YOU SEE HOW YOU ARE WORSHIPPING A #LUCIFERIAN #FREEMASON !!! • • THE #GOD FREQUENCY • #TheTruthShallSetYouFree !
2231568851451953119; 0; False; 1580243788; :face_with_medical_mask::face_with_medical_mask::face_with_medical_mask: #CoronaVirus #BatBootyBroth #BatBootySoup #402thunder402
2231567818519006293; 36; False; 1580243635; • edit: ominous man to which credit has been found for the smashed glass, although I had no recollection, he ousted himself in the first comment }}} whiskey made him do it orr i could not have, ukno
2231550743750799545; 0; False; 1580241901; a unique and different way of promotion #TimelessTheStage performing #2Ya2Yao :smiling_face_with_heart-eyes::smiling_face_with_heart-eyes::smiling_face_with_heart-eyes::smiling_face_with_heart-eyes::smiling_face_with_heart-eyes::smiling_face_with_heart-eyes::smiling_face_with_heart-eyes::smiling_face_with_heart-eyes::smiling_face_with_heart-eyes: I LOVE IT! And the chorus is my favourite part!:blue_heart::blue_heart::blue_heart::blue_heart::blue_heart::blue_heart::blue_heart::blue_heart::blue_heart: including Shin's dance part OMG!!! How much he lost weight :face_screaming_in_fear::face_screaming_in_fear::face_screaming_in_fear::face_screaming_in_fear::face_screaming_in_fear::face_screaming_in_fear::face_screaming_in_fear::face_screaming_in_fear::face_screaming_in_fear: . :copyright:today's #VLIVE was supposed to be attended by 400 fans but because of the #Coronavirus and everyone's safety they change it to private. i feel sad that they worked hard for this, especially director shin but ended up being their alone :persevering_face::disappointed_face::unamused_face: . @superjunior #200128 #SJTimelessTheStage#Timeless #Shadow #Bright #2ya2yao #슈퍼주니어#TheLastManStanding#TunisianELF #이동해 #Super_Clap #은혁 #Eunhyuk #이특 #KimRyeoWook #김려욱 #ChoKyuHyun #조규현 #KimHeeChul #김희철 #Yesung#예성#신동 #최시원 #SJLabel
2231305459511806512; 0; False; 1580212557; :warning: Qué los dientes NO se conviertan en una amenaza :tooth: #dentistry #dientes #illustrations #design #mograph #artist #2D #artoftheday #digital #digitalart #Framebyframe #dynamics #motion #graphics #motiongraphics_p #abstract #motionlovers #motionmate #motionxgang #motiondevotion #animation #adobe #video #motiondesigners #characteranimation #photoshop #coronavirus
2231163831489233656; 0; False; 1580195501; Con los 45° que hay esta noche en Santiago me vine a dormir a la ducha traje un daw un poco improvisado y hice este beat ... Si lo quiere escuchar entero esta "Available all platforms" .. la mano es que nos sigamos en spotify (linkenlabio) o Apple music.. y si no está ni ahí con esas weas mande un dm y se lo comparto al wssp yaw ... Si quieres expresar su sentir, también se puede ... oye que heavy la wea de la #psu .. de todo lo que a pasado estos últimos 3 meses ..esta wea me emocionó... por fin realmente se puede decir que cambio la historia :raised_fist: a pulso. . . . . . . . . . 137 #ElAziz #Elazığ #DepremVergileriNerede #deprem #BomSucesso #Mari #Malatya #Haaland #kizilay #AllahuAkbar #Pompeo #StarTrek #dollypartonchallenge #SpaceForce #Huntsmen #MaryLouiseKelly #Starfleet2399 #BeTheHunter #Bambi #JoeRogan #scump #taekook #Virgo #TerryCrews #coronavirus
2231054657950856699; 1; False; 1580182462; #herpes #epilepsy #hpv #hbp #cancer #virus #copd #diseases #infections #Infertility #Weakerection #ejaculation #herpesdating #fungi #coronavirus #china
2231054568754929822; 1; False; 1580182451; Different pack for different ailments, name the sickness you are suffering from and your cure. . . . #herpes #epilepsy #hpv #hbp #cancer #virus #copd #diseases #infections #Infertility #Weakerection #ejaculation #herpesdating #fungi#coronavirus #china
2231592081419992155; 0; False; 1580246528; #كورونا #كورونا_فايروس #الحاجة_ام_الاختراع #coronavirus #mask #pad #sanitarypads
2231591966108794372; 3; False; 1580246514; Caaaaaalma gente, eu sei q muita gente quer virar o Rick Grimes (ou o Negan né, nunca se sabe...) mas ainda não será dessa vez...! #nãoézumbi #coronavirus
2231591903657184125; 0; False; 1580246507; Daha fazlası için takipte kalın :) .d #geritakip #kesfet #corona #coronavirus #korona #koronavirüsü #mizah #takipcikazan #komedi
2231591806718359701; 0; False; 1580246506; #coronavirus #saude https://youtu.be/54t7nqd0b0c
2231591215361923895; 0; False; 1580246491; (BAŞTAN DİYORUM EĞER BANA ABONE OLMAZSAN SANADA BULAŞIRIM. SONRA SÖYLEMEDİ DEME) çinde karantinadan kaçmak isteyen adam. sizce neden kaçmak istiyor?:thinking_face: #china #pekin #shanghai #turkey #virus #corona #coronavirus #önlem #çin #türkiye #japanese #japan
2231591675711522111; 6; False; 1580246479; Coughin rn:pensive_face: • • • • • • • • • • • • • • • • • • • Like and share or some shit idk #tasm#tasm1#tasm2#theamazingspiderman#amazingspiderman#tasmmemes#tasm1memes#tasm2memes#andrewgarfield#spiderman#marcwebb#electro#theamazingspiderman2#emmastone#jamiefoxx#memes#TASMMemeVerse#tasmlove#shitpost#marvel#film#comics#comic#comicbook#comicbooks#cbm#morbius#spidermanmovie#coronavirus
2231591634733269093; 3; False; 1580246475; #Coronavirus: how to protect yourself from infection. World Health Organization @who recommends people take simple precautions against virus to reduce exposure and transmission . . . . . . #ProsperoLatino #coronaviruses #washingtondc #dc #washington #igdc #america #washingtonmonument #health #healthy #nutrition #vegan #healthyfood #gains #selfcare #family #virus #outbreak #ncov #wuhanchina #wuhan #news #chinacoronavirus #likeforlikes #like4likes #follow4followback #followforfollowback
2231591273646467504; 0; False; 1580246473; Merhaba ! Ey mashallah ! #coronavirus #wuhan
2231591592966258757; 0; False; 1580246470; If hou wanna avoids corona virus contamination be sure about what the right mask. #coronavirus
2231591514677538863; 1; False; 1580246460; :rolling_on_the_floor_laughing::rolling_on_the_floor_laughing: #coronavirus #fight #safetyfirst
2231591513293779132; 0; False; 1580246460; All most done :six_o’clock: .... . . . #providence #tampa #tampaarts #tampaartists #coronavirus
2231591480013718873; 1; False; 1580246456; All most done :six_o’clock: .... . . . #providence #tampa #tampaarts #tampaartists #coronavirus
2231591198265693662; 5; False; 1580246451; #CoronaVirus :face_with_medical_mask: #China . . . . . . . . . #vladimirputin #abd #usa #america #amerika #trump #donaldtrump #turkey #turkish #türkiye #türk #rte #reis #mizah #instagram #word #caps #komedi #receptayyiperdoğan #başkan #cumhurbaşkanı #army #ukraine #repost #noel #yeniyıl
2231591433289450208; 0; False; 1580246451; Cihanda Firavun ve Nemrud'un yüz binlerce benzerleri her zamanda mevcuttur; cümlesinin akıbeti Firavun ve Nemrud gibi olmaktır! . . . . . . . . . . #arakandakatliamvar #arakan #doğutürkistandazulümvar #doğutürkistan #çin #coronavirus #corona #virus #zulum #deprem #doğalafet #mekke #medine #instagram #keşfetteyiz #menzil #salihler #tasavvuf #cennet #cehennem #islam #muslim #turkey #azerbayjan
2231591376188299100; 0; False; 1580246444; What a start for the decade:clapping_hands::clapping_hands: Really impressive :unamused_face::unamused_face::smirking_face::smirking_face::man_shrugging: . . . . . . . . . . . . . #green #nature #explorer #sarcastic#lolI #couples #couplegoals #war #corona #coronavirus #rajinikanth #paradise #china #india #America #bomb #life #god #jesus
2231591308450301172; 0; False; 1580246436; :party_popper: New weekly survey is out :party_popper: Click here :backhand_index_pointing_right: https://yoursaygib.typeform.com/to/bWzSAO :wrapped_gift: With every completed #survey you are entered into our monthly #prize draw :crossed_fingers: #gibraltar #pandemic #sickleave #coronavirus #takethesurveytuesday
2231591266945371697; 0; False; 1580246431; :backhand_index_pointing_right: Protégete del #coronavirus. Si retornas de un viaje :airplane:o estás próximo a salir del país, :index_pointing_up:mantente alerta ante posibles síntomas y sigue nuestras recomendaciones de salud.
2231587595603796245; 4; False; 1580246420; #china #coronavirus #corona #muslim #concentrationcamp #Muslim_Concentration_camp #:unamused_face: #freedom #:dove: #peace @official.mamou :heart_suit: نمی توان نتیجه گرفت که پدید آمدن یک ویروس نتیجه اعمال یک شخص یا اشخاص خاصی است؛ شایدم باشه و من نوعی از درکش عاجزم. در حال حاضر نه تنها چین و مردمش بلکه این ویروس در حال حاضر گریبان گیر دیگر کشورها و ملتها شده. هدف فقط یادآوری ظلم چین و چینی ها در برابر مسلمانانی ست که تنها گناهشان داشتن یک دین و مذهب فراگیره، نمیدانم کجا هستند آن روشنفکرانی که فقط بلدن از اسلام و مسلمان ایراد بگیرند کجا هستند آن بشر دوستان و جامعه ی انسانی که دم از حقوق بشر میزنند و‌میزدند.
2231591144790486072; 0; False; 1580246416; “China will stop individual travelers to Hong Kong to curb the spread of the coronavirus, Chief Executive Carrie Lam says‪.”‬⁣ ⁣ ‪From QuickTake on Twitter.‬⁣ ⁣ #news #breakingnews⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣ #worldnews⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣ #coronavirus #wuhanvirus #wuhancoronavirusoutbreak #WuhanCoronavirus⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣ #coronavirusoutbreak #corona #ncov2019 #ncov⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣ #武漢肺炎 #武汉疫情⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣ #China #Wuhan⁣⁣⁣⁣⁣ #StandWithWuhan⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣ #LunarNewYear #NewYear #SpringFestival⁣⁣ #HongKong #CarrieLam
2231591133262460820; 0; False; 1580246415; Como a aromaterapia pode nos ajudar com o vírus que vem trazendo questionamentos em todo o mundo? . Muito importante estar atento e se precaver , mas sem pânico! . Manter a nossa vibração alinhada a confiança de que tudo está bem! :slightly_smiling_face: . Se hidratar, se nutrir com alimentos e pensamentos positivos. . Saúde é prevenção! :police_car_light: . Então vamos falar de um óleo essencial perfeitamente adequado para esse momento e que toda a família pode usar: . O óleo essencial de Ravintsara :herb:(Cinnamomum camphora qt cineol). Indicado no caso de infecções que afetam a esfera respiratória, sua ação antiviral e seus efeitos estimulantes sobre o sistema imunológico são de fato poderosos e reconhecidos por todos os profissionais e seguidores da aromaterapia. . O óleo essencial de Ravintsara é altamente concentrado em álcoois e segundo os estudos feitos por vários cientistas as diferentes moléculas que encontramos no oléo essencial de Ravintsara (1,8 cineol, alfa-terpineol e monoterpeno). . possuem propriedades como : antiviral,antiifeccioso,antibiotico,imunoestimulador,antibacteriano. Seu espectro de ação é muito amplo e ele é muito eficaz e seguro para todas as idades. . Então respire ravintsara, e não pire!:herb: . . . . #virus #coronavirus #ravintsara #oleosessenciais #aromaterapia
2231591117316823735; 0; False; 1580246413; #Chinese state-run newspaper the Global Times posted an image of a purported “novel #coronavirus hospital” called #Huoshenshan #Hospital on Twitter Monday. “1st building of #Wuhan‘s special novel #Coronavirus hospital, Huoshenshan Hospital, completed construction on Monday, in 16 hours,” the tweet read. “It is expected to be transferred to the military for management on February 2. Another Leishenshan Hospital is also under construction.” The tweet was quickly scrutinized by people who noticed that the image of Huoshenshan Hospital provided by Global Times is actually an Alibaba stock photo for a portable “container school building.”
2231591111109169159; 0; False; 1580246412; let me take you on a journey #streamcoronavirus #coronavirus #depressionmemes #meme #funny #elevator #graphic
2231591097460120687; 0; False; 1580246411; ¿Estás preocupad@ por el #Coronavirus? Esperemos que esta infografía de @micofvlc ayude con las dudas
2231590757729597460; 0; False; 1580246408; Habitantes de #Wuhan cantan el himno nacional desde su encierro tras el brote de #coronavirus
2231591066046676664; 0; False; 1580246407; Conoce un poco más sobre el coronavirus, aquí :backhand_index_pointing_up_medium-light_skin_tone: #SaludSanPablo #Coronavirus
2231591033010073644; 2; False; 1580246403; #Coronavirus Yellow - 1 case Light Orange - 2 to 4 cases Dark Orange - 5 or more cases Red - 100 or more cases Dark Red - 1 thousand or more cases
2231590948295855773; 0; False; 1580246400; :pistol::face_with_medical_mask::shield::syringe::pill: #coronavirus
2231590995621871757; 1; False; 1580246398; Here is the latest information on coronavirus from Dr. Papparello, Infectious Diseases Doctor with Emerson Hospital and Acton Medical Associates. Please share to help us educate our community. #coronavirus
2231590941685284505; 0; False; 1580246392; #antivirus #coronavirus #weightloss #barley #gerste #garcinia #soup #artichoke #brusselsprouts
2231590269589814350; 0; False; 1580246380; #virus #coronavirus #usa #uk #hongkong #uae #eu #europe #medicine #doctor #turkey
2231590501676092351; 0; False; 1580246378; La película del coronavirus tiene pintón:bat::bat: #memesespañol #coronavirus #humor #video #comedia #humor
2231590789062740987; 0; False; 1580246374; El infectólogo nacional, Tito Alvarado, manifestó que es poco probable que la nueva enfermedad de coronavirus llegue a Honduras. Ese virus ha contagiado a miles de personas, principalmente en China, país que reporta más de 100 muertes por la enfermedad. #coronavirus #latribunahn
2231590734369058682; 0; False; 1580246367; Apreciación de #radiografía posteroanterior de tórax del ciudadano chino que posiblemente pueda ser portador del #coronavirus 2019-nCoV . En la misma se puede observar como la #infección a invadido gran parte del pulmón izquierdo, ademas del compromiso del pulmón derecho. Hasta el momento #no se confirma diagnóstico definitivo y solo se ha continuado con tratamiento #sintomático en el paciente. Créditos de imagen: Estudiantes de la Universidad Central del Ecuador.
2231590384388447763; 1; False; 1580246349; Revisa el link que está en mi descripción del perfil par verificar los casos de Coronavirus que hay en el mundo. #coronavirus #gripe #pandemia #china #venezuela #enfermedadesraras #google #googlemap
2231590513898400133; 1; False; 1580246341; LE BATTUTONI! Seguitemi su @memememorabili_official #meme #memes #memeitalia #memeitaliani #memeita #memedivertenti #memeignoranti #dankmemes #dankmeme #battute #battutesquallide #virus #corona #coronavirus #follow4followback #followers #followforfollowback #likeforfollow #memememorabili
2231590480126945388; 3; False; 1580246337; A empresa que está cuidando do Corona vírus tem o mesmo símbolo da Umbrela Corp (Resident Evil). Coincidência?? . #aboboranerd #colecionáveis #avenger #dc #dbz #marvel #joker #brinquedos #toys #geek #nerd #residentevil #coronavirus #umbrellacorp #brasil
2231590479076716861; 0; False; 1580246337; #ATENCIÓN | Lista de países con casos confirmados del #coronavirus, al 28 de enero del 2020.
2231590461175718363; 0; False; 1580246335; #CORONAVIRUS :microbe: | El coronavirus que surgió en la ciudad china de #Wuhan se detectó ya en varios países y suma ya más de 100 muertos y miles infectados. . Más información en ecuavisa.com . Para conocer sobre cómo va el caso de sospecha de coronavirus en #Ecuador, puedes seguirnos también en @ecuavisanoticias
2231590462276009662; 0; False; 1580246335; 5- Irak’ın başkenti Bağdat’ta ABD Büyükelçiliği yakınlarına 2 füze atıldığı açıklandı. Saldırıda maddi hasarın meydana geldiği bildirilirken, can kaybı yaşanıp yaşanmadığına dair bilgi verilmedi. #2020 #coronavirus #ww3 #sondakika #virus #doomsday #cursed
2231590343240116314; 2; False; 1580246321; / / CORONAVIRUS / / With the recent announcement of this virus arriving in BC we wanted to remind you of the top ways to protect yourself and your family! :keycap_1:Wash Your Hands - This is the number one way to stop transmission. It is SO simple and yet still under-utilized. Please note that hand sanitizer is NOT the same. This has been proven time and again. Nothing compares to 1 minute of soap and water hand washing. When you get home wash your hands, when you get to the gym wash your hands, when done at gym wash your hands, before eating wash your hands, after EVERY cough/sneeze wash your hands...you get the point. . :keycap_2:Stay Home - If you do get sick please please please stay home. Even if you think you can just “power through” or your symptoms aren’t that bad to you, spreading them to a child, the elderly, or immunocompromised can be fatal for them. . :keycap_3:Sleep - Your body needs rest to fight off the viruses we are exposed to. . :keycap_4:Reduce Sugar Intake - Sugar can actually curb your immune cells that are responsible for attacking bacteria and viruses. . :keycap_5:Seek care from a licensed ND for further help in supporting your immune system.
2231590330539800668; 0; False; 1580246319; CORONA VIRUS!! The coronavirus causes severe acute respiratory infection and there is no specific cure or vaccine. Most of the deaths have been in Hubei province (China). The initial victims were mostly elderly people or those with pre-existing respiratory problems, but few details have been released about the dozens of deaths confirmed in recent days. Allah behter karay! . . . . . #corona #coronavirus #coronavirusoutbreak #coronaviruschina
2231590326690099276; 0; False; 1580246319; “Enquanto os homens exercem seus podres poderes...” #coronavirus #godisgod . . Foto: @afpfr_officiel
2231590325634049238; 0; False; 1580246319; #coronavirus #sick #contagious #humantohuman #animaltohuman #global #alert #worning
2231590117210989516; 2; False; 1580246312; Resident evil 2020 #coronavirus#memecoronavirud#meme#memes#humor#videosgraciosos#humornegro#videos#china#moriremostodos
2231590260647413453; 16; False; 1580246311; 29 days into the new decade and it been a total shit show. 1-#AustraliaBurning 2-#IranAttacks 3-#coronavirus 4-#KobeRIP . Now a tsunami threat message has been issued by the US National Weather Service’s Pacific Tsunami Warning Center after a magnitude 7.7 earthquake struck Tuesday (local time) near Jamaica. . I am a positive person who tries so hard to project positivity into the world, but so far this year with everything going on, I must say it’s been a little challenging. . :camera: via Twitter Josh Cox
2231590186021943158; 0; False; 1580246302; :mosquito::mosquito::mosquito::cat_face_with_tears_of_joy::cat_face_with_tears_of_joy::cat_face_with_tears_of_joy: . . . #coronavirus #doctor #doctores #jaja #jajaja #meme #memes #hospital #fly
2231590113132341439; 0; False; 1580246293; Ecco com'è realmente il corona virus - - - #meme #memes #dankmemes #memesita #fun #funny #laugh#memeita #coronavirus#coronavirusmeme#coronavirusmemeita#coronavirusmemes#coronavirusmemesita
2231589986894319623; 0; False; 1580246278; Repost @chinaxinhuanews #médicos al parecer voluntarios (con la #politícaschinas y del #Partido no se sabe) despidiéndose de sus seres queridos para dirigirse a la zona de #Wuhan el #matadero de #China Esperemos vuelvan sanos y salvos y esta #pesadilla se acabe pronto #Chinanews #coronavirus #NoticiasdeAsia #Asia #virusdelaboratorio #nipposfera #médicosvoluntarios
2231587928470389110; 5; False; 1580246272; Reposted from @daysikary_veganlove (@get_regrann) - #Repost @anetek_30001 • • • • • • Posted @withregram • @blingblingbitch8888_888 What is that? Posted @withregram • @coronavirus.china.news Одна из версий почему вирус начал распространяться. В рационе были дикие животные ! One version of why the virus began to spread. There were wild animals in the diet! #китайвирус #коронавирус #китайухань #вирускитай # #wuhanvirus #coronavirus #коронавирускитай #coronaviruses #coronavirusoutbreak #wuhan #chinafood #viruswuhan@ecopub.ve - #regrann
2231589496905069209; 9; False; 1580246269; I had no choice but risk my health to go and buy food and water. Vegetables were finished. As of today 106 dead and more than 4600 cases identified. Still no official word from Cameroon Embassy. #Wuhan #coronavirus
2231589871341112300; 4; False; 1580246264; Santini, que é numero 2 na pasta da pasta, estava como ministro interino devido a período de férias do titular da Casa Civil, Onyx Lorenzoni. Ele participou da programação da viagem oficial de Bolsonaro à Índia, onde apresentou a carteira de investimentos do Programa de Parcerias de Investimentos (PPI) a investidores. De acordo com a Casa Civil, a utilização de aeronave da FAB “seguiu os critérios definidos na legislação vigente”, mas Bolsonaro considerou a medida um ato inadmissível. Para Bolsonaro, é inadmissível o gasto de recursos públicos da forma conduzida por Santini. “O que ele fez não é ilegal, mas é completamente imoral”, acusou. “Questão do avião da Força Aérea. Inadmissível o que aconteceu. Já está destituído da função de executivo do Onyx, decidido por mim. Vou conversar com o Onyx, ver quais outras medidas podem ser tomadas contra ele”, disse Bolsonaro. Fonte: República de Curitiba . . . #governo #bolsonaro #bolsonaropresidente #brasil #direita #reforma #amazônia #naovamosdesistirdobrasil #trump #jairbolsonaro #Feminismo #direitaconservadora #carlosbolsonaro #direitabrasil #conservador #lulalivre #cultura #guerramundial #sergiomoro #anossabandeirajamaisseravermelha #conservadorismo #direitaunida #witzel #direitacaxias #coronavirus #foraideologiadegenero #brasilacimadetudo #folhadesaopaulo
2231589817240997119; 3; False; 1580246258; Assassination time #cancerousmemes #offensivememes #gay #relateable #coronavirus #corona #relatablememes #stolenmemes #china #stolenmemesforstolenkids #offensivememes:sweat_droplets::eyes::hundred_points::face_with_tears_of_joy::face_with_tears_of_joy::gem_stone::fire::face_with_steam_from_nose::sweat_droplets::OK_hand::hundred_points::face_with_tears_of_joy::folded_hands::face_with_tears_of_joy::face_with_tears_of_joy::gem_stone::gem_stone::fire::face_with_steam_from_nose::sweat_droplets::eyes::eyes: #dankmemes #meme #pronouncingthingsincorrectly #jetfuelcantmeltsteelbeams #lmao #tiktoksexy #tiktokmemes #twittermemes#twitterquotes #redditmemes #gaming
2231589785047517933; 1; False; 1580246254; With word spreading that the Coronavirus has possibly made its way to the KC area I will be placing a bulk order of hazmat suits. If you’re interested let me know! :face_with_tears_of_joy:. #businessalways #huslteandgrind #entrepreneur :man_shrugging_light_skin_tone: #coronavirus
2231589775708715581; 0; False; 1580246253; #coronavirus
2231589701370672650; 0; False; 1580246244; Sin querer sonar alarmista pero.. La verdad es que nos sentimos algo "banales" publicando #noticias de #tecnologia mientras ya hay indicidios muy claros de una #pandemia #mundial derivada de la situación con el #coronavirus, el hecho es que seguiremos adelante mientras nos sea posible Cabe destacar que @pasionmovil como empresa depende en gran medida de las campañas y el #marketingonline que realizamos para diversas marcas principalmente de Asia, especialmente de China, pero por ahora todo está congelado y no sabemos cuándo se reanudarán las actividades comerciales, por lo que quizás tendremos que anunciar algunos cambios temporales en nuestro equipo editorial en los próximos días El equipo de la foto es un #alcatel3 2019 de @alcatelmobilemx el cual cuenta con un modesto pero potente procesador #snapdragon de @qualcomm dispositivo del que puedes ver su #review en nuestro canal de #pasionmovil en YouTube http://youtube.com/pasionmovil #tech #techsource #techlovers #techreview #poderpda #pasionmovil #youtubereview #alcatelmobile #alcatel #alcatelphone #android #qualcommdevice #qualcomm #snapdragonprocessor #coronavirusoutbreak #coronaviruschina
2231589674660804861; 7; False; 1580246241; Alerta :warning: O Ministério da Saúde confirmou, nesta terça-feira (28), o registro de um caso suspeito de coronavírus em Minas Gerais e elevou a classificação de risco do Brasil para o nível 2, que significa "perigo iminente" da chegada do vírus. O caso suspeito é o de uma estudante de 22 anos que esteve recentemente em Wuhan, na China. Segundo o ministro, todas as 14 pessoas que tiveram contato com a estudante estão sendo "monitoradas". Acompanhe a repercussão em terra.com.br. #Saúde #Coronavirus :camera_with_flash: Carlos Garcia Rawlins/Reuters
2231589648581180687; 0; False; 1580246238; De interés! #coronavirus Créditos: @mtkd17
2231589647901004555; 1; False; 1580246238; En el prólogo expongo de forma sucinta el origen de ese veneno que nos inunda,y como controlarlo. . . #venecas #venezolanas #exacto #tusa #conaltura #foodlovers #14defebrero #diadelosenamorados #norkysbatista #venezolanosenelmundo #coronavirus #lovers #tinder #venezolanosenespaña #venezolanosenmadrid #tips #kobe #sarcasmos #memesespañol #humor #chicassexys #china #colombia #colombianas #misscolombia
2231589125767592028; 0; False; 1580246238; J’ai pu dire quelques mots des théories complotistes qui gravitent autour du #coronavirus. #FranceInfo
2231588737393807907; 0; False; 1580246237; :face_with_medical_mask:Ante posible propagación mundial del Coronavirus, experto recomienda aislar personas que lleguen a RD, provenientes China y más si han estado específicamente en la ciudad de Wuhan, dónde se descubrió el primer infectado con este virus. . . #coronavirus #wihan #chinavirus #coronavirusrd #salud #bienestar #familia #santodomingo #rd #umbrella
2231589290538464856; 1; False; 1580246235; #Repost @dewa_45idn --- Waspadalah, Waspadalah... Himbauan Dari Presiden NKRI Kita Nih Bapak @jokowi Yang Mulia Kembali Ke Laptop Ya Diterbitkan January 27, 2020 Wabah Virus Corona, Jokowi: Tidak Terdeteksi Scanner Kita Sepekan terakhir banyak berita tentang virus baru ini, ya corona wuhan atau coronavirus n-CoV novel masih menjadi perbincangan internasional saat ini. Pemberitaan terbaru mengabarkan, bahwa virus ini tidak hanya menjangkit wilayah yang ada di China, melainkan banyak kasus serupa terjadi di beberapa Asia lain seperti Taiwan, Hongkong, Singapura, Vietnam, Thailand, dan lainnya. Pemerintah Indonesia berupaya keras untuk memberikan perlindungan dan mencukupi kebutuhan bagi warga negara Indonesia (WNI) yang saat ini masih berada di Wuhan, Tiongkok. Presiden Joko Widodo yang juga memantau perkembangan wabah korona baik di Indonesia maupun di Tiongkok sendiri mengatakan bahwa pihak Kedutaan Besar Republik Indonesia (KBRI) yang berada di Beijing terus menjalin kontak dengan WNI di sana #CoronaVirus #Jokowi #Wuhan
2231589535853347006; 0; False; 1580246224; They the real ones tho #cancerousmemes #offensivememes #gay #relateable #coronavirus #corona #relatablememes #stolenmemes #china #stolenmemesforstolenkids #offensivememes:sweat_droplets::eyes::hundred_points::face_with_tears_of_joy::face_with_tears_of_joy::gem_stone::fire::face_with_steam_from_nose::sweat_droplets::OK_hand::hundred_points::face_with_tears_of_joy::folded_hands::face_with_tears_of_joy::face_with_tears_of_joy::gem_stone::gem_stone::fire::face_with_steam_from_nose::sweat_droplets::eyes::eyes: #dankmemes #meme #pronouncingthingsincorrectly #jetfuelcantmeltsteelbeams #lmao #tiktoksexy #tiktokmemes #twittermemes#twitterquotes #redditmemes #gaming
2231589522047275945; 0; False; 1580246223; BTC Price Back at $9,000 But No, Coronavirus Isn't 'Good for Bitcoin' #Bitcoin (BTC) may be gaining thanks to “economic fear” over #coronavirus — but only up to a point, analysts are concluding as the disease spreads. The #cryptocurrency hovered at around $9,000 on Tuesday, capping 4% gains for the week in which coronavirus sent China into partial lockdown. Coronavirus uncertainty creeps into markets Fears are now surfacing about the impact on Chinese economic growth, while global signals also suggest investors are more cautious about the short term. Markets analyst Mati Greenspan, the sentiment is already palpable. Uploading a chart of United States bond yields, he noted one-month performance delivered higher returns than the longer seven-year options. “It means investors are expecting trouble in the short term,” he explained in comments. Such economic uncertainty and unease on markets have often sparked increased bullish action for Bitcoin. As Cointelegraph noted, the Iran crisis earlier this month was just the latest geopolitical event that appeared to buoy the Bitcoin price. While Greenspan noted Bitcoin remained a highly non-correlated asset, mainstream media claims that Bitcoin was defying traditional markets and gaining purely on the back of coronavirus were widely panned. A report by the Financial Times with the headline “Coronavirus is good for Bitcoin” came in for particular criticism. Notably, the report cited two random Twitter accounts dedicated to altcoin XRP as sources. As reported, Bitcoin has long exhibited increasingly strong technical fundamentals, which preceded recent price moves. Vays: virus would “hurt” #BTC in epidemic scenario Discussing the impact of coronavirus, trader Tone Vays nonetheless stopped short of agreeing with the idea that the disease could perpetually fuel further gains. If it were to spread internationally, for example, panicked investors would likely reduce speculative activity, meaning less interest in non-traditional assets such as Bitcoin.
2231589479643548136; 0; False; 1580246218; January 28th 2020 Infected: 4515 Deceased: 107 Of the infected, 2714 are still located in central China (hubei) And as of 12:00:00EST WHO has confirmed there are no reported deaths due to coronavirus outside of China. This comes alongside other developing news regarding the statistics of the infected. Sources seems to suggest the median age of the deceased (107 confirmed) to be around 48y.o. with cases ranging in severity and age between: infants, children, adults & elderly regardless of any pre-existing conditions or general health. One interesting case comes from a recently deceased 50 year old man from Beijing. What’s interesting is the timeline of how the illness progressed. Traveled from Wuhan to Beijing in January 8th, Developed a fever and flu symptoms on January 15th, He was hospitalized on the 21st and later passed on the 27th. With a speculated 5 million evacuating central China before the national contagion lock down, it is now a race for virus identification, vaccination, treatment plans and containment. #survival #sheepdog #coronavirusoutbreak #coronavirus #coronavirusnews #preparedness #worldhealthorganization
2231589482552084875; 0; False; 1580246218; BTC Price Back at $9,000 But No, Coronavirus Isn't 'Good for Bitcoin' #Bitcoin (BTC) may be gaining thanks to “economic fear” over #coronavirus — but only up to a point, analysts are concluding as the disease spreads. The #cryptocurrency hovered at around $9,000 on Tuesday, capping 4% gains for the week in which coronavirus sent China into partial lockdown. Coronavirus uncertainty creeps into markets Fears are now surfacing about the impact on Chinese economic growth, while global signals also suggest investors are more cautious about the short term. Markets analyst Mati Greenspan, the sentiment is already palpable. Uploading a chart of United States bond yields, he noted one-month performance delivered higher returns than the longer seven-year options. “It means investors are expecting trouble in the short term,” he explained in comments. Such economic uncertainty and unease on markets have often sparked increased bullish action for Bitcoin. As Cointelegraph noted, the Iran crisis earlier this month was just the latest geopolitical event that appeared to buoy the Bitcoin price. While Greenspan noted Bitcoin remained a highly non-correlated asset, mainstream media claims that Bitcoin was defying traditional markets and gaining purely on the back of coronavirus were widely panned. A report by the Financial Times with the headline “Coronavirus is good for Bitcoin” came in for particular criticism. Notably, the report cited two random Twitter accounts dedicated to altcoin XRP as sources. As reported, Bitcoin has long exhibited increasingly strong technical fundamentals, which preceded recent price moves. Vays: virus would “hurt” #BTC in epidemic scenario Discussing the impact of coronavirus, trader Tone Vays nonetheless stopped short of agreeing with the idea that the disease could perpetually fuel further gains. If it were to spread internationally, for example, panicked investors would likely reduce speculative activity, meaning less interest in non-traditional assets such as Bitcoin.
2231589472193767667; 0; False; 1580246217; •Good start 2020, thank you• • • • • • • • • • • • • #coronavirus #china #jeffhong #sadpictures #follow4followback #unhapplyeverafter
2231589466219788750; 0; False; 1580246216; Hoy Pablo de @medicadoo ha hecho esta publicación muy interesante de lo que debes saber sobre el Coronavirus #Repost @medicadoo (@get_repost) ・・・ :face_with_medical_mask: No lo iba a colgar hasta mañana... pero viendo que la cosa esta que arde... va a tocar hablar hoy del Coronavirus este que tiene a los chinos tela de preocupados⁣ ⁣⁣ Lo primero... este tipo de virus ya ocasiono dos epidemias anteriores, el síndrome respiratorio de Oriente Medio (MERS) y el el síndrome respiratorio agudo severo (SARS), con unas tasas de mortalidad nada desdeñables del 35% y 18% respectivamente.⁣⁣ ⁣⁣ Al lío... se trata de una nueva cepa de coronavirus que, hasta entonces no se había encontrado en el ser humano que tiene su origen en China, más concretamente en la ciudad de Wuhan, y cuya existencia se comunico a la OMS el 31 de Diciembre de 2019. ⁣⁣ ⁣⁣ Los síntomas, las vías de contagio y las medidas a tomar te las cuento en la infografía y tienes mucha más información en el blog www.medicadoo.es ⁣⁣ ⁣⁣ Solo deciros que no cunda el pánico, al menos en España... que a pesar de que muchas veces los medios de comunicación tratan estos temas de una manera un tanto alarmista, mostrando imágenes que parecen sacadas de películas de apocalipsis zombies y fin del mundo, todo esto parece que por ahora nos queda un poco lejos y si conviene saber que es bastante poco probable que en España suframos un número significativo de casos y las autoridades nos dicen que el riesgo para la salud publica es muy bajo.⁣ ⁣ Aunque eso si... si vas a viajar a China extrema las precauciones y sobre todo... lavado de manos, solución hidroalcoholica a go go y la mascarilla si es necesaria (del tipo FFPII)⁣ ⁣ #consejofarmacéutico #consejomedicadoo #farmacia #farmacias #farmaciaamado #farmaamado #vilafranca #penedes #garraf #bcn #vilafrancadelpenedes #coronavirus #viruschino #salud #tipsdesalud #cuidamosdeti #consejofarmaceutico #bienestar #virus #consejos #consejo #consell #salut
2231589148930507968; 0; False; 1580246211; شعب الخليجي مع #فيروس #مارونا قصدهم #كورونا :microbe: ا:face_with_tears_of_joy::rolling_on_the_floor_laughing::rolling_on_the_floor_laughing::face_with_tears_of_joy::face_with_tears_of_joy::face_with_tears_of_joy::face_with_tears_of_joy::woman_facepalming_light_skin_tone::woman_facepalming_light_skin_tone::woman_facepalming_light_skin_tone::woman_facepalming_light_skin_tone: #CoronaVirus :microbe:
2231588949531803682; 6; False; 1580246210; Coronavirus @6ixbuzztv #coronavirus
2231589414530019281; 6; False; 1580246210; . Sur la première vidéo on dirait que je suis en bateau :face_with_tears_of_joy: . Plus que jamais lavez vous les mains entre chaque exo #coronavirus . Yzzi. . #powerlifter #powerlifting #workout #gym #girlswholift #fitgirl #nopainnogain #power #blancbleubelgebooty #squat #bench #training #determination #nevergiveup #gohard #strong #gohardorgohome #motivation
2231589246767279206; 0; False; 1580246201; (BAŞTAN DİYORUM EĞER BANA ABONE OLMAZSAN SANADA BULAŞIRIM. SONRA SÖYLEMEDİ DEME) Asansöre binen Çinli asansörün tuşlarına tükürüyor. •Gitmişken yanımda birilerini daha götüreyim hesabı #china #pekin #shanghai #turkey #virus #corona #coronavirus #önlem #çin #türkiye #japanese #japan
2231588991400208310; 1; False; 1580246200; - - - - - #coronavirus #memes #meme #funny #explore #explorepage #quote #quotes #viral #instagram #offensivememes #dankmemes #follow #humor #lol #lmao #comedy #edgymemes #fun #memesdaily #daily #relatable #dank #entertainment #hood #twitter #memestagram #memepage #like #trending
2231589234795819171; 0; False; 1580246197; Void Follow @lar.mp4 for more Follow @lar.mp4 for more . . . . . . . . . . . . . #memepage #trending #explorepage #viral #memes #dankmemes #edgymemes #offensivememes #dailymemes #cursedmemes #kobe #coronavirus #corona
2231589275714027884; 0; False; 1580246193; Crab and cream cheese Wuhan's anyone? #haha #coronavirus #kungflu
2231589201651215087; 0; False; 1580246185; That toaster is fire tho #cancerousmemes #offensivememes #gay #relateable #coronavirus #corona #relatablememes #stolenmemes #china #stolenmemesforstolenkids #offensivememes:sweat_droplets::eyes::hundred_points::face_with_tears_of_joy::face_with_tears_of_joy::gem_stone::fire::face_with_steam_from_nose::sweat_droplets::OK_hand::hundred_points::face_with_tears_of_joy::folded_hands::face_with_tears_of_joy::face_with_tears_of_joy::gem_stone::gem_stone::fire::face_with_steam_from_nose::sweat_droplets::eyes::eyes: #dankmemes #meme #pronouncingthingsincorrectly #jetfuelcantmeltsteelbeams #lmao #tiktoksexy #tiktokmemes #twittermemes#twitterquotes #redditmemes #gaming
2231589175908198615; 0; False; 1580246181; 4- Brezilya'nın güneydoğusunda bulunan Minas Gerais eyaletinde cuma günü başlayan şiddetli yağışlar sonrası meydana gelen sel ve toprak kaymalarında ölü sayısı 53'e yükseldi. #2020 #coronavirus #ww3 #sondakika #virus #doomsday #cursed
2231589167400475534; 26; False; 1580246180; ¿Casualidad o coincidencia? #coronavirus #residentevil
2231588408753133079; 0; False; 1580246169; |#Salud |Estudiantes dominicanos en la ciudad de Wuhan, en donde se originó el coronavirus, dicen estar esperanzados que serán repatriados por el Gobierno dominicano. #coronavirus #dominicanos #estudiantes
2231589057998540393; 0; False; 1580246167; A case of #coronavirus was just discovered in #Lawrence #lfk #kansas
2231589051446345776; 0; False; 1580246167; El secretario de Salud, Alex Azar, anunció que de momento no ha habido contagio en los cinco casos de coronavirus registrados en Estados Unidos y pidió a China más cooperación y transparencia sobre el nivel de propagación para que se pueda determinar el grado de gravedad de la epidemia después de que se disparara el número de muertos. "Es importante que el país sepa que es una amenaza potencial grave para la salud pero aún no conocemos lo que tenemos que saber del virus, pero eso no quita que no nos tengamos que preparar", señaló el secretario de salud, quien recomendó a los estadounidenses que eviten los viajes no esenciales a China. Azar señaló que el hecho de que haya más de 100 muertos en China es "grave" pero recalcó que la mayoría de las víctimas eran personas de edad y con su salud comprometida. Leer más en: www.demosnoticia.com #DemosNoticias #28Ene #EstadosUnidos #China #Coronavirus #Noticias #News
2231589008504691811; 0; False; 1580246161; Injection injection I dont want your Chinese infection #memes #coronavirus #china
2231588995014373421; 49; False; 1580246160; #CORONAVIRUS :microbe: | El coronavirus que surgió en la ciudad china de #Wuhan se detectó ya en varios países y suma ya más de 100 muertos y miles infectados. . Más información en ecuavisa.com . Para conocer sobre cómo va el caso de sospecha de coronavirus en #Ecuador, puedes seguirnos también en @ecuavisanoticias
2231588972878301432; 21; False; 1580246157; This movie deadass fire but that dude they inside dirty asl :woozy_face: sweaty ass smelling ass dude but the movie fire tho
2231588962350035949; 11; False; 1580246156; Las coincidencias entre el videojuego de @capcomusa y el terrible virus que ataca a #China son innegables :astonished_face:. Desde los logos de #UmbrellaCity con el del laboratorio biológico #Wuhan :eyes:, las ciudades que se encuentran en cuarentena :warning:, el esfuerzo de las autoridades para evitar la propagación del #Coronavirus es casi idéntico a lo que se reflejaba en #ResidentEvil :video_game: e incluso el anagrama de #Corona es #Raccoon, el mismo nombre de la ciudad ficticia del juego :eyes:. ¿Qué opinas?.. ¿Crees en las coincidencias? :thinking_face:
2231588952426695251; 2; False; 1580246155; #Coronavirus #Protection :shield::crossed_swords:
2231588806690232031; 0; False; 1580246137; ... #coronavirus #virus
2231588788581454984; 0; False; 1580246135; Hate that I'm a fucking millennial. #lol #1fuck #dankmemes #darkhumor #ImFUCKINHARDCORELOL #4rayswoar #thestoneyomnistdude #popedmontano #funnyaf #coronavirusmemes #coronavirus #madeinchina
2231588760712408089; 1; False; 1580246132; A proibição de caça a animais silvestres foi um fator que inibiu a possibilidade de mutação do vírus que passa de animais para seres humanos, causando infecção. Em entrevista ao Jornal do Piauí nesta terça-feira (28), o infectologista Kelson Veras falou sobre o vírus e deu dicas de como se prevenir de doenças cujo o contágio se dá pelo contato. Link nos stories! #coronavirus #infectologista #caçanobrasil
2231588731511493778; 0; False; 1580246128; 2020 gowa başlamady inşallah soñy gowylaşyp gider:crying_face::thumbs_up: #bro_tm19 . . . . . . . #türkmenistan #türkiye #ahal #dasaguz #ashgabat #mary #lebap #balkan #bayramaly #turkmenabat #gyzlar #haladynmy #owadan #oglanlar #vipgyzlar #vip_asgabat #music #çyra #kizlar #avustralya #coronavirus #2020 #china #usa #iran
2231588671633874043; 0; False; 1580246121; my mans in the red shirt really getting into that discussion #meme #memes #funny #sandwich #nipple #lol #lmao #kobe #bryant #kobebryant #rip #ripkobe #ripkobebryant #gianna #giannabryant #thebox #roddyricch #tiktok #tiktokmemes #offensive #offensivememes #news #coronavirus #china #virus #pilot #helicopter #womenmemes #women #youtube
2231588620748373322; 1; False; 1580246115; ATENTOSSSSS Nuevos Métodos para el #coronavirus :rolling_on_the_floor_laughing::rolling_on_the_floor_laughing::rolling_on_the_floor_laughing: . . . . #memesespañol #meme #14febrero #amor #venezuela #caracas #risas #maricositepasa #felicidad #followforfollowback #followers #family #relationshipgoals #travel #world #beautiful #valencia #zulianos #fiesta #coronavirus
2231588592898172453; 0; False; 1580246115; Minister of Health and Wellness, Christopher Tufton said news that there is a coronavirus case at the University Hospital of the West Indies is false. ⠀ #news⠀ #Jamaica⠀ #coronavirus
2231588530237335957; 0; False; 1580246104; “Life is short, but art lives forever.” — Marcus Tullius Cicero #art #ego #China #Coronavirus #Corona #virus #artegoist #MonaLisa #Mona #Lisa
2231588465309758912; 0; False; 1580246097; #wish #coronavirus #free #haha #mem #smiesznymem
2231588312628539760; 0; False; 1580246095; (BAŞTAN DİYORUM EĞER BANA ABONE OLMAZSAN SANADA BULAŞIRIM. SONRA SÖYLEMEDİ DEME) ARKADAŞLAR HALA DURUM CİDDİ Mİ YAZAN KİŞİLER VAR. DURUM CİDDİ ÇİN ŞU AN ALARM DURUMUNDA HASTANELER DOLU. DİKKATLİ OLALIM LÜTFEN #CORONA #coronavirus #china
2231588450535961638; 0; False; 1580246095; #anime #coronavirus #ninjutsu #hilarious #nerd
2231588398416576503; 0; False; 1580246089; Gotta be safe...and cute #coronavirus #sickmask #mask #disney #cute #mickeymouse #goofy #CassByTDA #dailyoutfit #ootd #DonaldDuck #OutfitoFTheDay #fashion #dailyfashion #me #style #model #outfit #queer #alternative #stretchlobes #glasses #pinkglasses #justgotmyzennis #zennioptical #redhair #eyes #face
2231588401472465111; 1; False; 1580246089; My first pen drawing. #coronavirus #realisticdrawing #ink #inkart #mandalorian #starwarsmemes #cool #mustsee #trending #art #fanart #disney #fun #epic #smallartist #beginnerartist #babyyoda #artist #tictok #brushpen #starwarsfan #starwarsfanart #youngartist #youngartists
2231588342858808791; 3; False; 1580246082; :memo:Antes explicaremos cómo podemos aumentar las defensas de nuestro organismo de forma natural y con miel Beehouse , explicaremos porque se bajan las defensas, primero es necesario que comprendamos por qué motivos se resiste nuestro sistema inmunológico, y no siempre gozamos de la misma salud . :backhand_index_pointing_down: :cross_mark: -Cambio de clima. :cross_mark: -No tener suficiente higiene . :cross_mark: -Mala alimentación. :cross_mark: -Falta de ejercicio físico. :cross_mark: -No dormir las 8 horas . • Es indispensable que cambiemos estos malos hábitos por hábitos saludables. ¿Y que no ayudara? Bien nuestra miel Beehouse es el remedio natural más dulce, es decir se nos será muy fácil acomodarlo a nuestra dieta saludable te daremos algunos tips para subir las defensas : :backhand_index_pointing_down: :heavy_check_mark: Tomar agua tibia con una cucharadita de miel Beehouse . :heavy_check_mark: En la noche tomar un té de jengibre , ponerle 5 gotitas de limón y una chulada de miel Beehouse . :heavy_check_mark: Tomar bastante limonada y endulzar con miel Beehouse. :heavy_check_mark: Endulza todas tus bebidas con miel ya que es rico en vitamina B6, esta vitamina es encargada en producir calcio , hierro, magnesio entre otros . :heavy_check_mark: Trata de tomar 3 cucharadas de miel al día. ( no excedas los límites si eres diabético o sufres alguna enfermedad consulta primero a tú médico ) :warning: No olvidemos :double_exclamation_mark: • Dormir lo suficiente . • lavarnos las manos cada 30 minutos. • hacer 10 minutos de ejercicio diarios . • tener una alimentación saludable. :beaming_face_with_smiling_eyes: ¿Deseas saber más tips sobre la miel beehouse? Comenta SI o pon tú opinión en los comentarios :honeybee: • • • • • #salud #mielorganica #beehouse #panama #veraguas #coronavirus#salud#
2231588327306792337; 0; False; 1580246080; :police_car_light::round_pushpin:#historiasdepolicia #lucianalopezproducoes #unicef #india #policiacivildorn #parnamirim #uk #sus #esplanadadosministerios #Brasília #onumulheres #policiafederal #mj #mpf #Germany #usaembassy #nyt #Brasília #brazil #Amazônia #greenpeace #uniaouropeia #Brasília #brasil #mj #onumulheres #naoaviolenciacontraamulher #google #estadodorn #natal #parnamirim #onumulheres #coronavirus #china #russia #africa #india #esplanadadosministerios :police_car_light::round_pushpin:
2231587593162368090; 2; False; 1580246076; Empty streets of Beijing, China :China:. Beijing population: 21.542.000 people . #coronavirus #coronavirusoutbreak #virus #wuhan #wuhanvirus #coronaviruschina #wuhanchina #corona #coronovirus
2231588274879557799; 0; False; 1580246074; China Cruises:passenger_ship: Cancelled Due to Coronavirus Outbreak- :face_with_medical_mask:@royalcaribbean, @msccruisesofficial, @costacruisesofficial, and more. Latest details in our blog (LINKINBIO) :double_exclamation_mark::index_pointing_up::index_pointing_up: #coronavirus #china #cruises #cruiseship #maritime #personalinjury #aronfeldlaw #miami
2231588242952544732; 4; False; 1580246070; #coronavirus
2231588193928909023; 0; False; 1580246064; Le nouveau virus : "CORONA VIRUS':face_screaming_in_fear: détecter en Chine pour la 1ère fois #virus #coronavirus #china
2231588156472545749; 1; False; 1580246060; Run because #coronavirus will catch the untrained ones first :face_with_tears_of_joy: - - - - - - - - - - - - - - - - #coronavirus #china #virus #wuhan #Coronavirus #coronavirusoutbreak #wuhanvirus #health #epidemic #wuhancoronavirus #PharmacyEducation #StudentPharmacist #PharmacySchool #HospitalPharmacy #CommunityPharmacy #PharmacyStudent #PreReg #PreRegistration #futurepharmacist #Pharmacisttobe #StudyPharmacy #ClinicalStudy #PharmacyOTC #PharmacyQuiz #pharmacyUniversity #Healthcare #PharmacyLife #PharmacyQuestions #PharmacyExam #PharmacyHelp
2231588085681096814; 0; False; 1580246051; #coronavirus :face_with_medical_mask:
2231588043109377371; 0; False; 1580246046; Como el #coronavirus de #wuhan es el protagonista de todas las noticias en el mundo:globe_showing_Europe-Africa:. Aquí os dejamos información básica sobre este virus y unos consejos para evitar el contagio :face_with_medical_mask: . . . #consejosmicof #wuhan #coronavirus #farmacia #salud #tufarmaceuticotecuida #parapoteca #noticias #virus
2231588040928432689; 3; False; 1580246046; With all the talk of the coronavirus, I’m thinking I might invest in one of these, so I never have to cancel a show! I think it could bring a new dimension to my show! What do you think? . . . . . #anightattheopera #wuhanchina #virus #coronavirusoutbreak #utahmusic #freddiemercury #iwanttobreakfree #ctmusic #corona #chasegivenlive #supportmusic #freddymercury #ncov #dontstopmenow #coronavírus #localband #viruscorona #bostonmusicscene #localshows #makingmusic #theshowmustgoon #anotheronebitesthedust #somebodytolove #supportnewmusic #newbands #pittsburghmusic #radiogaga #queenforever #wuhan #coronavirus
2231588033329102523; 0; False; 1580246045; #coronavirus #coronavirusmemes #fifty-leaven
2231586890573978175; 0; False; 1580246043; @weatherchannel #coronavirus#weather#theweatherchannel#china#unitedstates#weather#breakingnews#theweathernetwork#theweather
2231588008230759136; 5; False; 1580246042; O primeiro caso suspeito de incidência do coronavírus no Brasil é investigado em Minas Gerais. Trata-se de uma mulher de 22 anos que esteve em Wuhan, na China, e foi atendida na Unidade de Pronto Atendimento (UPA) Centro-Sul de Belo Horizonte na última sexta-feira (24). O Ministério da Saúde confirmou, nesta terça-feira (28), que o caso é investigado pela pasta. . Foto: Agência Minas/ Divulgação. . #coronavirus #saude #sesmg #ministeriodasaude #jornalismo #bh #belohorizonte #mg #minasgerais #divulgagerais
2231587461838946169; 2; False; 1580246011; (BAŞTAN DİYORUM EĞER BANA ABONE OLMAZSAN SANADA BULAŞIRIM. SONRA SÖYLEMEDİ DEME) WUHAN KENTİNDEKİ HASTANE #corona #coronavirus #virus #china
2231587683297642476; 0; False; 1580246004; #Repost from @inbecbrasil. Nos arredores de Wuhan, na China, a construção de um hospital com mil leitos, para tratar pacientes com coronavírus, se assemelha a uma corrida contra o relógio, com centenas de trabalhadores, dezenas de escavadeiras e seus termômetros para detectar a pneumonia viral. "É preciso trabalhar rápido para combater a epidemia", diz um trabalhador, que prefere não dar seu nome. ⠀ Acesse a notícia completa no link da #bio ou nos #stories.⠀ ⠀⠀ www.inbec.com.br/blog ⠀ #INBEC #PósGraduação #Especialização #Educação #Engenharia #Arquitetura #Blog #Hospital #China #Wuhan #CoronaVirus
2231587389218598799; 2; False; 1580246003; Meanwhile in Wuhan, China.:China: :right_arrow::right_arrow:(@coronavirus_2019)
2231587657510258743; 0; False; 1580246000; Como el #coronavirus de #wuhan es el protagonista de todas las noticias en el mundo:globe_showing_Europe-Africa:. Aquí os dejamos información básica sobre este virus y unos consejos para evitar el contagio :face_with_medical_mask: . . . #consejosmicof #wuhan #coronavirus #farmacia #salud #tufarmaceuticotecuida #parapoteca #noticias #virus
2231587607372645659; 0; False; 1580245994; HABERLER İÇİN TAKİP EDİN :backhand_index_pointing_right: @darkvebhaber #darkvebhaber #turkey:Turkey: #turkiye #elazighersey #haber #deprem #trump #abd #sondakika #haberler #coronavirus #corona #virus
2231587604059367435; 0; False; 1580245994; Oh hell no • • Follow @spritstail for more • • • • • #memes #textposts #tumblr #twitter #reddit #funnymemes #explorepage #explorepagememes #memesdaily #dankmemes #repost #followme #viral #vine #tiktok #cleanmemes #jokes #memelord #savagememes #comedy #lol #memeaccount #bestmemes #coronavirus #corona #china #wuhan #coronavirusmemes #outbreak
2231585908250589745; 0; False; 1580245990; Tag someone else who recently learned how to do this... lol Imagine making this a viral Post ??? #viral #coronavirus #roundoffbackflip
2231587534700399769; 1; False; 1580245986; İran Dışişleri Bakanı Muhammed Cevad Zarif, ABD Başkanı Donald Trump'ın açıkladığı barış planına ilişkin, "Umarım 'bu tehdit' tüm Müslümanlar için bir uyandırma çağrısı olur. Filistinliler için birleşelim" dedi. #coronavirus #gundem #gündem #siyaset #sondakika #siyasi #tsk #dışpolitika #politika #politics #haber #haberler #türkiye #ankara #istanbul #izmir #antalya #bursa #msb #denizli #vatan #anadolu #turksilahlikuvvetleri #trump #putin #abd #rusya #türkiye #iran #çin
2231587515122795286; 0; False; 1580245983; Hey Guys I’m not worry about the #coronavirus, because I’m taking care of myself with too many of dietary supplements like those, high recommended, protect your kids! Love you guys stage safe please. #holdinghands #eatwell #greece_nature:blue_heart:
2231587499386680749; 3; False; 1580245982; #yeezy700carbonblue #yeezyboost380 #yeezyalien #yeezy380alien #yeezy380 #yeezy700inertia #yeezy #yeezy700 #yeezy700v3 #yeezy700azael #yeezy700waverunner #adidasyeezy #yeezy700runner #yeezyboost350 #yeezyboost #yeezyboost #yeezy350v2 #yeezys #yeezy750 #yeezymafia #yeezyboost350v2 #yeezysupply #hypebeast #sneakerhead #sneakernews #yeezy380alien #yeezyblack #offwhite #yeezypirateblack #yeezyyecheil #yeezy700tealblue #coronavirus
2231587486633919614; 0; False; 1580245980; Confira algumas recomendações para se proteger do Coronavírus. ⠀ ⠀ :white_heavy_check_mark: Lavar regularmente as mãos. :white_heavy_check_mark:Cobrir a boca e nariz ao tossir e espirrar. :white_heavy_check_mark: Evitar aglomerações e ambientes fechados. ⠀ ⠀ #SupermercadoTelefrango #OndeAEconomiaCantaDeGalo #Supermercado #Telefrango #smtelefrango #supertelefrango #Saúde #DicaSaude #Coronavirus ⠀
2231587434179684310; 3; False; 1580245974; Before criticizing the Chinese for their eating habits, start by fixing yourselves first. #coronavirus . . . . . . . . . . . . . . #food #meat #virus #sick #animals #factoryfarming #vegetarian #instapic #media #socialmedia #china #america #canada #europe #hypocrisy #truth #like #follow #share #blessed #God #bless
2231587407428653857; 0; False; 1580245971; :warning: #Atención :warning: #LosAndesTeCuenta| ¡La prevención es la clave! Compartimos algunos sencillos pasos para evitar una infección por #coronavirus :microbe:
2231587394184148060; 0; False; 1580245969; ..tag your squad.. . follow for more original memes :sweat_droplets:. . . . #dankmemes #memes #relatable #meme #dailyfunny #relatablememes #funny #dailymemes #reddit #redditmemes #dankmemesdaily #lol #tiktok #tiktokmemes #ww3 #kobe #kobebryant #animememes #cursedimages #offensivememes #offensivememes:sweat_droplets::eyes::hundred_points::face_with_tears_of_joy::face_with_tears_of_joy::gem_stone::fire::face_with_steam_from_nose::sweat_droplets::OK_hand::hundred_points::face_with_tears_of_joy::folded_hands::face_with_tears_of_joy::face_with_tears_of_joy::gem_stone::gem_stone::fire::face_with_steam_from_nose::sweat_droplets::eyes::eyes: #china #coronavirus #corona #plague #america #outbreak #lunarnewyear #chinesenewyear #pornmemes:no_one_under_eighteen:
2231587344876409915; 0; False; 1580245963; #asia #girl #meme #memes #coronavirus
2231586528480320627; 0; False; 1580245866; In frame : @adamucoppe #canon750d #photooftheday #bukitbintang #pondanmalaysia #lightroom #coronavirus
2231586000323460219; 2; False; 1580245803; Интерес людей по поводу вируса уже выходит за рамки :dna::microbe: • Мне постоянно пишут мои знакомые, даже их семьи пытаются что-то через меня узнать. Родителей уже достали с расспросами про вирус и про то, не успела ли я там заразиться, а то ещё и им самим перепадёт :woman_facepalming_light_skin_tone::woman_facepalming_light_skin_tone::woman_facepalming_light_skin_tone: • Я ничего не могу сказать по поводу вируса, слишком много мнений успела выслушать с момента его возникновения. Знаю лишь, что в России ещё те паникёры. Даже от самих китайцев слышу меньше жалоб. • Хочу лишь, чтобы всё это поскорее закончилось, можно было вернуться обратно в Китай и жить прежней жизнью. Я успела соскучиться по Шанхаю в первый же день моего нахождения на родине, а с появлением вируса все планы начали рушиться в момент. • Знакомые начали сдавать свои билеты в целях безопасности, никому не известно, когда начнут работать университеты и школы. Поэтому свой вылет обратно мы отложили на неопределенный срок. • Со слезами на глазах читаю сообщения и беспокоюсь за друзей, которые решили остаться там. Кто-то остался из-за того, что Китай их дом, за многие годы, которые они там провели, обзавелись работой, жильем и домашними питомцами, просто не могут всё бросить и уехать. • А для кого-то жизнь в России страшнее любого вируса и их можно понять. Для них изоляция - находиться в России, где заработать хорошие деньги тяжелее на родине, нежели в стране, где во всю бушует вирус. Китай даёт возможности и счастливое будущее, а вернуться в Россию, значит смириться с серой и несправедливой жизнью. • Китайцы невероятно умны и работают слажено даже во времена такой беды, за месяц, максимум два они уже смогут победить вирус. • По СМИ любят показывать проблемы других стран, но никак не своей страны, где их и без вируса хватает. Смотрите ТВ и слушайте всю эту бурду, продолжая не замечать все наши проблемы, думая как всё плохо у других и как хорошо у нас. Ведь мы это хорошо умеем :raised_fist_medium-light_skin_tone: • Тут уже сами выбирайте кого на самом деле стоит жалеть.
2231586000392207343; 3; False; 1580245803; Muito se tem falado nos últimos dias sobre a epidemia de coronavírus e a possível disseminação do vírus no Brasil diante da confirmação do primeiro caso divulgado pela mídia.⁣⁣ ⁣⁣ Atualmente o Brasil possui somente um caso confirmado, trata-se de uma estudante de 22 anos que viajou para Wuahn, na China, e retornou para o Brasil no dia 24 de janeiro. Ela esta internada em Belo Horizonte.⁣⁣ ⁣⁣ Diante da entrada no vírus no território brasileiro e consequentemente da possibilidade de uma epidemia nacional, pode surgir a seguinte dúvida: O plano de saúde deverá custear o tratamento caso haja infecção?⁣⁣ ⁣⁣ Por enquanto o Brasil, de acordo com o Ministro da Saúde Henrique Mandetta, está na fase de “perigo iminente”, todavia caso o vírus circule em território nacional será decretada a fase “emergência em saúde pública”. ⁣⁣ ⁣⁣ Diante disso, atualmente, a ANS (agência nacional de saúde) ainda não inseriu no rol de procedimento o tratamento específico para esse vírus, considerando que a medicação ainda está sendo desenvolvida, o que possivelmente deverá ser feito nos próximos dias.⁣⁣ ⁣⁣ Todavia, mesmo sem a previsão no rol da ANS, o plano de saúde deve fornecer o tratamento e o acompanhamento ao paciente, visto que de acordo com o artigo 14 do Código de Defesa do Consumidos (Lei 8.078/90) o risco da atividade deve ser suportado pelo fornecedor.⁣⁣ ⁣⁣ Em caso de negativa de tratamento pelo plano de saúde, não pense duas vezes, procure um advogado de sua confiança para tomar as medidas cabíveis.⁣⁣ -----⁣⁣ 1. Marque alguém que precisa ler isso⁣⁣ 2. Deixe sua opinião nos comentários
2231574449286353569; 0; False; 1580244720; 2020 has started the worse for 37 years #ripkobe:broken_heart: #juicewrld #bushfiresaustralia #coronavirus
2231563520540213141; 9; False; 1580243180; I Interrupted A #Coronavirus Meeting To Introduce Them To @IAmMidgetMac But They Were Not Impressed! :rolling_on_the_floor_laughing:
2231550034571087247; 1; False; 1580241670; Our Festival Director and @freelandfoundation Founder, Steve Galster’s important message about the Coronavirus and China’s wildlife trade ban.
2231469634830418724; 0; False; 1580232116; Inchiesta sul corona virus . . . #coronavirus #virus #wuhan #pistoia #napoli #italia #germania #giornalerosso #sinistra
2231467201320433309; 0; False; 1580231641; Poveretti... . . . . #coronavirus #virus #wuhan #pistoia #napoli #italia #germania #giornalerosso #sinistra
2231465940378259627; 2; False; 1580231491; Il coronavirus ora spaventa anche l'Italia. Un caso sopetto del virus cinese infatti s'è verificato a Pistoia dove una turista cinese 53enne, originaria della provincia dell'Hubei (quella il cui capoluogo è Wuhan), è ricoverata da ieri all'ospedale San Jacopo. A riferirlo, con una nota, è stata l'Alsl Toscana Centro. La donna, che viaggiava con una comitiva di una ventina di turisti cinesi a bordo di un pullman diretto a Lucca, è svenuta accusando una sintomatologia influenzale con lieve rialzo febbrile. Episodio simile anche a Napoli. Dopo il falso allarme dei giorni scorsi, un 28enne cinese, anch'egli proveniente dalla provincia di Hubei, si è presentato all'ospedale Pellegrini con sintomi sospetti. Subito è stato attivato il protocollo previsto dal Ministero della Salute, con il trasferimento del paziente al Cotugno, una struttura specializzata in malattie infettive. È presso l'Azienda Ospedaliera dei Colli che, in questi minuti, il personale sta sottoponendo il cittadino cinese agli esami di rito, tra cui il tampone, che stabiliranno la presenza o meno del coronavirus. . . #coronavirus #virus #wuhan #pistoia #napoli #italia #germania #giornalerosso #sinistra
2108006385082731318; 1; False; 1565513965; 333me.life #kobebryantdied in helicopter on #kobebryantcartoon in 2016 also:man_shrugging_medium-dark_skin_tone::thinking_face: #orwell #edwardsnowden #billgates #patent #viral #coronavirus #iran #china NSA #theylive #pedoelitist #epsteindidntkillhimself #orlandobrown #westworld #harveyweinstein #elsagate #oprah personofinterest #theylive #vacinnes humanity #plauge trending #kobebryantconspiracy #metzizahbpeh #pizzagate #pedophilialegalizationmustbestopped #rickygervaise behindthescenes #adrenochrome #lebronjames #humantraffickingawareness #organharvesting 333me.life now since they cancelled my Youtube like they cancelled #issackappy Good job every1 ,I feel so good that I'm dedicating my entire life into Channeling divEYEness, even tho the algorithm suppresses my content:eye::OK_hand_medium-dark_skin_tone:w3 ar3 th3 saviors-take care+stay aware. 333me.life
2039613771623468860; 0; False; 1557360930; #kobebryantdied in helicopter on #kobebryantcartoon in 2016 also:man_shrugging_medium-dark_skin_tone::thinking_face: #orwell #edwardsnowden #billgates #patent #viral #coronavirus #iran #china NSA #theylive #pedoelitist #epsteindidntkillhimself #orlandobrown #westworld #harveyweinstein #elsagate #oprah personofinterest #theylive #vacinnes humanity #plauge trending #kobebryantconspiracy #metzizahbpeh #pizzagate #pedophilialegalizationmustbestopped #rickygervaise behindthescenes #adrenochrome #lebronjames #humantraffickingawareness #organharvesting 333me.life now since they cancelled my Youtube like they cancelled #issackappy Good job every1 ,I feel so good that I'm dedicating my entire life into Channeling divEYEness, even tho the algorithm suppresses my content:eye::OK_hand_medium-dark_skin_tone:w3 ar3 th3 saviors-take care+stay aware. 333me.life
2231587067751027016; 1; False; 1580245956; “The line to pay fruits & vegetables today.”⁣ ⁣ ‪From wheretogooncein on Twitter.‬⁣ ⁣ #news #breakingnews⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣ #worldnews⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣ #coronavirus #wuhanvirus #wuhancoronavirusoutbreak #WuhanCoronavirus⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣ #coronavirusoutbreak #corona #ncov2019 #ncov⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣ #武漢肺炎 #武汉疫情⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣ #China #Wuhan⁣⁣⁣⁣⁣ #StandWithWuhan⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣ #LunarNewYear #NewYear #SpringFestival⁣⁣
2231587254187617349; 0; False; 1580245952; :police_car_light:Atenção :police_car_light:Ministério da Saúde sobe o nível de alerta de 1 para 2 após confirmação do 1º caso suspeito da doença no Brasil. #medicina #alerta #coronavirus #simego
2231586833658189981; 0; False; 1580245950; (BAŞTAN DİYORUM EĞER BANA ABONE OLMAZSAN SANADA BULAŞIRIM. SONRA SÖYLEMEDİ DEME) Afiyet olsun kanka Aq midesizi seni Bu serefsizden bulastığına dair iddialar var ortada #corona #coronavirus #virus #china
2231587155428077460; 0; False; 1580245941; 3- Barış Pınarı Harekatı bölgesinde düzenlenen bir bombalı araç saldırısında 3 Türk askeri hayatını kaybetti. #ww3 #coronavirus #sondakika #breakingnews #turkiye #2020 #virus #koronavirüsü
2231586870189152900; 6; False; 1580245932; The REAL TRUTH about the Coronavirus My new highly requested video that will uploaded at 2pm. Channel Link is in my bio cringey tags: #smallyoutuber #youtube #youtuber #youtube #subscribe #smallyoutuberarmy #smallyoutubersupport #smallyoutubers #smallyoutubercommunity #smallyoutuberscommunity #coronavirusmemes #coronavirus #coronaviruses #coronavirusoutbreak #coronaviruschina
2231587064628807524; 0; False; 1580245930; Saw this when I was out today. #coronavirus #toronto
2231586746037140595; 7; False; 1580245923; Home-brew meme, probably not even funny. Disclosure: Any circumstances that appear to resemble real life in this video are purely coincidental. Kind of :face_with_raised_eyebrow: Stay tuned:medical_symbol: J:man_guard_light_skin_tone: #coronavirus #wuhan #cdc #disaster #prepper #shtf #Ebola #aids #meme #china #un #news #disease #health #medicine #doctor #china #zombieoutbreak #virus #nurse #pandemic #plague #epidemic #outbreak #zombie #disaster #trump #maga #kag2020 #china #virus #medschool #doomer
2231586992326495671; 1; False; 1580245921; Herkese merhaba #ketojenik ailesi. Maalesef kış mevsimi ile birlikte virütik salgınlar arttı. Şu anda Çin'den yayılan ve Dünya Sağlık Örgütü WHO tarafından Wuhan koronavirüs salgını olarak adlandırılan virüs de 2019-nCoV etiketi ile virüs listesine eklendi. Semptom olarak soğuk algınlığı semptomlarını göstermesi nedeniyle müdahalelerde gecikme çok rastlanmakta. Ancak tarihe baktığımızda koronavirüslerinin MÖ 8000 yıllarına kadar uzandığını görüyoruz. Aslında bu virüslerle tanışıklığımız var ama sorun virüslerin mutasyona uğrayarak evrilmesi. Dönemsel olarak insanlık tarihini büyük salgınlarla da vurduğu biliniyor. Koronavirüslerin (kv) hayvan, insan çeşitleri bulunmakta ve insan (kv) leri soğuk algınlığı, viral pnomani, viral bronşit veya sekonder bakteriyel bronşite neden olabilmektedir. 2003 yılındaki SARS da bu (kv) lerden biri olarak bilinir. Bu tip salgınlarda ölümcül olma riski maalesef hep var zira şu andaki salgın için önleme tedavisi veya onaylanmış aşılar yok. Bu nedenle sizden ricam, lütfen önümüzdeki bir iki ay toplu taşıma araçlarında seyahat etmek zorunda iseniz eczaneden temin edebileceğiniz bir maske ile yolculuk yapın. Sadece bu önlem bile salgınların yayılma hızını önemli ölçüde düşürebilmekte. Salgınlar genelde büyük etkileşim alan kapalı mekanlardan yayılmaktadır. AVM'ler, metro, metrobüs ve İstanbul için Marmaray en riskli yayılım bölgeleri. Tüm toplu taşıma araçlarının gün sonunda dezenfekte edilmesi bir lüks değil zorunluluktur. Umarım yetkililer bu konuda gereken hassasiyeti gösteriyorlardır. Lütfen maskenizi takın. :warning: Unutmayın korumak, onarmaktan her zaman kolaydır. #ketojenikbeslenme #ketojenikyasam #ketojeniktarifler #ketojenikmutfak #kilovermekistiyorum #zayıflama #saglikliyasam #sagliklibeslenme #ketojenikdiyet #ketonyamaster #sismanlik #fithayat #zayıflamagünlüğü #sagliklitarifler #diyet #kilovermek #kilover #glutensiz #temizbeslen #diyethesaplaritakiplesiyor #diyetteyim #insülindirenci #diyetyemekleri #tüpmide #motivasyon #ketojenikrehberi #coronavirus
2231586953193648427; 2; False; 1580245916; Oh no...:face_with_medical_mask: Credits to:u/Cerseus01 :black_medium-small_square::black_medium-small_square::black_medium-small_square::black_medium-small_square::black_medium-small_square::black_medium-small_square::black_medium-small_square::black_medium-small_square::black_medium-small_square::black_medium-small_square::black_medium-small_square: Follow:@hilariousmile Follow:@hilariousmile :black_medium-small_square::black_medium-small_square::black_medium-small_square::black_medium-small_square::black_medium-small_square::black_medium-small_square::black_medium-small_square::black_medium-small_square::black_medium-small_square::black_medium-small_square::black_medium-small_square: To help me grow more: :right_arrow:Like,Comment,Follow :right_arrow:Send this to your friends :right_arrow:Save the post/Share it in your story :black_medium-small_square::black_medium-small_square::black_medium-small_square::black_medium-small_square::black_medium-small_square::black_medium-small_square::black_medium-small_square::black_medium-small_square::black_medium-small_square::black_medium-small_square::black_medium-small_square: #funny #public #memes #memepage #dank #dankmemes #darkhumor #share #follow #like #coronavirus #virus #epidemic #elonmusk #chinese #china #asia #mask #edgymemes
2231586929841538902; 8; False; 1580245914; #coronavirus got me like...:rolling_on_the_floor_laughing:
2231586813942823444; 0; False; 1580245900; #noticias #news #malaga #a #eltiempo #desafiodelbuda #Arenas #musica #follow #actualidad #loterianavidad #like #famosos #martes #lagos #nerja #torrox #deportes #velezmalaga #natal #noticia #politica #zafarraya #instagram #lagos #Axarquía #navidad #eltiempo #TorredelMar #coronavirus
2231586737388638579; 1; False; 1580245891; Compartí a tu amigo :hugging_face: . Seguime subo contenido diario :thumbs_up: . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . #meme #memeslatinos #memesespañol #memeespañol #memes:face_with_tears_of_joy: #sarcasticmemes #momos #momoslatinos #momoscorp #momosespañol #momosshidos #momoschidos #momosshidoris #momosad #humor #humorvenezolano #humorlatino #humorlatinoxd #memestgram #momoslimesproof#momaso #momasos#humorespañol #risas:face_with_tears_of_joy: #re100horneado#.#frasesinstagram.#apocalipsis . #umbrellacorporation #coronavirus .
2231586610369518111; 0; False; 1580245876; #coronavirus HOPE NOBODY SNEEZED ON THIS PAPERWORK #imdead The primary way that SARS appears to spread is by close person-to-person contact. SARS-CoV is thought to be transmitted most readily by respiratory droplets (droplet spread) produced when an infected person coughs or sneezes.  https://www.cdc.gov › about › faq #coronavirus #coronavirusmemes #sars #china #sneeze
2231586576890504835; 1; False; 1580245872; This is an avengers level threat Dont forget to like and follow @2_memes_ *If u want to support us you can donate using the link in bio* . . . . . . . . . . Just some # (~˘▾˘)~ . . .#memes #dankmemes #memesdailyjoy #kermitmemes #ocmemes #notgay #kermit #memesdaily #memesquad #memestgram #joke #jokes #offensivememes #car #puppy #area51 #fast #area51meme #area51raid #china #asia #simba #ps5 #chef #ww3 #trump #avengers #usa #police #car #coronavirus
2231585935296808701; 12; False; 1580245872; Boa tarde !!! Misericórdia MEU DEUS :astonished_face: Urgente urgente Em Wuhan, na China, ninguém entra, ninguém sai. Como é viver na cidade que é o marco zero do #coronavirus Veja o que dois brasileiros disseram ao #Fantastico #JornalNacional #G1 #GloboNews #BalançoGeralRJ #Hora1 #ボタフォゴホンダに来て “”” Sfl “””
2231586580933260820; 0; False; 1580245872; Sometimes it be ya own boi :pensive_face:#coronavirus #coronalime
2231585827703887718; 0; False; 1580245867; #mundo #brasil #china #virus #coronavirus #epidemia #vacina #cuidados #saude #vicencia #timbauba #recife #pernambuco #sus #ministeriodasaude
2231586425460144843; 0; False; 1580245854; #coronavirus #cina #virus
2231586372485196260; 2; False; 1580245847; Run because #coronavirus will catch the untrained ones first :face_with_tears_of_joy: - - - - - - - - - - - - - - - - #coronavirus #china #virus #wuhan #Coronavirus #coronavirusoutbreak #wuhanvirus #health #epidemic #wuhancoronavirus #marathon #running #run #runner #fitness #runningmotivation #instarunners #trailrunning #instarun #instarunner #training #runners #marathontraining #motivation #workout #sport #instagood #triathlon #nike #runningman
2231586374228931743; 0; False; 1580245847; What a twist of irony in Hong Kong :Hong_Kong_SAR_China: Now all the executives in the government are wearing masks .... along with the protesters! They are now eligible to join the protest marches! #coronavirus Could other countries start holding news conferences also wearing masks?
2231586357428339865; 1; False; 1580245845; You ain’t got the nerve Follow @flopi800 Follow @flopi800
2231586331339757168; 0; False; 1580245842; Manisa Akhisar ilçesinde 4.7 artçı deprem meydana geldi. Geçmiş olsun :sad_but_relieved_face::sad_but_relieved_face: #sondakikahaberler #haber #gündemhaberleri #gündem #coronavirus #deprem #manisa #bülten #haberler #dünya #news #world #türkiye #istanbul #izmir #zhaber #znews #2020 #amerika #yangın
2231586318872426186; 0; False; 1580245841; I heard the cure also requires lime. #coronavirus #coronalime #dead
2231586310888412474; 0; False; 1580245840; :call_me_hand_medium-light_skin_tone: #balkan #yugo #jugo #jugobetrugo #tito #balkanmemes #jokesfrombalkan #yugoslavia #memesfrombalkan #memes #meme #coronavirus #lol #bosnia #croatia #serbia #albania #kosovo #bosnien #bosnienundherzegowina #kroatien #serbien #slowenien #slovenia #balkanPeople #balkangirl #balkanboy #credittotwitter #twitter #credittoowner
2231586302424174831; 1; False; 1580245839; Virus korona dapat menyebar sangat pesat melalui kontak antar manusia dan berpotensi menyebarkan ke dua atau tiga orang lainnya melalui udara. Telah tercatat lebih 41 orang tewas dan lebih dari 1.400 orang terinfeksi di seluruh dunia, sebagian besar di China. Gejala penyakit yang disebabkan oleh virus korona ini antara lain demam, batuk, dan kesulitan bernapas. Virus adalah mikroorganisme yang “akrab” dengan manusia. Virus ada di hampir setiap tempat. Kelembapan udara yang tinggi seperti saat ini, membuatnya lebih mudah berkembang. Saat daya tahan tubuh menurun, maka dengan mudah berbagai virus tersebut dapat menginfeksi. Virus apapun, akan dapat menembus pertahanan tubuh siapapun, lalu memicu sakit, bila daya tahan tubuhnya rendah. Begitupun dengan virus korona. Jadi, langkah antisipasi terbaik agar tidak terserang penyakit yang disebabkan oleh virus, termasuk virus korona, adalah dengan menjaga sistem pertahanan tubuh agar tetap baik. Hindari berbagai vektor yang berpotensi membawa virus, jaga pola makan dan pola hidup sehat, serta tingkatkan daya tahan tubuh dengan suplemen kesehatan seperti “SULTAN” Madu Sari Kurma Plus dengan komposisi sari kurma, madu, dan angkak. Kandungan gula utama madu yang terdapat dalam “SULTAN” Madu Sari Kurma Plus adalah fruktosa, glukosa, dan sukrosa dapat diproses langsung oleh tubuh menjadi glukogen, sehingga khasiatnya untuk meningkatkan daya tahan tubuh langsung dapat dirasakan. Sifatnya sebagai antibiotik dan antibakterial alami membuatnya mampu membantu tubuh mencegah sekaligus melawan infeksi penyakit yang disebabkan virus dan bakteri. Dapatkan “SULTAN” Madu Sari Kurma Plus di mitrasalur Sut06 Denai secara online dan offline. Info lebih lanjut, hubungi: +62 812 64 696 111 www.shadnetwork.com/ahadi/ #madusarikurmaplus #suplemenherbal #kurma #peningkatHb #angkak #penambahtrombosit #viruskorona #suplemengizi #coronavirus #antivirusalami #antibiotikalami #sistempertahanantubuh #snw #komunitashalal #bisnismudah #bisnisberkah #bisnishalal #peluangbisnis #bisnissyariah #bisnismandiri #halalindonesia #peluangusaha #bisnissampingan #entrepreneur #wirausaha #CintaProdukHalalanThayyibanIndonesia #CintaProhati
2231586293430270336; 4; False; 1580245838; O Maria proteggici e fa che presto possa essere trovato un vaccino contro questo virus che sta preoccupando il mondo. Grazie o Madre del tuo amore. Amen #coronavirus #ReginadelRosario #verginedelrosario #Fatima
2231586261578522179; 0; False; 1580245834; Lmao :rolling_on_the_floor_laughing::rolling_on_the_floor_laughing::rolling_on_the_floor_laughing::rolling_on_the_floor_laughing: - - :ring::crown::smiling_face_with_horns::shark::joker::infinity::hundred_points::hundred_points::hundred_points::hundred_points: - - #SmudgeTheCatMemes #LadyYellingAtCat #Smudge #FunnyDeath #CoronaVirus #FuckYou #KungFlu #DemonicSharkKing
2231586239189843308; 0; False; 1580245831; China’s top pathogen research lab is in #Wuhan, the epicenter of the outbreak. #China #Coronavirus
2231583970775150529; 1; False; 1580245830; #cuba ve #jamaica da 7.7 şiddetinde deprem olduğu, görüntüler olay yerinden geldiği iddaa edildi. Görüntülerin Twitter’dan alıntı kesinliği yoktur.. - Daha fazlası için @dijitalmedyahaber . #bilim #bilimsel #inovasyon #virus #coronavirus #teknoloji #digitalartwork #digitalart #sağlık #takip #takipet . #çin #wuhan . #deprem . #elazığ #earthquake #göçük #bina . #cuba #cübadeprem #cubaearthquake #jamaica .
2231582306710210633; 0; False; 1580245829; #cuba ve #jamaica da 7.7 şiddetinde deprem olduğu, görüntüler olay yerinden geldiği iddaa edildi. Görüntülerin Twitter’dan alıntı kesinliği yoktur.. - Daha fazlası için @dijitalmedyahaber . #bilim #bilimsel #inovasyon #virus #coronavirus #teknoloji #digitalartwork #digitalart #sağlık #takip #takipet . #çin #wuhan . #deprem . #elazığ #earthquake #göçük #bina . #cuba #cübadeprem #cubaearthquake #jamaica .
2231586099311160578; 0; False; 1580245824; Coronavirus aler‪t in Birmingham as medics in hazmat suits quarantine suspected victim. ‬⁣ ⁣ ‪Medics in hazmat suits were sent to Drew Bennett’s, 39, home in Harborne on Monday and he was taken to the QE, where he remains in isolation awaiting results. ‬⁣ ⁣ ‪From HelloBham on Twitter.‬⁣ ⁣ #news #breakingnews⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣ #worldnews⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣ #coronavirus #wuhanvirus #wuhancoronavirusoutbreak #WuhanCoronavirus⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣ #coronavirusoutbreak #corona #ncov2019 #ncov⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣ #武漢肺炎 #武汉疫情⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣ #China #Wuhan⁣⁣⁣⁣⁣ #StandWithWuhan⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣ #LunarNewYear #NewYear #SpringFestival⁣⁣
2231585965133520591; 180; False; 1580245812; ¡'Wuhan jiāyóu'! ¡Wuhan, sigue adelante! Así exclamaban sus habitantes durante la noche. La ciudad permanece en cuarentena por ser el epicentro del coronarvirus, epidemia que ha dejado 106 muertos y unos 4.500 infectados en China. #coronavirus #wuhan
2231586023679484210; 14; False; 1580245811; How worried should you be about the coronavirus? Ohio officials are investigating two possible cases at Miami University, while the Centers for Disease Control and Prevention calls the disease -- from the same family as MERS and SARS -- an “emerging, rapidly evolving situation.” The disease has killed more than 100 people in China, where there have been 4,500 cases. Outside China there have been 60 cases, including five in the United States. It’s not time to freak out in the United States, obviously. But the disease can seem scary because of the unknown, said Dr. Elie Saade at University Hospitals. Click the link in our bio for more. // #cleveland #ohio #MiamiUniversity #health #coronavirus #usa #china
2231586008848070360; 0; False; 1580245804; #corona #coronavirus
2231585989619939894; 0; False; 1580245802; De momento ni un caso confirmado en España de #coronavirus, :microbe:así que como decía el Chapulín Colorado, "que no panda el cunico" Las medidas preventivas frente a esta epidemia vírica, son las mismas que para cualquier otra enfermedad respiratoria, y son normas de higiene básicas,:sneezing_face: así todos tranquilos y con un poquito de cuidado. :winking_face: Para cualquier duda, no olvidéis preguntarnos :face_with_medical_mask: #FarmaciaFigueruelas #Figueruelas #ConsultaATuFarmaceutico
2231585989376499777; 0; False; 1580245802; #coronavirus
2231585966183766641; 4; False; 1580245799; #futureprovespast #pizzagate #qanon #pizzagateisreal #maga #adrenochrome #wethepeople #draintheswamp #thegreatawakening #patriotsfight #wwg1wga #makespaingreatagain #protejamosalosniños #crimenescontralahumanidad #guerradememes #redpill #nativeamericansfortrump #amishfortrump #teoriadelaconspiracion #impeachment #BlacksForTrump #LatinosForTrump #womenfortrump #qanon8kun #spygate #HisNameWasSethRich #Bilderberg #democrats #coronavirus
2231585963706969664; 0; False; 1580245799; -new post:tornado: Uñas acrílica :woman_tipping_hand_light_skin_tone::green_salad::heart_suit: ∘∴⋅⋆*⋆⋅∴∘♡∘∴⋅⋆*⋆⋅∴∘ - ̗̀:linked_paperclips:feed: @feeds.blop - ̗̀:linked_paperclips:hour:03:09 - ̗̀:linked_paperclips:date:01/28/20 - ̗̀:linked_paperclips:segs: ∘∴⋅⋆*⋆⋅∴∘♡∘∴⋅⋆*⋆⋅∴∘ ꧁ACLARACIÓN꧂⊰cualquier comentario de odio o spam sera eliminado⊰ ⊰si usas da creditos o de lo contrario seras bloqueado⊰ ∘∴⋅⋆*⋆⋅∴∘♡∘∴⋅⋆*⋆⋅∴∘ sigue a @melisa_liang_19 y @selfcare__dark_ ∘∴⋅⋆*⋆⋅∴∘♡∘∴⋅⋆*⋆⋅∴∘ "amate a ti misma" ⇢:･ﾟ✵ :･ﾟ✧ :･ﾟ✵ *:･ﾟ✧:･ﾟ✵ :･ﾟ✧:･ﾟ -ˏˋ @selfcare__es__ ⌘ ⇢:･ﾟ✵ :･ﾟ✧ :･ﾟ✵ *:･ﾟ✧:･ﾟ✵ :･ﾟ✧:･ﾟ ∘∴⋅⋆*⋆⋅∴∘♡∘∴⋅⋆*⋆⋅∴∘ [:label:tags ignorar] #selfcare #colors #love #feeds #es #lindo #bonito #follow #bienvenidos #tags #adolescencia #selfcareawards #coronavirus #aburrimiento #iconostumblr #comida #expectativavsrealidad #crush #uñasacrilicas #uñas
2231585940840383557; 0; False; 1580245796; Jadinya ala-ala Resident Evil. nCov-2019 #CoronaVirus #coronavirusoutbreak #viruscorona #viruscoronachina #corona #virus #outbreak
2231585904804445423; 0; False; 1580245792; #elmochueloafilao #coronavirus #panilleros #seguimos #siguenos #comparte
2231585692773885799; 0; False; 1580245789; Follow for more hilarious posts @freshwickmemes.mp4 ................................................................................................................................................#meme #memes #funny #dankmemes #dank #memesdaily #cringe #tumblr #wtf #hilarious #lmao #offensivememes #shitpost #humor #relatablememes #meme #memes #funny #dankmemes #funnymemes #like #dankmeme #anime #edgymemes #comedy #dailymemes #instagram #coronavirus #memer #memestagram #memez #coronavirusmemes
2231585879275814536; 0; False; 1580245788; Historically, the Deep State and big pharma seem to find a new virus, or two, every year to drum up an ocean of fear, paranoia, and anxiety. Do you remember SARS, ZIKA, and Avian Flu? ••• Is this proof of a false flag or manufactured outbreak? ••• Research and decide for yourself. ••• Mr. Depopulation himself, Bill Gates, is front and center regarding the Coronavirus in my opinion. It’s just supposed to be a coincidence that his foundation co-hosted “Event 201” that just so happened to simulate this exact virus depopulating the planet by 65 MILLION people. ••• Give me a break. ••• I forgot the D in Melinda on slide 7. Whoops :woman_shrugging_medium-light_skin_tone: ••• #wwg1wga #billgates #thegatesfoundation #gatesfoundation #billandmelindagatesfoundation #coronavirus #depopulation #mms #kungflu #pirbright #pirbrightinstitute #redpill
2231585871719985121; 0; False; 1580245788; Quer ganhar dinheiro vendendo geladinhos deliciosos ? Então está é a sua oportunidade,ganhe de 1300 a 2000 reais por mês vendendo essas delícias. Para isso basta adquirir o nosso e-book com mais de 150 receitas para você. Se tiver interessado comente “eu quero” nessa publicação. #bolsonaro #sergiomoro #coronavirus #china #politica #noticias #geladinho #geladinhosgourmet #rendaextra #marketingdigital #vendasonline #palestine
2231585845228859839; 0; False; 1580245784; #corona #coronavirus #china
2231585806448031273; 0; False; 1580245780; #COFM#CORONAVIRUS
2231585774435105149; 2; False; 1580245776; #BREAKINGNEWS THIS IS #guaranteed #fact when a #comunist #chinese #government declares to the rest of the #world somethings #wrong IT'S already to late.. NOW I used to live in #Eastwood years ago & now it's one of the #biggest Chinese populated community's in #australia & they have themselves cancelled there #festival over concerns of the #coronavirus & everyone is walking around with masks on. THAT IS THE ANSWER THAT'S ALL YOU NEED TO KNOW.. you can not #trust our government for one reason only they are reliant on Chinese money to keep our #economy #balanced just look at #unsw with out Chinese #students it closes that is #fact Australia is #China's #bitch & the #USA #cunt we are #fucked ... #scomomustgo & if the #ALP was in power it would be #Albomustgo
2231585734591242464; 0; False; 1580245771; #futureprovespast #pizzagate #qanon #pizzagateisreal #maga #adrenochrome #wethepeople #draintheswamp #thegreatawakening #patriotsfight #wwg1wga #makespaingreatagain #protejamosalosniños #crimenescontralahumanidad #guerradememes #redpill #nativeamericansfortrump #amishfortrump #teoriadelaconspiracion #impeachment #BlacksForTrump #LatinosForTrump #womenfortrump #qanon8kun #spygate #HisNameWasSethRich #Bilderberg #democrats #coronavirus
2231585733541132498; 0; False; 1580245771; Muito cuidado! atenção e higiene redobradas #coronavirus #oms #saude
2231585730715201331; 1; False; 1580245771; Gerçekten Bitmiş mi Bir Bilgim Yok. . . @coronasalgini . . #takipcikazan #takipçikazan #coronavirus #corona
2231585724918682889; 0; False; 1580245770; Кинези само преносе тај вирус, па чак и у игрице #brawlstars #coronavirus
2231585617427507041; 0; False; 1580245757; #futureprovespast #pizzagate #qanon #pizzagateisreal #maga #adrenochrome #wethepeople #draintheswamp #thegreatawakening #patriotsfight #wwg1wga #makespaingreatagain #protejamosalosniños #crimenescontralahumanidad #guerradememes #redpill #nativeamericansfortrump #amishfortrump #teoriadelaconspiracion #impeachment #BlacksForTrump #LatinosForTrump #womenfortrump #qanon8kun #spygate #HisNameWasSethRich #Bilderberg #democrats #coronavirus
2231585538975241841; 8; False; 1580245748; Pessoal, temos visto nos jornais e TV o crescimento do coronavirus por todo o planeta e vale a pena tirar dois minutos do seu tempo para ler as informações acima, divulgadas pelo Ministério da Saúde (@minsaude). Há, ainda, um acompanhamento online dos países em que já existem casos relatados, que você pode acessar diretamente no link que está abaixo e também nos meus stories de hoje. #DelegadoPABLO #DeputadoFEDERAL #AmigoDoAmazonas #Coronavirus #Saúde #GovernoFEDERAL #PSL #Manaus #Amazonas #Brasil
2231585458932697406; 0; False; 1580245738; #epidemia #corona #coronavirus #memes #meme #epidemic #virus #chinese
2231585448783219076; 0; False; 1580245737; :sparkle:199$ - 7-7.5-9-9.5-10.5:sparkle: #yeezyboost380 #yeezyalien #yeezy380alien #yeezy380 #yeezystaticreflective #yeezy #yeezyreflective #yeezyblackreflective #pirateblack #pirateblackyeezys #yeezypirateblack #yeezy350pirateblack #yeezyboost350 #yeezyboost #yeezyboost #yeezy350v2 #yeezys #yeezy750 #yeezyrotation #yeezyseason #yeezymafia #yeezyboost350v2 #yeezysupply #yeezy2 m #hypebeast #sneakerhead #sneakernews #yeezy380alien #yeezy700v2 #kobe #kobebryant #coronavirus
2231585416839324546; 3; False; 1580245737; Every cold and flu season patients come in wondering how to best protect themselves from getting a cold or the flu. This year, patients are exceptionally worried due to the extensive media coverage surrounding the coronavirus outbreak. In light of this, I've decided to share a few recommendations that I've successfully used in clinic in order to hopefully put your minds at ease. . . . In addition to the basics such as washing your hands, sleeping well, staying hydrated, exercising and eating a nutrient-dense diet I usually implement an immune protocol with my patients, especially with those who are chronically stressed. Remember: high levels of cortisol suppresses your ability to fend off viruses. . . I use a combination of biochemically active vitamins and standardized botanical medicines that: -strengthen immune function -have anti-viral and anti-bacterial properties -prime the body's ability to produce antibodies. . . Keep in mind, every patient is different and every case requires different combinations at different dosages, however, here are some of my favorites that I've seen work well clinically: -high dose vitamin D3 (speak with your Doctor for dosing, high dose has to be prescribed by your ND). I like drops because vitamin D3 is a fat absorbable vitamin and when mixed with an oil we can achieve greater absorption. -Garlic extract (has anti-viral and anti-bacterial properties)-has to be standardized to contain allicin (active ingredient)- look for brands such as allimax. -andrographis complex by Mediherb (requires a prescription) -echinacea premium by Mediherb (requires a prescription) -astragalus complex by Mediherb (requires a prescription) -Broncafect by Mediherb (requires a prescription) -cold and flu rescue by SISU -Vitamin A drops (10 000IU daily) -Zinc citrate (30-50mg daily) -immune essentials by Xymogen -High dose intravenous vitamin C therapy (anti-viral) #immunefunction #mediherb #virus #viruses #coldandflu #fluseason #flu #cold #immune #integrativemedicine #natural #coronavirus
2231585428734080088; 2; False; 1580245735; :exclamation_mark::exclamation_mark::exclamation_mark::exclamation_mark::exclamation_mark::exclamation_mark::exclamation_mark::exclamation_mark::exclamation_mark::exclamation_mark::exclamation_mark::exclamation_mark::exclamation_mark::exclamation_mark::exclamation_mark::exclamation_mark::right_arrow: @coronavirusoffiziell :left_arrow: Подпишись и будь в курсе всех новостей о коронавирусе :police_car_light: Subscribe and stay informed #pray #prayer #nature #indonesia #sydney #carlinhosmaia #bbb20 #anitta #bts #justinbieber #newyork #prayforrevival #prayforhealing #hope #Jesus #life #viruscorona #love #помощь #coronavirus #коронавирус #вирус #virus #china #china:China: #ухань #китай #bbc #news #новости
2231585371196686128; 0; False; 1580245728; #coronavirus #virus #share
2231585314580076117; 1; False; 1580245721; #CoronaVirus #Hulkamania #Abs #Pythons #Brother #SexTape
2231585287963058591; 0; False; 1580245718; Repost @leangreenie If not for your health, if not for our planet, if not for the animals then FOR WHAT? . Farmers are literally burning the lungs of our planet to clear land for cattle in the Amazon rainforest. 1 billion wildlife were killed in the Australian fires because of climate change worsening the drought, we then culled 5,000 camels because they were "drinking our water". Now we see the Coronavirus, caused by consuming and handling dead animals. . The most powerful single thing you can do to help our environment, our health and the animals is shift to a vegan diet. . . . . . . . #animalagriculture #coronavirus #amazonfires #fire#bushfires #animals #animal #australia #australian#australianfirefighters #australianfires#endsuffering #endexploitation #speciesism#animalliberation #animalactivist #animallovers#vegetarian #vegan #veganism#leangreenie#govegan #veganlove #crueltyfree#vegansofig #veganlife #vegan #animallover
2231585278945617125; 0; False; 1580245717; #Repost @farmaciamuchavista with @make_repost ・・・ HOY queremos hablaros sobre las CLAVES del VIRUS que está afectando a la población China y que ya ha provocado numerosas muertes ----------------------------------------------- :right_arrow: Qué son los coronavirus? Los coronavirus son una amplia familia de virus que normalmente afectan sólo a los animales. Algunos tienen la capacidad de transmitirse de los animales a las personas. Producen cuadros clínicos que van desde el resfriado común hasta enfermedades más graves. --------------------------------------------------- :right_arrow: ¿Qué es el nuevo coronavirus (2019-nCoV)? Es un nuevo tipo de coronavirus que puede afectar a las personas y se ha detectado por primera vez en diciembre de 2019 en la ciudad de Wuhan, provincia de Hubei, en China. ----------------------------------------------- :right_arrow: ¿Cuáles son los síntomas del 2019-nCoV? Por lo que sabemos hasta ahora, los síntomas más comunes incluyen tos, dolor de garganta, fiebre y sensación de falta de aire. En casos más graves, la infección puede causar neumonía, dificultad importante para respirar, fallo renal e incluso la muerte. Los casos más graves, generalmente ocurren en personas ancianas o que padecen alguna otra enfermedad como por ejemplo, del corazón, del pulmón o problemas de inmunidad. --------------------------------------------------- :right_arrow: ¿De qué forma se puede adquirir la infección? Si bien no se conoce de forma precisa, por analogía con otras infecciones causadas por virus similares, parece que la transmisión sería a través del contacto con animales infectados o por contacto estrecho con las secreciones respiratorias que se generan con la tos o el estornudo de una persona enferma. -------------------------------------------------- :right_arrow: Existe un tratamiento para el 2019-nCoV? No existe un tratamiento específico para el nuevo coronavirus. Sí existen muchos tratamientos para el control de sus síntomas por lo que la asistencia sanitaria mejora el pronóstico. CONSEJO: Lavado de manos frecuente (agua y jabón o soluciones hidroalcohólicas) y evitar el contacto con personas que presenten los síntomas enumerados previamente. #saludpublica #coronavirus #farmacia
2231585225595410877; 0; False; 1580245711; Hvala @dragi_mimovac #brawlstars #coronavirus
2231585015903775817; 13; False; 1580245710; Ne oldu lan fazla artistlik yapıyordunuz adam olun adam takashi makat hiroshi .d #corona #virus #coronavirus #wuhan #china #corona #virus #turkey #usa #russia #sirke #korona #türkiye
2231585205664306675; 0; False; 1580245708; #futureprovespast #pizzagate #qanon #pizzagateisreal #maga #adrenochrome #wethepeople #draintheswamp #thegreatawakening #patriotsfight #wwg1wga #makespaingreatagain #protejamosalosniños #crimenescontralahumanidad #guerradememes #redpill #nativeamericansfortrump #amishfortrump #teoriadelaconspiracion #impeachment #BlacksForTrump #LatinosForTrump #womenfortrump #qanon8kun #spygate #HisNameWasSethRich #Bilderberg #democrats #coronavirus
2231585158905968482; 0; False; 1580245703; Depois da confusão de ontem e de baixas intensas, o mercado da SOJA fechou com estabilidade na CBOT. No entanto, as perdas acumuladas desde o início de janeiro passam de 7%. No Brasil, a saca já perdeu de R$ 4 a R$ 5 por saca em algumas praças do interior do país. O link para o fechamento completo no @noticiasagricolas , com a entrevista de Camilo Motter, da Granoeste, está no perfil. #soja #sojabrasileira #sojabrasil #mercadodasoja #soybean #agro #agronegocio #agricultura #agribusiness #noticiasagricolas #noticiasdoagro #campo #farm #farmer #China #corona #coronavirus #mercadofinanceiro #aversaoaorisco #commodities #mercadobrasileiro :seedling::peanuts::China::Brazil::dollar_banknote:
2231585159870150908; 0; False; 1580245703; Hey Guys I’m not worry about the #coronavirus, because I’m taking care of myself with too many of dietary supplements like those, high recommended, protect your kids! Love you guys stage safe please. #holdinghands #eatwell #greece_nature:blue_heart:
2231585157001837606; 13; False; 1580245702; بنات درت ليكم روتين ليلي خفيف ضريف شوفو ستوري :smiling_face_with_3_hearts::smiling_face_with_3_hearts: تصبحو على خير :red_heart: . . . . . #honfleur#honfleurtourisme#honfleurterredestuaire#honfleurgallery#outfit#outfitinspirationbyme#outfitideas#outfitoftheday#shein#hm#zara#chanel#influenceuse#mode#lifestyle#goodvibes#bambi#makeup#mer#photography#weekendenfamille#paris#coronavirus#bambieyes#hairstyle#holidays
2231585157620561848; 0; False; 1580245702; :face_with_tears_of_joy::face_with_tears_of_joy:...cough...oh shit.. #illmissyouguys #coronavirus #antfw
2231585135619329645; 0; False; 1580245700; El Wuhan Zall, equipo de fútbol de la ciudad china de #Wuhan, llegará este miércoles a #Málaga para una concentración de pretemporada, sin presentar sintomatología del #coronavirus, brote que ha tenido su epicentro en esta población asiática.
2231585107608575552; 0; False; 1580245696; Theme: game changers 1. Signals #haiku #prose #poetry #photojournalism #streetphotography #shotoniphone #photography #expressionism #inkwash #sumie #Haiga #art #anthropocene #flowers #Jesus #alberteinstein #relativity #coronavirus #history #historical #change #incommon #shared #medicinalplant
2231585101837733397; 0; False; 1580245696; Anime is p good tho and ngl he look kinda thicc too:eyes::eyes::eyes: #corona #coronavirus #winnietheflu #anime #freerange #organic #dank #meme #tbt #dankmemes #justinbieber #owo #uwu
2231585003756818729; 7; False; 1580245684; Allyuh want #coronavirus Madd ting !!! I know somebody that would curry that shit :weary_face::weary_face::weary_face:
2231584970405970527; 0; False; 1580245680; Just a wake up call to everyone. This is the artwork from the Denver International Airport aka bad guy HQ (one of them). Get your hearts right with the one and only maker and his one and only son. Open your eyes and see what they are doing and realize, it's no coincidence. They're proud of what they're doing as written on the guidestones. Picture 1. Coronavirus (notice his gas mask) Picture 2. Wildfires and destruction, cancer, animals and children dying Picture 3. Immigration to cause chaos and disrupt from their ultimate doings on. (Notice the skeleton and spiked collar on the bottom right) Don't ask for your will to be done, ask for God's will to be done. Seek the truth, no matter the cost. Keep love in your heart and when you say you forgive, let go and forgive. #denverinternationalairport #georgiaguidestones #coronavirus #wuhan #mexico #america #death #wake #togetherwestand #dividedtheywin #hateartsucks #effthesystem #wildfires #australia #cancer #destruction #forgive #lovecuresall #13 #bloodlines #rulethemall #notme #nosheephere #wearenotherd #oneGod #Jesus
2231584853678235423; 2; False; 1580245666; "A suo figlio manca l'esavalente e mi chiede il Coronavirus?!" . . . . #assistenzasanitaria #assistentisanitarie #assistentisanitari #assistentesanitaria #assistentesanitario #studenteassistenzasanitaria #vaccini #vaccino #virus #coronavirus #novax #antivax #salute #prevenzione
2231584470568304485; 0; False; 1580245665; Bahaha! I love him so much!!!#thedailyshow #china #coronavirus #trevornoah #jamaicans
2231584747200392803; 0; False; 1580245654; Погибшие и пострадавшие на 28.01.20 По данным ВОЗ, заражены 2798 человек (из них в Китае 2753). Национальная комиссия по здравоохранению Китая сообщила о 4515 подтвержденных случаях. Согласно данным Национальной комиссии, 976 человек находятся в больницах, 60 выписаны. 106 человек умерли. #coronavirus#china#news#coronavirusoutbreak#folow4folow#likeforlikes#people#virus
2231584743392474746; 0; False; 1580245653; GP idag: Min man i farten #munskydd #coronavirus #välgörenhet #geelydonerartillviruskampen #fullfart #mediafokus #gp #göteborg #china
2231584683054311468; 0; False; 1580245646; Ya tenemos el antídoto jajajajaj . . . #corona #colombia #tolima #arauca #popayan #villavicencio #neiva #villanueva #cucuta #vallenato #valledupar #reggaeton #coronavirus #salsa #pop #rap #santamarta #popular #barranquilla #cartagena #bogota #cali #tunja #pereira #medellin #bucaramanga #sincelejo #monteria #sanandres #riohacha
2231584513962956208; 0; False; 1580245626; Hoy hablando sobre la coronavirus: qué es?, síntomas, y cómo prevenir el contagio @univisionaz con @lilianasalgado #univisionaz #coronavirus #physicianassistant #medicine#clinicalafamilia
2231584484218431780; 0; False; 1580245622; #REPOST #SHARE For those in affected countries: Buy: lysol, masks, alcohol, peroxide, hand sanitizers the likes #today #january #world #disease #cure #prevention #coronavirus #getwellsoon #health #body #healthy #china #chinashutdown #chinaoutbreak #virus #protection #viral #earthquake #earth #sicknesses #2020 #help #helpingothers #preventionisbetterthancure #share #repost #reposting #asia
2231584470360757685; 16; False; 1580245621; Le parole di #RobertoBurioni a #CTCF sul #coronavirus :pushpin: #viruscinese
2231584477390178539; 0; False; 1580245621; Official cases of the Wuhan Corona Virus doubled overnight. Some people have been put on house arrest, and we are only a few days into the quarantine. https://www.breitbart.com/asia/2020/01/28/china-has-not-accepted-u-s-offers-to-send-cdc-experts-to-aid-in-coronavirus-fight/ #wuhanflu #coronavirus #wuhan #china #cdc #plague #quarantine
2231584472649161751; 2; False; 1580245621; Tam da bu konuda Veteriner Hekimlerden neden destek istenmiyor diye düşünürken , kedilerden köpeklerden de geçermiş diye yazılanları okurken Sevgili @yalcinebru2 Hocamız karışık kafalara bir ışık tutmuş. #coronavirus #coronavirüsü #kedi #köpek #köpekeğitimi #köpekeğitmeni
2231584446117606615; 0; False; 1580245618; :radioactive::exclamation_mark::radioactive:Граница Китая с Россией - 4209,3 км: это самая длинная граница КНР с другой страной. Россия закрыла границу с Китаем из-за вспышки заразного коронавируса на территории КНР. :biohazard:#coronavirus :biohazard:#коронавирус2020 #вирус Источник https://news.liga.net/world/news/rossiya-zakryla-granitsu-s-kitaem-iz-za-koronavirusa
2231584450344819151; 0; False; 1580245618; Prestate attenzione cari medici . by -founder #memesdaily #meme #coronavirus #blackhumor #dankmemes #memes:face_with_tears_of_joy:
2231584363068581844; 0; False; 1580245608; #masshysteria #coronavirus
2231584309248395412; 0; False; 1580245601; Gift of life. #coronavirus #depression #cancer #vegasstrippers #newyorkcity #texas
2231584277976388417; 0; False; 1580245598; Faith brothers: @schwarzer_als_baumwolle @schwarzesladekabel @der_schwarzfahrer_ Tags: #meme #schwarzerhumor #funny #blackhumor #humor #likes #911 #911memes #worldtradecenter #wtc #minecraft #christmas #porn #pornhub #dominospizza #edgymemes #mac #apple #tech #new #technics #computer #pc #imac #imacpro #kobebryant #worldwar3 #ww3 #ww3memes #coronavirus
2231584254353404926; 0; True; 1580245595; Protecting myself :face_with_medical_mask: from coronavirus :microbe:Specially, I’m always in and out in the hospital #coronavirus
2231584189324458971; 0; False; 1580245587; Interesting point of view #coronavirus #china #sarsvirus #ebola
2231565089369373466; 0; False; 1580245584; Matthew 23:9 And call no man your father upon the earth: for one is your Father, which is in heaven. #coronavirus #pope #slapahoe #getback #popefrancis #coronavirusmemes
2231584031024378760; 0; False; 1580245583; :folded_hands::broken_heart::folded_hands::broken_heart::folded_hands: #Repost @fightdogmeat_dot_com (@get_repost) ・・・ CHINA: Haven Dogs Running Out Of Food. The coronavirus epidemic is affecting the Haven Sanctuary. They can’t buy kibble and there’s no deliveries. They need to buy sacks of rice for 200+ dogs, while they can. Please help if you can: PAYPAL: Donate@FightDogMeat.com. Fight Dog Meat. Registered Charity. #fightdogmeat #dog #dogs #china #china:China: #coronavirus #coronavirusoutbreak
2231584120914745095; 41; False; 1580245579; Only beer I know is takbeer u/mistermuesli . . . . . . . . . . #muslimhumor #muslimmemes #muslimhumour #muslimmeme #halalhumour #halalbanter #humormuslim #halalhumor #americanmuslims #americanmuslim #usmuslims #usmuslim #corona #coronavirus
2231584083091520790; 0; False; 1580245574; Go to the #CDC website for more info #washyourhands #dontfreakout #publichealth #psa #coronavirus #ncov2019 #illness #respiratoryillness
2231583973988883368; 0; False; 1580245561; What a Year #2020 #memes #meme #memepage #memer #memelucu #memes:face_with_tears_of_joy: #corona #coronavirus #ww3 #china #simpsons
2231583964762406422; 0; False; 1580245560; @coronavirusworldwide @coronavirusworldwide @coronavirusworldwide . Follow .follow Corona virus :microbe: #coronavirus #virus #germs #health #california #worldwide #instagram #keepclean #2020#usa #kids #adults #china cdc##pennsylvania #texas #florida #delaware #colorado #maryland #massachusetts #illinois #arizona #utah #tenessee #iowa #southdakota #connecticut #hawaii #kentucky
2231583925175922835; 0; False; 1580245556; LGA is empty. Guess the fear of the Coronavirus is really. There is barely anyone on my flight :airplane:. My :woman_health_worker: friend said we should be more scared of the “bad flu” :face_with_medical_mask: going around the US. On my way to an Entrepreneur Conference to learn, network and make stuff happen! #entrepreneur #entrepreneurlife #coronavirus #flu #empty #travel #travelsafe #fear #makeithappen #bigrock #bestu #shitwillhappen #youcandoit #pushpastyourfears
2231583833864979912; 0; False; 1580245545; admin #edgy #memes #coronavirus #elonmusk #kobe
2231583832239175239; 0; False; 1580245544; Inspiré d'une histoire vraie (c'est même pas inspiré c'est actuellement mon histoire xD) #memes #memefrancais #coronavirus
2231583800855673139; 0; False; 1580245541; Jajajajaja legal :face_with_tears_of_joy::rolling_on_the_floor_laughing::face_with_tears_of_joy::rolling_on_the_floor_laughing: #triviasv #tuza #sivarescuela #colegio #memeros #tusa #meme #añonuevo #memes #momos #momazos #hermanas #sivar #sanvalentin #usulutan #launion #elsalvador #hermanos #seguime #siganme #siganmeparamasrecetas #memes #nostalgia #vacaciones #pilsenervirus #adiosvacaciones #elsalvadormemes #regresoaclases2020 #elcherovacilon #coronavirus
2231582584433757801; 2; False; 1580245536; Não seja radical você irá assustar e afastar as pessoas do veganismo, será mesmo??? Será que só com palavras bonitas as pessoas deixarão de comer animais??? ,explorar animais ridicularizar animais humilhar animais assassinar animais???,.....será que a pura verdade falada escrita falada e mostrada não é melhor do que ficar dando voltinhas enquanto bilhões são torturados e mortos,os radicais entraram em matadouros, fizeram vídeos, falaram a verdade ,invadem favelas para salvar animais ,fazem motim contra grandes empresas,espalham panfletos sem isto a grande maioria estaria ai na inércia do ativismo pacato , porque somos radicais com o racismo com o sexismo,e não tá certo ????claro que tá ,e porque que com o Especismo temos que esperar o tempo de cada pessoa???? ,será que temos que esperar o tempo do racista do sexista do pedófilo??? Claro que não!!!!o Especismo a mesma coisa temos que ser radicais sim ,existem seres inocentes morrendo e sendo torturados a cada segundo ...Reposted from @nom_aly (@get_regrann) - We have been conditioned for so long to not think about the animals who had suffered for that piece of meat. . For you, it was a piece of meat. For them, it was their whole life. . I hope that today is the day that you can make that connection. :seedling: . Empathy. . Because you are the change you wish to see in this world. . #animal #animals #animalsofinstagram #animalsofinsta #animallover #animallovers #liveandletlive #vegan #vegans #vegansunited #govegan #govegan:seedling: #govegan2020 #wuhancoronavirus #wuhanvirus #wuhancoronavirus #wuhanpneumonia #coronavirus #coronavirus2020 #coronavirusoutbreak #coronaviruschina #coronaviruses #china #china:China: #mainlandchina #chinamainland #goveganfortheplanet #goveganfortheplanet:globe_showing_Americas: #goveganforyourhealth #goveganfortheenvironment #goveganfortheanimals:green_heart::pig_face::cow_face::hatching_chick::pig::boar::rabbit_face::chicken::fish::dolphin::whale::monkey_face::goat::ram::dog::cat_face::green_heart:
2231583760743082768; 0; False; 1580245536; Gerçekler serimize devam edelim... 2-İran'da Ukrayna Havayollarına ait Boeing 737 tipi yolcu uçağı kalkışından kısa süre sonra düştü. 167 yolcu ve 9 mürettebatın bulunduğu uçaktan sağ kurtulan olmadığı açıklandı. #2020 #doomsday #coronavirus #sondakika #breakingnews #ww3 #virus
2231583654659425676; 0; False; 1580245523; Mentre l’Oms lancia l’allarme globale sul #Coronavirus, i contagi si moltiplicano di ora in ora e le strade di Wuhan vengono blindate per impedire alle persone di fuggire, cosa sta aspettando il nostro Ministero degli Esteri per rimpatriare i nostri connazionali ancora bloccati lì? USA e UK hanno provveduto a evacuare i loro cittadini già da domenica, mentre 70 italiani sono bloccati in casa da giorni in quella che è diventata una città fantasma.
2231583385386651480; 0; False; 1580245516; :exclamation_mark::exclamation_mark::exclamation_mark::exclamation_mark::exclamation_mark::exclamation_mark::exclamation_mark::exclamation_mark::exclamation_mark::exclamation_mark::exclamation_mark::exclamation_mark::exclamation_mark::exclamation_mark::exclamation_mark::exclamation_mark::right_arrow: @coronavirusoffiziell :left_arrow: Подпишись и будь в курсе всех новостей о коронавирусе :police_car_light: Subscribe and stay informed #pray #prayer #nature #indonesia #sydney #carlinhosmaia #bbb20 #anitta #bts #justinbieber #newyork #prayforrevival #prayforhealing #hope #Jesus #life #viruscorona #love #помощь #coronavirus #коронавирус #вирус #virus #china #china:China: #ухань #китай #bbc #news #новости
2231583515669251520; 1; False; 1580245510; A worker operates machinery to dispose of medical waste at a medical waste treatment company in Yangzhou City, Jiangsu Province, China. China's Ministry of Ecology and Environment on 23 January has urged local authorities to properly supervise and manage the treatment of medical waste produced while fighting the coronavirus outbreak. The outbreak of coronavirus in China has so far claimed at least 100 lives and infected more than 4,500 others, reports state. :camera: epa-efe #CoronavirusOutbreak #Coronavirus #outbreak #disease #facemasks #Wuhan #epidemic #WuhanPneumonia #China #photojournalism #epaphotos
2231583505569447624; 0; False; 1580245505; #CoronaVirus Follow @da_virgin_memes ⁣ ⁣ ⁣ ⁣ ⁣ ⁣ #memed #memelord #memes #meme #dankmemes #memesdaily #memesespañol #memes:face_with_tears_of_joy: #memesgraciosos #memestagram #memestagram #memer #memez #memepages #l4l #lforl #likeforlikes #likeforfollow #follow4follow #follow4followback #followforfollowback #followｍe #shoutoutforshoutout #promo4promo #jokes #joke #joker #jokesfordays #relatable #relatablememes⁣
2231583490889349178; 0; False; 1580245504; Better safe than sorry? . . #chrysler #chrysler300 #dodge #mopar #moparornocar #moparnation #moparmadness #moparworldwide #hemi #hemi345 #345hemi #v8 #srt #rt #slp #spectre #spectreperformance #amerihood #hellcat #srthellcat #tazer #diablosport #diablo #coronavirus #n95
2231583479708134335; 8; False; 1580245502; TRAVEL SAFE :luggage::cross_mark::face_with_medical_mask: Mascarillas de protección frente a partículas: sólidas y líquidas. Especialmente indicadas para virus, incluido el coronavirus. #coronavirus #virus #saftyfirst #healthylifestyle #drogueria #vintage #calidad #especialistas #emblemático #centenaria #galvany #barcelonagram #barcelonacity #barcelonainspira #instagram#goodlife#fashion#new#arrivals
2231583463155202538; 0; False; 1580245500; Expect a rise in price for tech due to the Coronavirus. Many factories in China have shut down, and production of electronics will slow down or come to a complete halt. With this also expect a drop in stocks in technology based companies based in China and nearby. Link for more information and details- https://www.investors.com/news/technology/china-stocks-in-tech-hammered-as-coronavirus-fears-spread/ #stocks #coronavirus #technews #technology
2231583441839844800; 0; False; 1580245498; LOL @ “Temporarily” :face_with_tears_of_joy::grinning_face_with_sweat::weary_face: Fucking SAVAGES, them #chinese in #china #prc !!! Let’s hope the #coronavirus WILL be doing what God meant it to do: #decimate #china:China: #prc but NOT #hongkong #hongkong:Hong_Kong_SAR_China: or #taiwan #taiwan:Taiwan: or #tibet #tibetans or #uighurs #xinjiang
2231583282885948274; 0; False; 1580245479; In our globalized world, disease oubreaks are no longer local. Translators and interpreters can help provide vital health information to people from all over the globe. When translating about topics like #CoronaVirus it's important to ensure information is accurate, consistent, and disseminated effectively. #translation #medicaltranslation #healthforall #languagematters #globalimpact #international #outbreak #virus #twbtranslators #humanitatiantranslators #humanitarianaid #peoplematter
2231583286130644530; 0; False; 1580245479; #memes #mem #memes:face_with_tears_of_joy: #meme #lol #kek #pablic #coronavirus #memestagram #memepage #memelife #memua #memru #ukraine #lalka #instagram #life #cool #nice #instalike #witcher #мемы #мем #мемчики #лол #кек #чебурек #коронавирус #ведьмакузаплатитечеканноймонетой #ведьмакузаплатитезачтётсявсёэто
2231583236639626513; 0; False; 1580245473; Be responsible to yourself...prevention is the key~ support Wuhan~ #coronavirus #wuhan #prevention #facemask
2231583189931875307; 0; False; 1580245468; Red White and Glorious Blue skies this morning at a #coronavirus free Chinatown this morning :face_with_tears_of_joy::beer_mug:
2231583003988548241; 1; False; 1580245462; Todo lo que debes saber del #coronavirus :microbe: Artículo para el periódico Canario @atlanticohoy dejando toda la información sanitaria que sabemos sobre este problema de salud pública. Es muy importante que el #farmaceutico transmita calma. Actualmente en españa no hay casos confirmados de este virus que se propaga fácilmente como el virus de gripe y que tiene síntomas similares a un resfriado o una gripe. :white_heavy_check_mark:Dolor de cabeza :white_heavy_check_mark:Fatiga :white_heavy_check_mark:Fiebre :white_heavy_check_mark:Dolor muscular :white_heavy_check_mark:Tos seca :white_heavy_check_mark:En determinados casos neumonías complicadas con potencial gravedad. :biohazard::radioactive:Prevención con mascarillas(sobre todo las tipo II) , lavados de manos frecuentes con agua y jabón y uso de soluciones hidroalcoholicas, evitar aglomeraciones , cubrirte la boca al toser o al estornudar con un pañuelo o con la parte interna del codo, con cuidado de hacerlo en el transporte público y evita el contacto con animales de granja. El coronavirus tiene este nombre por su aspecto a una Corona y ya desde diciembre de 2019 aparecieron los primeros casos en Wuhan, región de china de 12 millones de habitantes. Dentro de esta familia de virus podemos ver al del resfriado y ya tuvo casos importantes en 2002 y 2003 con el Mers y Sars. Se cree que apareció desde un murciélago :bat:o una serpiente:snake:desde el mercado de Wuhan. El virus es zoonotico, pasa de animales a humanos y actualmente sabemos que de humanos a humanos también incluso sin presentar síntomas. Consulta con un profesional sanitario y mantén la calma. El @farmaceuticos__ Está para resolver tus dudas referente a este tema. #coronavirus #wuhan #consejofarmaceuticp #prevencion
2231583136278659839; 1; False; 1580245461; Todos viram que a OMS admitiu erro e classificou na segunda-feira como elevado :double_exclamation_mark: o risco internacional do Coronavírus, depois de ter classificado ele como moderado na semana passada. . A doença está causando mortes na China, e já foi detectada em outros países, como Tailândia, Austrália, Singapura, entre outros. . O CONTÁGIO ENTRE HUMANOS se dá pelo ar. A pessoa contaminada pode transmitir pela tosse ou espirro. Em CASOS MAIS GRAVES pode causar uma síndrome respiratória aguda grave e insuficiência renal. PARA PREVINIR é necessário sempre lavar bem as mãos, cobrir a boca ao espirrar ou tossir, cozinhar bem carnes e ovos, e evitar lugares muito fechados com multidão. . Cientistas pelo mundo estão estudando novo vírus e o instituto Nacional de Saúde dos Estados Unidos deverá testar vacinas contra o #coronavirus em humanos em até três meses. . . . #saude #health #laboratorio #analisesclinicas #biomedicina #biomedico #hospitais #vacina #virus #medico #medicina #patologista #patologiaclinica
2231583069679626098; 0; False; 1580245454; Dalam foto tertanggal 28 Januari 2020 ini, seorang petugas di PT Indonesia Morowali Industrial Park (IMIP) memeriksa suhu tubuh tenaga kerja asal Cina di kawasan tambang nikel perusahaan tersebut di Morowali, Sulawesi Tengah. Kompleks industri nikel milik perusahaan Cina itu mengkarantina 3.000 pekerja asal Cina menyusul kedatangan 600 pekerja baru dari Cina pekan lalu, termasuk 15 orang dari Wuhan, ibu kota Provinsi Hubei di Cina di mana virus corona pertama kali ditemukan. IMIP mempunya 31.000 karyawan oleh karena itu perusahaan tidak mau mengambil resiko, dan telah menghentikan kedatangan pekerja baru dari Cina untuk sementara mulai tanggal 25 Januari. Di Cina sendiri per 28 Januari dilaporkan wabah virus corona telah membunuh 106 orang dan 4.500 orang lainnya telah terjangkit di daratan Cina. Foto: Dok. PT Indonesia Morowali Industrial Park #Coronavirus #viruscorona #IMIP
2231583045796963646; 2; False; 1580245451; Wondering what you can do to reduce your risk of coronavirus infection? We’ve broken it down for you with an easy to remember way to help reduce your risk. It’s important to WAATCH out for yourself! #coronavirus #infection #healtheducation #healthliteracy #jumohealth
2231582974225585472; 0; False; 1580245448; Sígueme para más Etiqueta a tus amigos . . . . Tags: #momos4k #memes #meme #memesenespañol #videosderisa #videos #videosgraciosos #dankvideos #videosrandom #risa #gracioso #youtube #minecraft #sdlg #momoscorp #coronavirus #luisitocomunica #legionmomo #legionholk #instalike #ranvi #ranvideos
2231583011865768165; 2; False; 1580245447; The cure at last #coronavirus
2231582939085674533; 0; False; 1580245438; Happy Chinese New Year! Don't forget your SARS-mask! #newyear #popart #comic #china #chinesenewyear #sars #coronavirus #meme #surgicalmask
2231582629296418832; 0; False; 1580245434; Karena bahaya Corona virus.. empus pun beralih vegetarian . . . #corona #coronavirus #cat #cutecats
2231582730697944766; 3; False; 1580245432; Germany confirmed that a 33-year-old man is the country's first known case of ‪coronavirus.‬⁣ ⁣ ‪From QuickTake on Twitter.‬⁣ ⁣ #news #breakingnews⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣ #worldnews⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣ #coronavirus #wuhanvirus #wuhancoronavirusoutbreak #WuhanCoronavirus⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣ #coronavirusoutbreak #corona #ncov2019 #ncov⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣ #武漢肺炎 #武汉疫情⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣ #China #Wuhan⁣⁣⁣⁣⁣ #StandWithWuhan⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣ #LunarNewYear #NewYear #SpringFestival⁣⁣ #Germany #GermanyCoronavirus
2231582756071292445; 1; False; 1580245430; Sígueme para más Etiqueta a tus amigos . . . . Tags: #momos4k #memes #meme #memesenespañol #videosderisa #videos #videosgraciosos #dankvideos #videosrandom #risa #gracioso #youtube #minecraft #sdlg #momoscorp #coronavirus #luisitocomunica #legionmomo #legionholk #instalike #ranvi #ranvideos
2231582868673348322; 2; False; 1580245430; #IMPORTANTE| Comunicado Oficial - Caso asociado a sospecha de #coronavirus #ecuador. |Vía Twitter @Salud_Ec
2231582290253682177; 4; False; 1580245361; Coronavirus is real
2231582105813433014; 1; False; 1580245339; None
2231580735709691733; 1; False; 1580245175; ⁣#qinjunjie recently donated ¥200,000 to the China Siyuan Foundation for Poverty Alleviation. Let’s all pray that everyone in China will have peace and good health soon. Take care, everyone! Fighting:flexed_biceps: ⠀ 秦俊杰最近給中華思源工程扶貧基金會捐贈了20萬元。希望所有中國境內的人都能早日得到平安、健康。大家保重啊！加油 :flexed_biceps: ⠀ ⠀ Source 資料來源: China Siyuan Foundation for Poverty Alleviation 中華思源工程扶貧基金會/Weibo (photo) #qinjunjiefanpage #qinjunjie #epidemic #wuhan #coronavirus #chineseactor #masks #virus #pneumonia ⠀ #秦俊杰 #秦俊傑 #秦俊杰粉絲專頁
2231580145622302892; 0; False; 1580245105; #werbung Viren auf dem Vormarsch...wie du dich schützen kannst..... erfährst du bei mir. #MoreQualityForYourLife #viren #Bakterien #influenca #coronavirus
2231579514748875277; 2; False; 1580245030; O Coronavírus vem de uma grande família de vírus, que acometem praticamente todas as espécies de répteis a mamíferos. Mas, o que se sabe até então é que apenas seis deles infectam humanos (agora sete com o mais novo descoberto). . Mas, por que o coronavírus é tão perigoso? Além de vir de uma família grande, sabemos que Coronavírus diferentes podem sofrer mutações, recombinando-se e originando um novo tipo de coronavírus. . Os sintomas do Coronavírus são semelhantes aos de outras doenças respiratórias. Tosse, febre, falta de ar e dificuldade de respirar. Podendo evoluir para pneumonia e síndrome respiratória aguda. . Caso esteja com algum desses sintomas, é de extrema importância procurar imediatamente um agente de saúde. . Apesar de ainda são terem sido confirmados casos no Brasil, cerca de 12 países já detectaram a presença do vírus. . @hospitalmemorialsf
2231577873188384002; 0; False; 1580244908; Koronavírus #koronavirus #coronavirusoutbreak #coronavirus . . . . (nemsajat)
2231578143913858382; 1; False; 1580244866; Are face mask need it? Nobody knows for sure, but Corona virus are spread through cough, sneeze, or touching an infected surface. The ideal situation everybody will be to use an astronaut suit :crescent_moon: although for now the expert are recomending to wash your hands :raised_hand: in an efective way for reduce potential infections. Also use a alcohol- based hand sanitizer
2231577825600988554; 0; False; 1580244832; CNO is engaging with the Ministry of Health and Long-Term Care to mitigate the spread of the novel coronavirus (also known as 2019-nCoV), and to protect the health and safety of patients. The Ministry of Health and Long-Term Care is creating a website for health care professionals to provide up-to-date information. A public website is already available. In the meantime, you can be proactive by reviewing your accountabilities on our Infection Prevention and Control page, which links to relevant practice standards and external resources. If you’re a nurse with questions about your accountabilities when caring for patients affected with the new coronavirus, email us: practicesupport@cnomail.org. WHAT IT IS: In December 2019, the novel coronavirus emerged in the city of Wuhan, China. Since then, this respiratory virus has been reported in multiple countries, including Canada. Symptoms of the virus range from mild to severe. They can include fever and cough, difficulty breathing, pneumonia and kidney failure. In severe cases, it can cause death. CNO understands the impact of this outbreak on nurses involved with direct patient care. We are closely monitoring this situation and will continue to provide updates as we learn more. MORE INFO IS AVAILABLE: Click the link in our bio to read CNO's statement on the coronavirus, or to learn about the new coronavirus from World Health Organization, visit the Ministry of Health and Long-Term Care’s public website, or to read the Ministry's case definition of a person who has been exposed to the virus. #coronavirus #nursing #ontarionurses
2231561166588341853; 0; False; 1580242842; :warning::warning: #coronavirus :double_exclamation_mark::double_exclamation_mark: Credit: @princesspurple_2525
2231558283884368612; 0; False; 1580242499; I don't wanna play here anymore. #Brat #MemesForDays #Comedy #MemeAddicts #Quotes #HoeQuotes #BitchQuotes #Memes #BDSMSub #Relatable #HoeMemes #Dom #Sub #BitchMemes #BDSM #BDSMCommunity #AlphaMales #WW3 #Slave #Fetish #DiscoverPage #DaddyAF #DaddyKink #Bratty #KinkyShit #FuckBoy #GoodGirl #CoronaVirus #Alpha #Sir
2231531358197587610; 1; False; 1580239289; None
2231530548352812270; 1; False; 1580239193; Coronavirus: a large :family: family of viruses.- Great! Because the flu is not enough. The name comes from its shape; :beer_mug:- not corona beer, but the solar corona when imaged using a microscope. The virus is transmitted through the air, and primary infects upper respiratory and gastrointestinal track of mamals and birds. Sorry, looks like sick birds could be able to fly wherever you are. :bird: :sad_but_relieved_face:, but there is a lot we can do if we are well inform about it. :grinning_face_with_big_eyes: We are making this Channel to :closed_mailbox_with_raised_flag: share information, and help spread the word. Please feel free to coment, tag, and share. The more we know the more prepare we could be. :heavy_check_mark:
2231449944181803849; 1; False; 1580229584; #Coronavirus #montagemaison
2231313290588472482; 0; False; 1580213304; :rolling_on_the_floor_laughing::rolling_on_the_floor_laughing::rolling_on_the_floor_laughing: #coronavirus #virus #videodrole #xd #zebi #:rolling_on_the_floor_laughing::rolling_on_the_floor_laughing::rolling_on_the_floor_laughing::rolling_on_the_floor_laughing::rolling_on_the_floor_laughing: #wrf #mort #wuhan #wuhanvirus #coronavirusmemes #coronavirusfrance #coronavirus_officiel_27#chauvesouris
2035736365645095328; 1; False; 1556898707; #kobebryantdied in helicopter on #kobebryantcartoon in 2016 also:man_shrugging_medium-dark_skin_tone::thinking_face: #orwell #edwardsnowden #billgates #patent #viral #coronavirus #iran #china NSA #theylive #pedoelitist #epsteindidntkillhimself #orlandobrown #westworld #harveyweinstein #elsagate #oprah personofinterest #theylive #vacinnes humanity #plauge trending #kobebryantconspiracy #metzizahbpeh #pizzagate #pedophilialegalizationmustbestopped #rickygervaise behindthescenes #adrenochrome #lebronjames #humantraffickingawareness #organharvesting 333me.life now since they cancelled my Youtube like they cancelled #issackappy Good job every1 ,I feel so good that I'm dedicating my entire life into Channeling divEYEness, even tho the algorithm suppresses my content:eye::OK_hand_medium-dark_skin_tone:w3 ar3 th3 saviors-take care+stay aware. 333me.life
1960556467041769724; 0; False; 1547936565; #kobebryantdied in helicopter on #kobebryantcartoon in 2016 also:man_shrugging_medium-dark_skin_tone::thinking_face: #orwell #edwardsnowden #billgates #patent #viral #coronavirus #iran #china NSA #theylive #pedoelitist #epsteindidntkillhimself #orlandobrown #westworld #harveyweinstein #elsagate #oprah personofinterest #theylive #vacinnes humanity #plauge trending #kobebryantconspiracy #metzizahbpeh #pizzagate #pedophilialegalizationmustbestopped #rickygervaise behindthescenes #adrenochrome #lebronjames #humantraffickingawareness #organharvesting 333me.life now since they cancelled my Youtube like they cancelled #issackappy Good job every1 ,I feel so good that I'm dedicating my entire life into Channeling divEYEness, even tho the algorithm suppresses my content:eye::OK_hand_medium-dark_skin_tone:w3 ar3 th3 saviors-take care+stay aware. 333me.life
2231582818367210570; 0; False; 1580245424; El maldito perro bastardo que... . . . #elctmque #elconchetumareque #coronavirus #coronavirusmemes #coronaviruschile
2231582795121930679; 0; False; 1580245421; Bu gün Prezident İlham Əliyevin tapşırığına əsasən, Nazirlər Kabinetində, Ümumdünya Səhiyyə Təşkilatının və Çin Xalq Respublikası hökumətinin elan etdiyi kimi, ÇXR-in Uhan şəhərində yayılmış və artıq dünyanın başqa regionlarında da qeydə alınmış koronavirus epidemiyasına qarşı qabaqlayıcı tədbirlərin görülməsi üçün müşavirə keçirilib. “Qafqazinfo” xəbər verir ki, Baş Nazirin sədrlik etdiyi müşavirədə aidiyyəti dövlət qurumlarının rəhbərləri iştirak ediblər. Müşavirədə epidemiyanın Azərbaycana daxil olmasının qarşısının alınması üçün müzakirələr aparılıb. Müşavirənin yekununda belə hallar üçün nəzərdə tutulmuş aşağıdakı tədbirlərin görülməsi haqda qərar qəbul edilib: - sərhəd-keçid məntəqələrində gücləndirilmiş iş rejiminə keçilməsi; - ÇXR-dən, xüsusilə epidemiya zonasından ölkəyə gələn bütün şəxslərin mütləq şəkildə ciddi tibbi müayinədən keçirilməsi və nəzarət altına alınması; - xüsusi riskli hesab olunan və virusun keçə biləcəyi ərzaq məhsullarının siyahısının hazırlanması və ərzaq bazarında həmin məhsullara nəzarətin gücləndirilməsi; - səhiyyə ocaqlarında qaynar xətlərin yaradılması; - virus və onunla mübarizə metodları haqda əhali ilə maarifləndirmə işlərinin aparılması; - vəziyyətlə bağlı əhaliyə mütəmadi məlumat verilməsi. Əhalinin nəzərinə çatdırılır ki, ölkədə belə vəziyyətlərdə ehtiyacın yarana biləcəyi bütün tibbi ləvazimatlar kifayət qədərdir. O da vurğulanıb ki, hazırda ölkəmizdə belə xəstəliyə yoluxma halları müşahidə olunmayıb, Azərbaycanda əhalinin sağlamlığı ilə bağlı vəziyyət dövlətin tam nəzarətindədir və narahatlıq üçün heç bir əsas yoxdur. Müşavirədə Səhiyyə nazirinin rəhbərliyi ilə və aidiyyəti qurumların iştirakı ilə İşçi qrupunun yaradılması qərarı qəbul edilib. Tədbirlərin görülməsində Ümumdünya Səhiyyə Təşkilatının müvafiq tövsiyyələri nəzərə alınır. Azərbaycanın ÇXR-dəkı səfirliyi və ÇXR-in Azərbaycandakı səfirliyi ilə sıx əlaqə saxlanılır. Habelə, Azərbaycanın Çindəki səfirliyi ÇXR-in dövlət qurumları və Çində olan Azərbaycan vətəndaşları ilə daimi təmasdadır. #qafqazinfo #qafqaz #qafqazinfoaz #hadise #xəbər #dunya #qafqazxeber #chin #coronavirus #koronavirus #xestelik #china #president #azepresidente #prezident #news
2231582783066948872; 0; False; 1580245419; #Reposting Thanks for the great Art ARRE INDIA Bakth will say Modi ji is not working BJP :face_with_tears_of_joy::face_with_tears_of_joy::face_with_tears_of_joy: To be honest #BJP is equal to #coronavirus #bjp #delhi #modi #godimedia
2231582747827420636; 0; False; 1580245415; :bell: Destek olmak için ; Bizi takip edebilir, paylaşımlarımizı beğenebilir ve yorum yapabilirsiniz Daha fazlası için @bilgihazneen hesabını takip edin! :hugging_face: :folded_hands: #Kobebryant #turkey #felsefe #teknoloji #hayat #ankara #ilgincbilgiler #sanat #bilimsel #edebiyat #bilgihane #hukuk #like #deepweb #yenibilgi #tarih #biliyormuydunuz #pratikbilgiler #bilgi #bilgiler #trump #corona #virus #coronavirus #erdogan #deprem #elazığ #wuhan #china #acunilicali
2231582627490710487; 1; False; 1580245411; Sígueme para más Etiqueta a tus amigos . . . . Tags: #momos4k #memes #meme #memesenespañol #videosderisa #videos #videosgraciosos #dankvideos #videosrandom #risa #gracioso #youtube #minecraft #sdlg #momoscorp #coronavirus #luisitocomunica #legionmomo #legionholk #instalike #ranvi #ranvideos
2231582441651821309; 0; False; 1580245403; Chinese president Xi Jinping tells the @who General Director that he “personally directed and personally deployed” the country’s battle against ‪the coronavirus.‬⁣ ⁣ ‪From QiZHAI on Twitter.‬⁣ ⁣ #news #breakingnews⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣ #worldnews⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣ #coronavirus #wuhanvirus #wuhancoronavirusoutbreak #WuhanCoronavirus⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣ #coronavirusoutbreak #corona #ncov2019 #ncov⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣ #武漢肺炎 #武汉疫情⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣ #China #Wuhan⁣⁣⁣⁣⁣ #StandWithWuhan⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣ #LunarNewYear #NewYear #SpringFestival⁣⁣
2231582637800533600; 0; False; 1580245402; O tratamento do novo cororavírus é feito de acordo com os sintomas de cada paciente. :winking_face: ⠀ ⠀ ⠀ ⠀ #cardiologia #cirurgiao #cardiovascular #barbalha #crato #juazeirodonorte #hospitaldocoracaodebarbalha #cardio #saude #medicina #coronavirus #china
2231582548605297365; 0; False; 1580245400; When can you manage symptoms at home and when do you need to see a doctor? Dr. James Keany @jim_keany, emergency medicine physician at Mission Hospital, shared the latest about the #coronavirus with @ocregister. " Patients who can manage their symptoms at home with rest probably don’t need to see a doctor. But for those who are not able to hold down fluids, are disoriented or confused, have pain or a runny nose that is not allowing them to sleep, or have difficulty breathing, it is important to see a doctor or go to an emergency room right away." Read more at http://provhealth.org/617215X4p #missionhospital #healthcare #flusymptoms
2231582292141653170; 0; False; 1580245397; #China #Coronavirus #wuhan :folded_hands:
2231582530369523146; 0; False; 1580245389; Има вирус 350 динала . . . . Админ 2 . . #мим #мимови#смех#смешно #србија #солиднемемаре #мем#meme #dank #dankmemes #roblox#robloxmemes#animememes#anime#manga #serbia #serbianmemes #kosovojesrbija#smesniklipovi#smesneslike #bakaprase#šaimse #corona #coronavirus #drljacagames
2231582503624685688; 2; False; 1580245386; Sígueme para más Etiqueta a tus amigos . . . . Tags: #momos4k #memes #meme #memesenespañol #videosderisa #videos #videosgraciosos #dankvideos #videosrandom #risa #gracioso #youtube #minecraft #sdlg #momoscorp #coronavirus #luisitocomunica #legionmomo #legionholk #instalike #ranvi #ranvideos
2231582407048474447; 0; False; 1580245375; Das Virus verbreitet sich... Wenigstens hat es Pfand. #corona #coronavirus #pfand
2231582369096474386; 0; False; 1580245375; Hhhh fr . . . . . . . . . . . #memes#dank #dankmemes#funny#corona#virus #coronavirus #awesome#pewdiepie #superfun#goals#couple #quotes #sofunny#bored#lol#wow#wtf#new#memepages#dsrkmemes#offensivememes:sweat_droplets::eyes::hundred_points::face_with_tears_of_joy::face_with_tears_of_joy::gem_stone::fire::face_with_steam_from_nose::sweat_droplets::OK_hand::hundred_points::face_with_tears_of_joy::folded_hands::face_with_tears_of_joy::face_with_tears_of_joy::gem_stone::gem_stone::fire::face_with_steam_from_nose::sweat_droplets::eyes::eyes: #offensive #offensivememes#supermemes#sexymemes#coolmemes#memesforkids#meme4mykid
2231582367142994273; 0; False; 1580245370; Hey Guys I’m not worry about the #coronavirus, because I’m taking care of myself with too many of dietary supplements like those, high recommended, protect your kids! Love you guys stage safe please. #holdinghands #eatwell #greece_nature
2231582332170972465; 1; False; 1580245366; we finna die - - - - - #memes#dankmemes#nonutnovembermemes#awesome#funny#ripkobe#kobebryant#funnymemes#kobe#roblox#qualitymemes#fortnite#reddit#twitter#pewdiepie#humour#comedy#weird#weliveinasociety#edgy#edgymemes#youtube#asianmemes#chinesememes#coronavirusmemes#ripkobebryant#relatable#teens#coronavirus #corona
2231582328732759431; 14; False; 1580245365; Coronavírus: Pernambuco inicia ações de vigilância da doença » https://www.blogdobrunomuniz.com.br ou acesse o link na descrição do nosso perfil. #saude #coronavirus #blogdobrunomuniz #noticias #pernambuco #pracegover #santacruzdocapibaribe
2231582236203878144; 0; False; 1580245354; #coronavirus #china #australia
2231582202198293112; 0; False; 1580245350; #meme #memes #template #creeper #fortnite #pubg #followforfollowback #follow4follow #london #sun #memer #doodle #thetemplater #instagram #amazing #girls #boys #pewdiepie #phone #instalove #instagood #followforfollow #follow4followback #joe #what #minecraft #fallout #lol #wow #coronavirus
2231581969664258814; 0; False; 1580245344; Considering the coronavirus situation, it’s better to wear mask whenever we are in a crowd, our sticky note family is taking action now, how about you? . . . . . #bulletjournaldaily#bulletjournalideas#bujoideas#bujosetup#bulletjournaladdict#bulletjournaladdicts#bujoweekly #手帐#手帐生活#手帐排版 . #bulletjournallayout#bujoinspiration#bujocommunity#bulletjournalcatalog #bulletjournalweekly#coronavirus#plannersociety#plannerlayout#stationeryholic #plannerworld#planneruk#passionplanner#showmeyourplanner#planneraddict#wooopyfun#discoverbulletjournal #แพลนเนอร์#불렛저널 #bulletjournalling#studygramcommunity
2231582104462616980; 0; False; 1580245338; #meme #memes #template #creeper #fortnite #pubg #followforfollowback #follow4follow #london #sun #memer #doodle #thetemplater #instagram #amazing #girls #boys #pewdiepie #phone #instalove #instagood #followforfollow #follow4followback #joe #what #minecraft #fallout #lol #wow #coronavirus
2231582040717013365; 0; False; 1580245331; Germany and Japan say the virus has spread in their countries #coronavirus #liveupdates #update #virus #china #amerika #englich #engels #follow #followers #end #endofworld #news #europa #world #vacsine #country #netherlands #paris #parijs
2231582020920096117; 0; False; 1580245329; ¡Tome nota! Los tipos de máscaras de protección más utilizadas por la epidemia del nuevo #coronavirus descubierto en China. :face_with_medical_mask:
2231582017783263535; 0; False; 1580245328; #meme #memes #template #creeper #fortnite #pubg #followforfollowback #follow4follow #london #sun #memer #doodle #thetemplater #instagram #amazing #girls #boys #pewdiepie #phone #instalove #instagood #followforfollow #follow4followback #joe #what #minecraft #fallout #lol #wow #coronavirus
2231581994536828245; 1; False; 1580245325; Got the new Wuhan style that's trending #lasvegas #vegasissues #wuhan #coronavirus #mask #westwood
2231581797447533730; 0; False; 1580245316; We fucked. . . . . . . . #offensivememes #offensivememes:sweat_droplets::eyes::hundred_points::face_with_tears_of_joy::face_with_tears_of_joy::gem_stone::fire::face_with_steam_from_nose::sweat_droplets::OK_hand::hundred_points::face_with_tears_of_joy::folded_hands::face_with_tears_of_joy::face_with_tears_of_joy::gem_stone::gem_stone::fire::face_with_steam_from_nose::sweat_droplets::eyes::eyes: #dankmemes #offwhite #offensivehumor #starwarstheclonewarsseason7 #corona #coronavirus #kobe #jaystation #edgymemes #edgy
2231581910585203618; 0; False; 1580245315; #meme #memes #template #creeper #fortnite #pubg #followforfollowback #follow4follow #london #sun #memer #doodle #thetemplater #instagram #amazing #girls #boys #pewdiepie #phone #instalove #instagood #followforfollow #follow4followback #joe #what #minecraft #fallout #lol #wow #coronavirus
2231581524304805541; 1; False; 1580245315; Today's editorial cartoon. See a full gallery of cartoons in the link in our bio.⁠ ⁠ :pencil:: @droweafr⁠ ⁠ #cartoon #politics #coronavirus #bridgetmckenzie
2231581878658706414; 0; False; 1580245312; #scaremongering #virus #globehoax #coronavirusoutbreak #coronavirus #fear #beafraid #news #tabloid #pandemic #scary #love #uk #england #antivirus
2231581832040907847; 0; False; 1580245306; Welp now what #memes #meme #funny #funnyshit #dankmemes #stepmom #stepmomlife #stepmomproblems #stepmomlove #girl #girlfriend #hair #haircut #freshcut #egirl #eboy #anime #otaku #corona #coronavirus
2231581810140305252; 0; False; 1580245303; :warning:O mundo todo está em alerta por conta do CORONAVÍRUS. Na China, país onde o vírus foi descoberto, já são mais de 100 mortes confirmadas, e um caso é investigado em Minas Gerais. Fique atento as dicas que preparamos! #neolab #neolablaboratorio #coronavirus #saude #qualidadedevida #juizdefora #minasgerai
2231581773389428202; 0; False; 1580245299; #meme #memes #template #creeper #fortnite #pubg #followforfollowback #follow4follow #london #sun #memer #doodle #thetemplater #instagram #amazing #girls #boys #pewdiepie #phone #instalove #instagood #followforfollow #follow4followback #joe #what #minecraft #fallout #lol #wow #coronavirus
2231581515230092231; 6; False; 1580245293; Çin/Hubei'de gerçekleşen karga istilasında Corvus cinsi kargaların hassas bir koku alma duyusuna sahip olduğu ve cesetlerden yayılan hafif kokuları uzun mesafeden koklayabilecekleri, cesetlere ulaşmak için yarışabilecekleri söyleniyor. Yabani hayvanlar vuruluyor. Hastalarını teslim etmeyen halk Ülkedeki koruyucu stokları bittiği için halk ne yapacağını şaşırdı ... #koronavirüsü #koronavirus #çinvirüsü #sondakika #sondakika #önemli #china #news #breakingnews #breaking #haber #gündem #coronavirus#sondakika #önemli #haber #gündem #karantina #coronavirüsü #koronavirus #koronavirüsü #Wuhan kentindeki sağlık çalışmaları yetmiyor. Çin'de karantina altına alınan şehir sayısı yükseliyor. Daha fazlası için takip etmeyi unutmayın :red_heart: @saglikbakanligi Daha fazlası için takip etmeyi unutmayın :red_heart: #corona #coronavirus #türkiye #tsk #hastalik #istanbul:Turkey: #kolombiya #istanbul #saglikbakanligi #cin #çin #woman #coronavirus #abd #trump #salgın #virus #
2231581701851479160; 0; False; 1580245290; Come get me coronavirus. . . . #rap #hiphop #punk #trap #tattoos #producer #newmusic #newshit #newtrap #dreads #dj #serato #numetal #rapper #rappers #newrappers #turntables #scratch #love #coronavirus #ska #punktrap #punkrap #newrap #tattoos
2231581618290741585; 0; False; 1580245281; A Netflix lançou em seu catálogo uma minissérie documental de 6 episódios chamada "Pandemia". A série mostra os esforços dos profissionais de saúde para evitar uma nova pandemia - como a da Gripe Espanhola, que matou milhões de pessoas ao redor do mundo. ⠀ Você sabe o que tem sido feito para que novas enfermidades não se tornem catástrofes globais? ⠀ #netflix #catalogonetflix #dicasdefilmes #dicasnetflix #medicina #coronavirus
2231581611607082266; 0; False; 1580245280; E partono le ciabattate ~Fenix . Seguici @memes.superbelli . . #ridichetipassa #memesimpatici #scuola #risate #battutesquallide #battute #memeita #memebelli #nerd #freddure #memescuola #dignità #cina #virus #ignoranzainabbondanza #comunismo #coronavirus #memesimpatici #memeitaliani #meme #riderefabene #vdm #ironia #cazzeggio #ignoranza #divertirsi #postdivertenti #coglione #muoiodalridere #ironiaportamivia #ridiamoinsieme
2231581580728361978; 0; False; 1580245276; While there has been a lot of hype about the Coronavirus circulating, the solution to stopping the spread of viruses is really quite easy! Wash your hands often with soap and water for at least 20 seconds. If soap and water are not available, use an alcohol-based hand sanitizer. Avoid touching your eyes, nose, and mouth with unwashed hands. Avoid close contact with people who are sick. Stay home when you are sick. Cover your cough or sneeze with a tissue, then throw the tissue in the trash. Clean and disinfect frequently touched objects and surfaces. The best disinfecting practices include disinfecting clean surfaces or areas that are commonly used by a lot of people, such as a doorknob, a coffee maker, counters, fridges and more. . . . #hamilton #hamont #kitchener #niagarafalls #niagara #waterloo #coronavirus #handwashing #disinfect #sanitize #health #healthyliving
2231581570148853922; 0; False; 1580245275; Von #reddit geklaut #meme #coronavirus #conorameme
2231581561065388360; 13; False; 1580245274; reddit.com/r/atheism . . . . . #televangelist #christiantv #coronavirus #globalwarming #climatechange #virus #sin #wickedness #crazy #preacher #extremist #extremism #religious #religion #vile #god #godless #atheism #theist #theism #biblebelt #preach #godisjust #endtimes
2231581553447137810; 1; False; 1580245273; Coronavirus: Ethiopian isolates 4; Kenya, Ivory Coast test suspected cases The coronavirus was confirmed in the Chinese city on January 7, 2020. Cases have since been confirmed in several other Asian countries, Europe and the United States. The World Health Organisation’s Africa emergency response program manager Michel Yao advised health ministers in the region to activate standard flu screening at airports for passengers coming from mainland China. There is a considerable community of students in China from African countries, and a number of them have expressed their desire to return home as authorities struggle to contain the virus. Other countries across the world are considering the option of evacuating their citizens. Ethiopia, Kenya, Nigeria and Uganda among other countries have started implementing surveillance and screening at airports, especially for travelers arriving from Wuhan in China where the outbreak began in December.Coronaviruses are a family of viruses that range from the common cold to MERS coronavirus, which is Middle East Respiratory Syndrome coronavirus and SARS, Severe Acute Respiratory Syndrome coronavirus. January 28,2020: Ethiopia confirms four possible cases Ethiopia’s state-affiliated FANA broadcasting corporate, FBC, reported that four Ethiopians suspected of being infected by coronavirus has been placed in isolation, said the Ministry of Health. “The students arrived in Ethiopia from a university in Wuhan, Chain’s worst-affected city by the disease,” the report added. January 28,2020: Kenya rushes suspected case to hospital Kenya Airways on Tuesday confirmed that one of its passengers who had travelled from the Chinese city of Wuhan to Nairobi had presented coronavirus-like symptoms and was rushed to hospital on arrival at the Jomo Kenyatta International Airport. #Kenya #Rwanda #ethopia #coronavirus
2231580801593898300; 0; False; 1580245270; The Coofer Follow @mopwater_memes for more • • • • #memes #funny #lol #lmao #viral #funnyposts #dankmemes #dank #dankestmemes #explore #explorepage #funnymemes #funnymeme #textposts #savagememes #popular #trending #edgy #edgymemes #edgymeme #boomer #nochill #plaguedoctor #memesdaily #coronavirus #plaguedoctor #instadaily #fun #follow #corona
2231581520219763830; 0; False; 1580245269; Ministro confirma primeiro caso suspeito de coronavírus no Brasil. Estudante de 22 anos está em observação em hospital de Belo Horizonte. . .:heavy_plus_sign: Link na bio. #PraCegoVer: Ministro Luiz Henrique Mandetta de terno. Ao fundo logotipo do Governo Federal. #coronavirus #ministeriodasaude #governo
2231526328598168227; 0; False; 1580245268; Самые свежие. Уже 106 человек умерли в результате заражения китайским коронавирусом. Число заразившихся к этому часу приближается к четырем с половиной тысячам человек - это только в Китае. Ситуация осложняется достаточно продолжительным инкубационным периодом заболевания и мутацией самого коронавируса. . . . . . . #coronavirus #короновирус #китай #европа #болезнь #смерть #опасность #мир #видео #хэштеги #новости #новости_ru #карантин #эпидемия #инстатаграм #весьмир #карантин #страх #top #люди #человек #video #life #жизнь #china #europe #ухань #wuhan #россия #болезнь
2231581514330864276; 0; False; 1580245268; É preciso ficar atento ao novo coronavírus, originário da China. Até agora, já foram registrados mais de 4 mil casos em todo o mundo. O Brasil está em alerta para a circulação do vírus e investiga um caso suspeito. :right_arrow: Confira as imagens e saiba mais sobre o coronavírus e como se prevenir. #herjf #coronavirus #novocoronavirus #saude #virus #infectologia #medicina
2231579222338603134; 0; False; 1580245265; #coronavirus :face_with_tears_of_joy: Abonne toi et rejoint notre communauté ! :gem_stone: ———————————————————————— #delire #chinois #chinoiserie #failarmy#gymfail#homersimpson#videohumour#videodrole#drole#droles#drolehumour#marrant#comique#astuce#jetroll#humouràlaconne#tweetdrole#photodrole#mdr#humourdemerde#humournoir#humourdemerdequinefaitrirequemoimaisjassume#drolevideo#sourire#rire#blague#humouralacon#memes#blaguedemerde
2231581486348001619; 0; False; 1580245265; #meme #memes #template #creeper #fortnite #pubg #followforfollowback #follow4follow #london #sun #memer #doodle #thetemplater #instagram #amazing #girls #boys #pewdiepie #phone #instalove #instagood #followforfollow #follow4followback #joe #what #minecraft #fallout #lol #wow #coronavirus
2231581486841475754; 1; False; 1580245265; What's up world? #skatevlog from #coronavirus country is coming soon! tag your bro and you will both get sick in 2020 haha #China #Shenzhen #nicechoiceAndrew
2231581453212477869; 12; False; 1580245261; I wonder what Ray is up to now⁣ ⁣ ⁣ ⁣ ⁣ ⁣ ⁣ ⁣ ⁣ ⁣ ⁣ ⁣ ⁣ ⁣ ⁣ ⁣ ⁣ #funnymemes #cancerousmemes #wholesomememes #surrealmemes #cringememes #cursedimage #funnyedits #shitposts #deepfriedmemes #surreal #wholesomememe #dankmemes #darkmemes #smashultimate #ww3 #aliens #nicememe #nicememes #spicymemes #memes:face_with_tears_of_joy: #tumblr #comedy #trending #frontpage #explore #meme #memes #coronavirus⁣
2231581455148915492; 0; False; 1580245261; #Coronavirus
2231581380668755432; 0; False; 1580245252; (BAŞTAN DİYORUM EĞER BANA ABONE OLMAZSAN SANADA BULAŞIRIM. SONRA SÖYLEMEDİ DEME) BU BEN DEĞİLİM ARKADAŞLAR YALAN HABERLERE İNANMAYIN. #socialsteeze #tweegram #photooftheday #20likes #amazing #smile #follow4follow #like4like #look #instalike #igers #picoftheday #instacool #carryme #follow #colorful #style #swag #corona #china #pekin #shanghai #turkey #virus #corona #coronavirus #önlem #çin #türkiye #japanese #japan
2231580141754346086; 0; False; 1580245252; Lmao this mf lucky he didn’t get his ass beat beat :face_with_tears_of_joy: #Lol #Nelk #NelkBoys #SteveWillDiIt #SendIt #Fullsend #TheseMfs #Haha #Lmao #CoronaVirus
2231581320464000154; 0; False; 1580245245; Não existem regras fixas nem formas pré-concebidas para o trabalho corporal - Lenora Lobo Foto: @oiuryrosendo . . . #ideologia #comunismo #anarcocapitalismo #liberalismo #neoliberalismo #anarquismo #coronavirus #movimento #corpo #danca #dance #videodança #elenao #elesim #elenunca #stfvergonhanacional #stf #manifestação #eleições #lulanacadeia #lulapreso #lulalivre #lulapresidente #anonimato #trump #congressonacional #noticia #inss #minas #lula
2231581301605726930; 0; False; 1580245243; #meme #memes #template #creeper #fortnite #pubg #followforfollowback #follow4follow #london #sun #memer #doodle #thetemplater #instagram #amazing #girls #boys #pewdiepie #phone #instalove #instagood #followforfollow #follow4followback #joe #what #minecraft #fallout #lol #wow #coronavirus
2231581288561656305; 1; False; 1580245241; Wäre das rassistisch oder nur vorsichtig
2231581234941498610; 0; False; 1580245235; :Turkey:Almanyada corona virüs tespit edildi. :European_Union:Germany has been effected corona virus. #clinicalnews #coronavirus #virusoutbreak #corona #health #nursing #nurse #wuhan2020 #wuhanvirus #coronaoutbreak #who #china #doctor #hospital #european #europe #crisis #lastnews #cdc #coronavirus #wuhan2020 #outbreak #usa #earthquake #jamaica #deprem #jamaicaearthquake #germany #germanycoronavirus
2231581223129209691; 67; False; 1580245233; En Ecuador se estudia un posible caso de coronavirus. Tome en cuenta estas recomendaciones . . #Salud #Coronavirus #virus #CoronavirusEcuador #Ecuador #viruschino #nuevovirus #saars #Consejos #Quito
2231581216770744402; 0; False; 1580245233; Hoje vamos falar um pouco sobre a transmissão desta nova variante do Coronavirus, fique atento as informações! Viver Mais Hospital - Sempre Pensando em você! #vivermais #hospitalvivermais #coronavirus ##saudepublica #saude #sulfluminense #sulfluminenserj #voltaredonda #voltaredondarj
2231580955877657232; 0; False; 1580245229; Let's be on the watch . Health is welth.. Being alive the reason we are hopeful towards our Goals. Lets #prevent #coronavirus let's follow the videos the instructions. It will help us all. @cdvpropertiesltd cares. We ask that you be safe. #wuhan #singapore #nigeria #china #preventivemedicine #pathology #goodmorning #healthylifestyle #health #healthyliving #healthyfood #caution #loveyourself
2231581152674339700; 0; False; 1580245228; El Gobierno de Kaohsiung (Taiwán, China) multará a un hombre infectado por el coronavirus por no informar a las autoridades que tenía síntomas de sufrir una infección en las vías respiratorias superiores tras regresar de la ciudad de Wuhan. Pan Chao-ying, especialista del Departamento de Salud de la ciudad, declaró que ese varón será multado con 300.000 nuevos dólares de Taiwán, unos 10.000 dólares estadounidenses, por violar la Ley de Control de Enfermedades Transmisibles. Además, este hombre de unos 50 años visitó un club de baile un día después de regresar de Wuhan sin usar una máscara facial y, posteriormente, una trabajadora de ese local sufrió síntomas de tener virus y tuvo que recibir tratamiento médico. #Tendenciasrd #Kaohsiung #TaiwanChina #Coronavirus
2231581153672696970; 0; False; 1580245225; #trumpintoronto #thedonald #trumpmemes #donaldtrumpmemes #presidenttrumpmemes #trumpfans #trumpselfie #presidenttrumpimpression #donaldtrumpimpression #donaldjtrumpimpression #trumpstandup #comedy #torontocomedy #thedonaldselfie #presidenttrumpimpersonator #presidentdonaldtrumpimpression #donaldjtrumpimpressionist #trumpfan #trumpfacts #trumphair #trumpfingers #presidenttrumpmeme #coronavirus
2231581151374860025; 0; False; 1580245225; “Taxi driver in China kicks out coughing passenger who just returned from Wuhan amid the coronavirus outbreak.”⁣ ⁣ From RT_com on Twitter.⁣ ⁣ #news #breakingnews⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣ #worldnews⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣ #coronavirus #wuhanvirus #wuhancoronavirusoutbreak #WuhanCoronavirus⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣ #coronavirusoutbreak #corona #ncov2019 #ncov⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣ #武漢肺炎 #武汉疫情⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣ #China #Wuhan⁣⁣⁣⁣⁣ #StandWithWuhan⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣ #LunarNewYear #NewYear #SpringFestival⁣⁣
2231581136400436063; 0; False; 1580245223; #meme #memes #template #creeper #fortnite #pubg #followforfollowback #follow4follow #london #sun #memer #doodle #thetemplater #instagram #amazing #girls #boys #pewdiepie #phone #instalove #instagood #followforfollow #follow4followback #joe #what #minecraft #fallout #lol #wow #coronavirus
2231581115177343439; 0; False; 1580245221; When you can’t get a mask in Singapore - stocking up in the US and bringing back! #coronavirus #bettersafethansorry #n95 #toflyornottofly #masks #respiratormask
2231581103819497047; 0; False; 1580245219; Wtf is going on? Is this true ? #coronavirus #residentevil #umbrellacorp #tvirus #racooncity
2231581081044429684; 0; False; 1580245216; :exclamation_mark::exclamation_mark::exclamation_mark::exclamation_mark::exclamation_mark::exclamation_mark::exclamation_mark::exclamation_mark::exclamation_mark::exclamation_mark::exclamation_mark::exclamation_mark::exclamation_mark::exclamation_mark::exclamation_mark::exclamation_mark::right_arrow: @coronavirusoffiziell :left_arrow: Подпишись и будь в курсе всех новостей о коронавирусе :police_car_light: Subscribe and stay informed #pray #prayer #nature #indonesia #sydney #carlinhosmaia #bbb20 #anitta #bts #justinbieber #newyork #prayforrevival #prayforhealing #hope #Jesus #life #viruscorona #love #помощь #coronavirus #коронавирус #вирус #virus #china #china:China: #ухань #китай #bbc #news #новости
2231581046709478510; 0; False; 1580245212; #meme #memes #template #creeper #fortnite #pubg #followforfollowback #follow4follow #london #sun #memer #doodle #thetemplater #instagram #amazing #girls #boys #pewdiepie #phone #instalove #instagood #followforfollow #follow4followback #joe #what #minecraft #fallout #lol #wow #coronavirus
2231580678718703270; 0; False; 1580245203; Jbg. :biohazard: . . . #virus #corona #coronavirus
2231580956488240391; 6; False; 1580245202; #brightside of #coronavirus outbreak in #china
2231580957982804969; 0; False; 1580245202; Verga si, Coranavirus is Coming! :rolling_on_the_floor_laughing::rolling_on_the_floor_laughing::rolling_on_the_floor_laughing: #humor #chistoso #memes #funny #videochistoso #memesespañol #venezolanosenchile #memeschile #memesvenezuela #ww3memes #tripeo #asombroso #coronavirus #coronavirusmemes Siguenos en Instagram @AltoTripeo subimos contenido diario :smiling_face_with_sunglasses:
2231580940231354394; 6; False; 1580245200; You can never be too safe
2231580672686826313; 0; False; 1580245197; @mistermemebear . . . . #nostalgia #nostalgie #ww3 #thisisme #fridayforfuture #meme #memes #funny #funnymeme #funnymemes #memez #dailymemes #dailymeme #followback #hashtag #youtube #follow4follow #lilke4like #cleanmeme #comedy #dank #memer #9gag #offensivememes #blackhumor #tiktok #memelife #china #corona #coronavirus
2231580903239532732; 13; False; 1580245195; Well • • Story from r/twosentencehorror • • • • • • • • • • [#horrorstories #horrorstory #horrorfacts #horrorfact #creepypasta #horrifyingthing #things #scary #creepy #scarystories #creepystories #creepyfacts #creepyfact #scaryfact #scaryfacts #conspiracy #theories #theory #conspiracytheory #terrifying #haunted #paranormal #horroreveryday #coronavirus #corona #virus #zombie #infected]
2231580896830198676; 0; False; 1580245195; #dolfut caminhando para o fechamento nas mínimas do dia refletindo certa acomodação nas preocupações com o #coronavirus. #traderbrasil #b3 #febcap
2231580880086584426; 0; False; 1580245193; #meme #memes #template #creeper #fortnite #pubg #followforfollowback #follow4follow #london #sun #memer #doodle #thetemplater #instagram #amazing #girls #boys #pewdiepie #phone #instalove #instagood #followforfollow #follow4followback #joe #what #minecraft #fallout #lol #wow #coronavirus
2231580864834444033; 0; False; 1580245191; WAP celebra decisión de China de prohibir el comercio de vida silvestre debido al brote de coronavirus :backhand_index_pointing_right:Para leer la nota completa entra a 3ersector.mx o desde la Bio Más información: https://bit.ly/37BKnX4 #WAP #China #Coronavirus #Prohibición #ComerciodeVidaSilvestre @world_animal_protection
2231580863450381046; 0; False; 1580245191; #dolfut caminhando para o fechamento nas mínimas do dia refletindo certa acomodação nas preocupações com o #coronavirus. #traderbrasil #b3 #febcap
2231580830105428806; 22; False; 1580245187; If not for your health, if not for our planet, if not for the animals then FOR WHAT? . Farmers are literally burning the lungs of our planet to clear land for cattle in the Amazon rainforest. 1 billion wildlife were killed in the Australian fires because of climate change worsening the drought, we then culled 5,000 camels because they were "drinking our water". Now we see the Coronavirus, caused by consuming and handling dead animals. . The most powerful single thing you can do to help our environment, our health and the animals is shift to a vegan diet. . . . . . . . #animalagriculture #coronavirus #amazonfires #fire #bushfires #animals #animal #australia #australian #australianfirefighters #australianfires #endsuffering #endexploitation #speciesism #animalliberation #animalactivist #animallovers #vegetarian #vegan #veganism #leangreenie#govegan #veganlove #crueltyfree #vegansofig #veganlife #vegan #animallover
2231580833311756473; 0; False; 1580245187; #dolfut caminhando para o fechamento nas mínimas do dia refletindo certa acomodação nas preocupações com o #coronavirus. #traderbrasil #b3 #febcap
2231580787619126648; 0; False; 1580245181; #meme #memes #template #creeper #fortnite #pubg #followforfollowback #follow4follow #london #sun #memer #doodle #thetemplater #instagram #amazing #girls #boys #pewdiepie #phone #instalove #instagood #followforfollow #follow4followback #joe #what #minecraft #fallout #lol #wow #coronavirus
2231580719612588025; 1; False; 1580245173; When my wife need a mask:smiling_face_with_halo::face_with_medical_mask::smiling_face_with_3_hearts::thumbs_up_medium-light_skin_tone::thumbs_up_medium-light_skin_tone::thumbs_up_medium-light_skin_tone: เมื่อภรรยาซื้อหน้ากากป้องกันเชื้อโรคก็จะประมาณนี้:nerd_face::face_with_medical_mask::smiling_face_with_halo::smiling_face_with_3_hearts: #bankpuidc #ขำๆกับBankPuiDC #coronavirus #สุขภาพกับBankPuiDC #เมียพี่รวย #คนรวย2020 #mask #virusmask
2231580538301807034; 0; False; 1580245171; People are so bored in Wuhan they’ve resorted to counting cars.⁣ ⁣ From Sergeant_Ozzy on Twitter.⁣ ⁣ #news #breakingnews⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣ #worldnews⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣ #coronavirus #wuhanvirus #wuhancoronavirusoutbreak #WuhanCoronavirus⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣ #coronavirusoutbreak #corona #ncov2019 #ncov⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣ #武漢肺炎 #武汉疫情⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣ #China #Wuhan⁣⁣⁣⁣⁣ #StandWithWuhan⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣ #LunarNewYear #NewYear #SpringFestival⁣⁣
2231580680413003340; 13; False; 1580245169; La ministra de Salud de Perú, Elizabeth Hinostroza, informó este lunes que cuatro personas se encuentran aisladas para descartar o confirmar la presencia del coronavirus. - Tres de los pacientes son de origen chino y uno es peruano, indicó Hinostroza. - “Recibimos cuatro casos reportados de pacientes sospechosos. Tres de ellos de procedencia china y que han estado en la ciudad de Wuhan. Estos pacientes presentan infección respiratoria leve, y eso tenemos que destacar que no tienen cuadro clínico de infección grave como es lo que se presenta en los casos de Coronavirus”, manifestó Hinostroza durante una entrevista en el Canal N. - El coronavirus procede de una familia de virus respiratorios denominada Coronaviridae, que agrupa a una serie de virus infecciosos que causan diversas enfermedades, principalmente cuadros respiratorios como resfríos, bronquitis o traqueítis, neumonías y en casos graves, la muerte, según las investigaciones. - #28Ene #ElInformadorVenezuela #ElInformadorVe #Venezuela #Lara #Barquisimeto #Noticias #Internacionales #coronavirus #Perú #YBM
2231580681401879993; 0; False; 1580245169; :microbe::medical_symbol:Es momento de tomarnos un tiempo para reflexionar y tomar precauciones en contra del #coronavirus. Les invito a ver los vídeos en mi feed sobre qué medidas tomar y cómo podemos protegernos. . . . #salud #medicina #chihuahua #ciudadjuarez #vida #mexico #oms
2231580644408606575; 0; False; 1580245167; Please be aware of the 2019 Novel Coronavirus, a virus identified as the cause of an outbreak of respiratory illness first detected in Wuhan, China. Medical interpreters who work directly with patients can be severely impacted by this virus, and should know how to protect their health and be prepared with related terminology. Please follow @cdcgov guidance which can be found here: https://bit.ly/2t47P08 . . . #Medicalinterpreter #Interpreter #Coronavirus #Outbreak
2231580636615562120; 3; False; 1580245163; #meme #memes #template #creeper #fortnite #pubg #followforfollowback #follow4follow #london #sun #memer #doodle #thetemplater #instagram #amazing #girls #boys #pewdiepie #phone #instalove #instagood #followforfollow #follow4followback #joe #what #minecraft #fallout #lol #wow #coronavirus
2231579213335518897; 16; False; 1580245156; muitos estão assustados com a notícia de que já há indícios do coronavírus aqui no Brasil. Existem 2 ações simples que você pode eatar fazendo para conseguir se prevenir. - Higienização das mãos - Vitamina D3 #coronavirus #coronavírus #surtodemorte #epidemia #pandemia #infeccao #higienizacao #lavesuasmaos #vitaminad3 #vitamina #morte
2231580543603429980; 1; False; 1580245152; Rush Hour. :round_pushpin:Wuhan,China
2231580478138234143; 0; False; 1580245145; (BAŞTAN DİYORUM EĞER BANA ABONE OLMAZSAN SANADA BULAŞIRIM. SONRA SÖYLEMEDİ DEME) Allaha sükür Washington'a ulaştık Amerika'ya git abi diyenler vardı buyrun arkadaşlar #socialsteeze #tweegram #photooftheday #20likes #amazing #smile #follow4follow #like4like #look #instalike #igers #picoftheday #instacool #carryme #follow #colorful #style #swag #corona #china #pekin #shanghai #turkey #virus #corona #coronavirus #önlem #çin #türkiye #japanese #japan
2231580462846044626; 0; True; 1580245143; :hospital: Complètement paniquée, une célèbre candidate pense avoir attrapé le Coronavirus :face_screaming_in_fear: Découvrez de qui il s'agit dans ma story :mobile_phone_with_arrow: @infos_tvr :left_arrow: #coronavirus #téléréalité
2231580438568571454; 0; False; 1580245140; #Repost @docmedia.co with @make_repost ・・・ #Docmedia . Coronavírus . Os coronavírus são uma família de vírus caracterizada por espículas na superfície que lembram uma coroa. Causam de quadros leves, semelhantes ao resfriado comum, a quadros respiratórios muito graves. As últimas epidemias provocadas por coronavírus foram a síndrome respiratória aguda grave (SARS) e a síndrome respiratória do Oriente Médio (MERS). . Em dezembro de 2019 foi identificada uma nova variante (2019-nCoV) na cidade chinesa de Wuhan, cuja provável transmissão ocorreu de um reservatório natural do vírus para o ser humano. O foco inicial da doença parece ser um mercado de frutos do mar. Suspeitas não comprovadas sugerem que o 2019-nCoV possa ser originário de morcegos. Além disso, o vírus é transmissível entre humanos e por contato com secreções aéreas contaminadas. Os dados sobre o contágio e a letalidade ainda não permitem conclusões e a evolução de epidemia deve ser acompanhada melhores conclusões. . Contudo, os últimos relatos já dão conta de 50.000 infectados e 106 mortes. Os infectados podem ser assintomáticos ou apresentar quadros respiratórios leves, até pneumonia viral severa e insuficiência respiratória. Até o momento não há vacina ou tratamento específico para os doentes, que devem ficar em isolamento respiratório e receber tratamento sintomático e de suporte. O diagnóstico da infecção é feito por biologia molecular em amostras de sangue para identificar o material genético viral. . A redução do risco de infecção deve ser prioridade e inclui evitar o contato com pessoas com sintomas respiratórios, lavar frequentemente as mãos em água corrente, utilizar lenços descartáveis na higiene nasal, cobrir a boca ao espirrar ou tossir, não compartilhar objetos de uso pessoal, evitar aglomerações humanas e não consumir ou ter contato com possíveis reservatórios do vírus. Até o momento não há casos de 2019-nCoV confirmados no Brasil. Técnicos afirmam existir sim o risco de uma epidemia global, mas só o acompanhamento da evolução poderá confirmar. . Para acompanhar os casos em tempo real: https://bit.ly/2tLBFqN . #docmedia #coronavirus #infectologia #saúde #medicina #epidemia
2231580399041899636; 14; False; 1580245135; Cette histoire de Cornavirus a délié pas mal de langues et a révélé un racisme ordinaire à l’encontre des asiatiques que je supporte plus du tout ! :persevering_face: Attention aux amalgames ! En plus, nous les musulmans on sait ce que ça fait... Il vaut mieux éviter de tout mixer et de faire de mauvaises tchakchouka avec l’actus. . #LesAsiatiquesNeSontPasTousChinois #LesChinoisNeMangentPasTousDuChien #LesChinoisNeSontPasTousOpresseurs #IlFautRespecterLaCultureDesAutres . . #JeNeSuisPasUnVirus #coronavirus #racismeordinaire #racisme #stopracisme #tolerence #chinois #asiatique #aimezvousbordel #lemondedenur #islam #uyghur #illustration
2231580327728383434; 3; False; 1580245127; I took advice from public health doctors. Tried to present a more balanced view rather than giving into mass media hype. Apparently some people don't like me summarising evidence for them. To note 1. I'm not chinese (not that that is a problem) 2. I'm not trying to down play it 3. We still need to be careful while the outbreak declares its further characteristics (think before you travel, hygiene, etc) #news #youtube #haters #racist #prejudice #auckland #Newzealand #doctor #coronavirus #virus #outbreak #infection #wuhan #china #오클랜드 #뉴질랜드 #youtuber #우한 #우한코로나 #바이러스 #감염 #우한폐렴
2231580303831213351; 0; False; 1580245124; Pretty much #memesformynibbas #memes #spongebobmemes #coronavirus #dankmemes #dankmemesmeltsteelbeams #yourmomgay #lucidchart
2231580278671869479; 0; False; 1580245121; :microbe:Coronavirus :microbe: ⠀ ⠀ NEST is taking heavy precautions to ensure our patients are safe and would like reassure everyone that we have processes in place to prevent any risk to our patients or staff. We will continue to follow instructions from the health department and chief health officer. ⠀ We ask if you have travelled anywhere overseas in last 2 weeks to call the clinic to discuss further with our staff #coronavirus #health #generalpracitce #nursing #dhhs #publichealthannouncement
2231580261544682932; 0; False; 1580245119; #coronavirus
2231579181559622007; 0; False; 1580245112; 01/28/2020 4:00 pm (new york) 1720: Black Death 1820:cholera 1920:spanish flu 2020: #wuhan #wuhanvirus #coronavirus #rip #newyork #china
2231580206917879315; 0; False; 1580245112; #coronavirus #chine #chinois
2231580179487135663; 4; False; 1580245109; Sorry per la giornata di chiusura, ma vojamo fare tutto da noi, senza delegare buyer di sorta, ma la family vi ha selezionato delle sberle in showroom #HellyHansen per l'inverno 2020/21. #Coronavirus permettendo. #Torino #AGEHAtorino #TORINOstateofmind #supportyourlocalsneakershop
2231580127358426309; 0; False; 1580245103; can we? #shrek #ww3 #trump #usa #iran #coronavirus #corona #chinese #kobebryant #kobe #2020 #australia #fire
2231580091775964690; 0; False; 1580245099; Tweet bastante acertado, muchas veces los programas caen en temas de actualidad sin saber, o con una opinión errónea . . . . #corona #coronavirus #coronaviruschina #coronavirusnews #ncov #ncov2019 #virus #viruscorona #coronaviruschina #viruschina2020 #viruschina2019 #viruswuhan #wuhanvirus #wuhancoronavirus #coronawuhan #wuhan #wuhanchina #wuhanvirus #wuhanpneumonia #pneumonia #china #chinavirus
2231580090231970294; 1; False; 1580245098; Siamo in una botte...di legno, Piena di vino. • • • #ipujttan #viruscorona #coronavirus #meme
2231579631230753843; 3; False; 1580245096; COMPARTE O MIERE TU MAMÁ! #coronavirus #isladelastentaciones #terror #historiasdeterror #ww3
2231577808925517149; 18; False; 1580245095; You bumped your head if you don’t think I’m going to call shit nasty as fuck. I have no ill-will towards the people of China and wish them luck in someday being free. But god damn, bud. #coronavirus #politigram #coronavirusmemes #batsoup #eatthebugs #getinthepod #politicalmemes #china #cough #wuhan
2231579701971917284; 2; False; 1580245095; #cuba ve #jamaica da 7.7 şiddetinde deprem olduğu, görüntüler olay yerinden geldiği iddaa edildi. Görüntülerin Twitter’dan alıntı kesinliği yoktur.. - Daha fazlası için @dijitalmedyahaber . #bilim #bilimsel #inovasyon #virus #coronavirus #teknoloji #digitalartwork #digitalart #sağlık #takip #takipet . #çin #wuhan . #deprem . #elazığ #earthquake #göçük #bina . #cuba #cübadeprem #cubaearthquake #jamaica .
2231580049931292654; 4; False; 1580245094; I took advice from public health doctors. Tried to present a more balanced view rather than giving into mass media hype. Apparently some people don't like me summarising evidence for them. To note 1. I'm not chinese (not that that is a problem) 2. I'm not trying to down play it 3. We still need to be careful while the outbreak declares its further characteristics (think before you travel, hygiene, etc) #news #youtube #haters #racist #prejudice #auckland #Newzealand #doctor #coronavirus #virus #outbreak #infection #wuhan #china #오클랜드 #뉴질랜드 #youtuber #우한 #우한코로나 #바이러스 #감염 #우한폐렴
2231580044413001148; 1; False; 1580245093; #DollyPartonChallenge #CanDoItAllChallenge #SocialChallenge (additional note: i dont play facebook, linkedin, grindr, tinder)
2231580004314411190; 1; False; 1580245088; Як швидко від розповсюджується :exploding_head:
2231579990080817231; 0; False; 1580245086; #coronavirus #chine #chinois
2231579974007413554; 0; False; 1580245084; :face_with_medical_mask::face_with_medical_mask::face_with_medical_mask: #memes #coronavirus #mildlyracist
2231579769527448893; 0; False; 1580245083; @wudangxuanmen Wudang Xuan Men Wushu Academy... Pray for us ... #kungfu #kungfulife #wudangxuanmen #prayforus #coronavirus
2231579946065837218; 2; False; 1580245081; “ :China: CoLona ViLus :crown: “ (POLCODIAZ!) Made by Me! . . #sketchoftheday #coronavirus #sketch #doodle #art #caricature #comic #toons #cartoon #crown #streetart #art #design #paint #draw #sketching #play #kik #virus #world #china #madeinchina #chinaexport #graffiti
2231579028654277631; 0; False; 1580245064; “There’s been a long queue of health sector workers in Mong Kok all evening, waiting to register for the new HA Employees Alliance trade union.⁣ ⁣ The queue is reaching its cut-off for today but will resume tomorrow.”⁣ ⁣ The union is protesting against the Hong Kong government’s approach to handling the coronavirus.⁣ ⁣ From aaronMCN on Twitter.⁣ ⁣ #news #breakingnews⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣ #worldnews⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣ #coronavirus #wuhanvirus #wuhancoronavirusoutbreak #WuhanCoronavirus⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣ #coronavirusoutbreak #corona #ncov2019 #ncov⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣ #武漢肺炎 #武汉疫情⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣ #China #Wuhan⁣⁣⁣⁣⁣ #StandWithWuhan⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣ #LunarNewYear #NewYear #SpringFestival⁣⁣ #HongKong
2231579502476109681; 0; False; 1580245037; (BAŞTAN DİYORUM EĞER BANA ABONE OLMAZSAN SANADA BULAŞIRIM. SONRA SÖYLEMEDİ DEME) Afiyet olsun aq çocuğu . . . . . . . . . . #socialsteeze #tweegram #photooftheday #20likes #amazing #smile #follow4follow #like4like #look #instalike #igers #picoftheday #instacool #carryme #follow #colorful #style #swag #corona #china #pekin #shanghai #turkey #virus #corona #coronavirus #önlem #çin #türkiye #japanese #japan
2231579571245798195; 28; False; 1580245036; Si viajarás o estás en países o zonas donde se han detectado casos del nuevo #CoronaVirus, te entregamos estas recomendaciones para evitar su contagio. Ante cualquier duda llama a #SaludResponde 600 360 7777
2231578864807488677; 0; False; 1580245034; Şangay metro . . . . . #turkey #türkiye #corona #korona #virüs #coronavirüs #sondakika #istanbul #bursa #izmir #ankara #hasta #hastalık #virus #coronavirus #haber #haberler #sondakikahaberler #çin #china #wuhan #güncel #güncelhaber #güncelhaberler #coronaviruses #coronaviruese #new #news #sondakikahaberleri
2231579549351967363; 4; False; 1580245034; #coronavirus #coronavirusoutbreak by: @geosfoli #kobe #kobebryant #impeachtrump #ww3 #fox11 #foxnews #abc7eyewitness #news #nbc
2231579513137726957; 1; False; 1580245030; Can never have too many excuses to drink :sneezing_face: Follow @emperorcandle Follow @emperorcandle Follow @emperorcandle
2231579514058986709; 3; False; 1580245030; The 1692 Jamaica earthquake struck Port Royal, Jamaica on 7 June Known as the "storehouse and treasury of the West Indies", and as "one of the wickedest places on Earth", it was, at the time, the unofficial capital of Jamaica, one of the busiest and wealthiest ports in the West Indies, and a common home port for many of the privateers and pirates operating within the Caribbean Sea. The earthquake caused most of the city to sink below sea level. About 2,000 people died as a result of the earthquake and the following tsunami; and, about another 3,000 people died in the days following the earthquakes, due to injuries and disease. #coronavirus #corona #earthquake #jamaicanhistory #jamaica #jamaicansbelike #kartel #vybzkartel #jamaicaearthquake #jamaicanmemes
2231579222950069867; 0; False; 1580244995; CoronavirusLive - Fourth patient with coronavirus admitted in France, three new cases in Germany #coronavirus #liveupdates #update #virus #china #amerika #englich #engels #follow #followers #end #endofworld #news #europa #world #vacsine #country #netherlands #paris #parijs
2231578460166210207; 0; False; 1580244965; Fermana Enfeksiyon Bulaşti #coronavirüs #coronavirus #çin @taner_olmez @sinemunsal @evcenf @burakozcivit @taner_olmez @iynemliarasbulut @burakozcivit #kuruluşosman #burakozcivit @ceyhancihangir @adem_kilicci @taner_olmez @okaykoksallofficial @damlacan #afilliaşk @onurtuna @taner_olmez @mucizedoktorfox @adem_kilicci #hakanhatipoğlu #gizemhatipoglu #hercai #ebrusahin #akinakinozu #reynmen #ademkilicci #dizi #birzamanlarçukurova #acunilicali #ceyhancihangir #aslanademkilicci #damlacan #survivor #yusufkarakaya #caglarertugrul #burcuozberk #cukur #masterchefturkiye #mucizedoktor #tanerolmez #onurtuna #sınemunsal #tanerölmez
2231577596760818739; 0; False; 1580244921; Staying Alive In China With Astro Helmets :alien::man_astronaut::face_with_medical_mask::victory_hand_light_skin_tone: #coronavirus #coronavirusprevention #coronavirusoutbreak
2231516242640961135; 12; False; 1580237487; La cosa che più mi preoccupa è che finché non torni a casa non avrò nessuno che mi alzerà le gambe alla mia prossima sincope. :woman_shrugging_light_skin_tone: #walkofshame
2231471394701511775; 5; False; 1580232335; :warning::warning::warning::warning: massacre of pigs, for the swine fever. Terrible videos. We have to stop this, Share and give a strong message to Chinese authorities. THIS MUST BE STOPPED #pigs #massacre #animals #china #chinapigs #swinefever #terriblevideos #coronavirus
2231469492039069657; 0; False; 1580231914; Please Do Not Falter under the newest Fear Campaign being shared and other such Global Sadness bombs (latest man made disease and death of polarized beloved figures) A SLEW OF FUCKERY AFOOT Parallel to current *biowarfare terrorism and high profile death(s) of our modern day heros, in a big way, these events(BIGmedia serving) also services to keep our morale (and energy levels) very low which in their effects, renders our decision making more malleable and any following fuckery admissible. Put simple, this mass manipulation move is nothing new actually. A cut-and-paste method rehatched and reused over and over, needles to say. ALWAYS REMEMBER: IRREGARDLESS OF ANY APPARENT DARKNESS PERCEIVED, THERE IS AFLAME DEEP WITHIN YOU PURE LIFE FORCE THAT IS STILL EVER ABLAZE AND SHINING FORTH. It is our Essence. This light, at our core, UNIFIES us all. If you are in fact afraid, please look to me and others for encouragement to bust through these devious efforts rather than be in support of the manufactured upheaval of fear, pain and sorrow. . #bigmedia #blackmambaforever #coronavirus #love. . . . Reposted from @lukewearechange IMO fear is the biggest factor that controls us and it’s important not to play into it. Wdyt? - #regrann
2231451998384157801; 0; False; 1580229829; IMPORTANTE :exclamation_mark::exclamation_mark: . . . . #med #medicina #medicinafamiliar #medical #med #life #medlife #medicalmedium #amomedicina #medlove #medicodefamilia #medico #medicina #MedicinaPreventiva #virus #coronavirus
2231451785976202824; 0; False; 1580229803; IMPORTANTE :exclamation_mark::exclamation_mark: . . . . #med #medicina #medicinafamiliar #medical #med #life #medlife #medicalmedium #amomedicina #medlove #medicodefamilia #medico #medicina #MedicinaPreventiva #virus #coronavirus
2231400960222239562; 0; False; 1580223748; :exclamation_mark:IMPORTANTE :exclamation_mark: Los coronavirus son un grupo extenso de virus de ARN con envoltura viral comunes SÍNTOMAS :white_heavy_check_mark:Secreción y goteo nasal. :white_heavy_check_mark:Tos. :white_heavy_check_mark:Fatiga. :white_heavy_check_mark:Dolor de garganta y de cabeza. :white_heavy_check_mark:Fiebre. :white_heavy_check_mark:Escalofríos y malestar general. :white_heavy_check_mark:Dificultad para respirar (disnea) Tal y como ocurre con el virus de la gripe, los síntomas más graves (y la mayor mortalidad) se registra tanto en personas mayores como en aquellos individuos con inmunodepresión o con enfermedades crónicas como diabetes, algunos tipos de cáncer o enfermedad pulmonar crónica. En casos extremos puede ocasionar insuficiencia respiratoria. #coronavirus #lima #chile #colombia #españa #nivelmundial
2040006891506892105; 1; False; 1557407859; My @ had got too big on the :magnifying_glass_tilted_left: so they had to off me like #alexjones ,now let's see which" truther " goin' to mention/guest host me:thinking_face: now.. #joerogan @joerogan maybe ?too raw for the algorithm :fire: #kobebryantdied in helicopter on #kobebryantcartoon in 2016 also:man_shrugging_medium-dark_skin_tone::thinking_face: orwell edwardsnowden #billgates #patent #viral #coronavirus #iran #china NSA #theylive #pedoelitist #epsteindidntkillhimself #orlandobrown #westworld #harveyweinstein #elsagate #oprah personofinterest #theylive #vacinnes humanity #plauge trending #kobebryantconspiracy #metzizahbpeh #pizzagate #pedophilialegalizationmustbestopped #rickygervaise behindthescenes #adrenochrome #lebronjames #humantraffickingawareness #organharvesting 333me.life now since they cancelled my Youtube like they cancelled #issackappy Good job every1 ,I feel so good that I'm dedicating my entire life into Channeling divEYEness, even tho the algorithm suppresses my content:eye::OK_hand_medium-dark_skin_tone:w3 ar3 th3 saviors-take care+stay aware. 333me.life
2231579507970317218; 0; False; 1580245029; Dios nos guarde del #coronavirus
2231579501651980982; 4; False; 1580245028; Está com dúvidas sobre o Coronavírus? Separamos algumas informações importantes para você ficar por dentro do assunto. Saiba mais acessando o link: http://bit.ly/coronavirus_delboni #coronavirus #saude
2231579501519876881; 0; False; 1580245028; #coronavirus #chine #chinois
2231579336532630001; 0; False; 1580245026; AHAHAHHA - #asian #asiantiktok #tiktok #coronavirus #viral #meme #joking
2231579041394841863; 0; False; 1580245024; Credit: @conscious_awareness_ #coronavirus #coronaviruses #coronaviruschina #china #virus #corona #health #meme #viruscorona #doctor #disease #news #repost #patent #dead #deadly #truth #truthbetold #truthbomb #truth:hundred_points: #truthhurts #truthseeker #wakeup #wakeupworld #wakeupgoals #wakeupamerica #wakeupandlive #wakeupsheeple #wakeupcall #wakeupnow
2231579346892331157; 0; False; 1580245010; El ministro de Salud de Brasil, Luiz Henrique Mandetta, informó este martes que no hay evidencia de que el coronavirus esté circulando en Brasil, pero indicó que se sospecha de un caso en Minas Gerais que todavía está siendo analizado. Se trata de una paciente que viajó a Wuhan, China, epicentro de la crisis, y que presenta todos los síntomas. Por este motivo, el ministro indicó que la cartera subió el nivel de clasificación de riesgo a "dos", que significa "peligro inminente". "A medida que identificamos el primer caso que se ajusta a la definición, ingresamos al nivel 2, que es un peligro inminente (de que el virus llegue al país). Y si tenemos una alerta, sin casos sospechosos, desde el primer caso, declaramos una emergencia de salud pública de importancia nacional ", explicó el secretario de vigilancia de la salud, Wanderson Oliveira. Leer más en: www.demosnoticia.com #DemosNoticias #28Ene #Brasil #Coronavirus #Noticias #News
2231578955428062473; 0; False; 1580245004; #Corona virüsünün ilk kez ortaya çıktığı #Wuhan'da İngilizce öğretmenliği yapan Türk vatandaşı Burcu Öner, kentteki son durumu NTV yayınında anlattı. Burcu Öner, evlerinden çıkamadıklarını, pencereleri açmadıklarını söyledi. Ülkede 17 kent hayalet sehre dönüştü. Son bilgilere göre ölü sayısı 106'ya yükseldi. Virüsün tespit edildiği vaka sayısı ise 5 bine yaklaştı. #Almanya'da ilk kez corona #virüs tespit edildi. Wuhan kentinde yaşayanlar, morallerini yüksek tutmak için geceleri binalarında bağırarak birbirlerini motive etmeye çalışıyor. O anlara dair pek çok görüntü sosyal medyada paylaşıldı. #wuhan #wuhancoronavirus #coronavirus #hubei #çin #china #sondakika #dünya #salgın
2231579285462076935; 0; False; 1580245002; :globe_with_meridians::newspaper:La Secretaria de Salud del Gobierno del estado de Chihuahua descartó la existencia en cualquier hospital, público o privado de la capital o de todo el estado, de algún caso sospechoso de la enfermedad coronavirus. Se informó que la subdirección de epidemiología de la Secretaria de salud estableció contacto con el área de epidemiología de un hospital, en las que varias versiones relacionaron con un caso sopechoso y se confirmó que no existe persona alguna tratada por ese padecimiento. #telediario #coronavirus #multimediosnoticias #chihuahua
2231579254802460178; 3; False; 1580244999; :warning:O mundo todo está em alerta por conta do CORONAVÍRUS. Na China, país onde o vírus foi descoberto, já são mais de 100 mortes confirmadas, e um caso é investigado em Minas Gerais. Saiba o que é o vírus e como agir!
2231578318524761586; 0; False; 1580244997; #coronavirus #chine #chinois
2231579037101339737; 0; False; 1580244996; #coronavirus jpp :face_with_tears_of_joy::face_with_tears_of_joy:
2231579208698636429; 1; False; 1580244993; Bona nit! Avui us compartim una publicació del Co·legi de Farmacèutics de València sobre el famós Coronavirus. De moment no ens hem d'alarmar, així que tranquilitzeu a amics i familiars. #farmacia #cardedeu #coronavirus #grip #salut . Reposted from @micofvlc El coronavirus de Wuhan es protagonista en las noticias de todo el mundo :globe_showing_Europe-Africa: Pero no te dejes llevar por el miedo. Aquí te dejamos información básica sobre este virus y algunos #consejosMICOF para evitar el contagio :backhand_index_pointing_down: - #regrann
2231579185864735208; 0; False; 1580244991; ...and then? . . #asiangirls #coronavirus
2231579137856011008; 0; False; 1580244985; Vamos ficar em alerta :skull_and_crossbones: Reportagem completa da @ocpnews @divesantacatarina https://ocp.news/seguranca/curtas/santa-catarina-esta-em-alerta-para-a-possiveis-ocorrencias-do-coronavirus?utm_medium=OCPS&utm_source=WP&utm_campaign=CORONA_VIRUS . . . . . . #coronavirus #saude #prevencao
2231579085310516889; 0; False; 1580244979; :police_car_light: El #AlmorsaderoDT te informa: A continuación te damos a conocer varias medidas que son necesarias para prevenir el #coronavirus.
2231579030944001303; 0; False; 1580244972; (BAŞTAN DİYORUM EĞER BANA ABONE OLMAZSAN SANADA BULAŞIRIM. SONRA SÖYLEMEDİ DEME) Afiyet olsun aq çocuğu . . . . . . . . . . #socialsteeze #tweegram #photooftheday #20likes #amazing #smile #follow4follow #like4like #look #instalike #igers #picoftheday #instacool #carryme #follow #colorful #style #swag #corona #china #pekin #shanghai #turkey #virus #corona #coronavirus #önlem #çin #türkiye #japanese #japan
2231575294305551669; 1; False; 1580244968; #unreal #visualization #corona #virus #coronavirus #blood #redgiant #redgiantnews #trapcode #trapcodeparticular #microscope #science #animation #animatedart #animated #bloodflow #emitter #particle #particles #particlephysics #fluid #flu #infection #2019ncov
2231578942108060268; 0; False; 1580244961; #coronavirus #wuhan
2231578927132979891; 1; False; 1580244960; When you see Chinese wearing masks:face_with_medical_mask:, plz don’t be panic. We are not walking pathogens. :microbe:Most of us are just students who focused on the outbreak in our country:China:. And we just want to prevent same thing happen in another land since the coronavirus can spread without obvious symptoms. Be responsible for yourself and others, put masks on before the local news alarms you. Mask is the way of protection, it’s not a sign of illness. As I always believe, experience all, understand all, then be yourself. Against virus not each others after all we’re all same kind.:globe_showing_Americas::globe_showing_Europe-Africa::globe_showing_Asia-Australia: We learn, we change and we will do better.:folded_hands:#coronavirus #putmaskonyourfacefirst
2231578890392179626; 0; False; 1580244955; Don't keep hearing about it and you don't know how to go about it DM for more info on how to go about it #investment#growth#houston#bitcoin#binary#crypto#vision#business#entreprenuer#forex#australia#canada#france#china#corona#coronavirus#aquarius#libra#usa#europe#uk#joker#businessdaily
2231578837225672724; 1; False; 1580244949; 29/1/2020 Warning: Please turn away now if you feel you cannot handle another update on #wuhan #coronavirus. I’m sharing for what I feel is beneficial first of all to myself, and I exercise full discernment on what I read on the internet, meaning EVERYTHING - official and unofficial with a pinch of salt. I suggest you exercise the same caution. I feel these individuals are doing a huge service to the world by providing their personal updates, so I get into an apoplectic fit when people don’t take the damn time to go do your own search on these people that are so easily searchable, exercise discernment but instead, fly off the handle about people “spreading fake news” when their intent is FAR from that. I understand it’s all fear and while I empathise, I also have no time for such negativity - denial and plain rudeness - ok maybe I got 1 or 2 mins to block and delete ‘cos your sense of entitlement makes me sicker than news of the virus. You have been warned. These people are already living in “hell” so even if got discrepancies, pls lah, they don’t owe us anything so don’t be one kind can? :angry_face: Mental health check. If it helps to not know, then really don’t read anything relating to this virus anymore. We all deal with things differently and it’s fine if you’d rather not know. We all need to feel safe, and safety means different things to everyone. Safety first :index_pointing_up: If this has sufficiently offended/worried you, please skip, block, delete. If you wanna know more, then please continue... Sharing 2 separate posts (1-2 days apart) from Daniel Ou Yang, a friend of Danny Chen’s whose post I shared previously. It’s great to hear from his account that the fatality risk is not as high as it’s contagion rate. Let’s hope that’s true/stays that way :slightly_smiling_face: From what I’ve read, Daniel is an Ozzie stuck in Wuhan. Again, like Danny, his FB is made public so you can EASILY search and decide for yourself if he’s legit.:heavy_heart_exclamation:Hope Daniel gets his wish, that is to have the Ozzie govt make arrangements to get him and his family back home. And he’s right, all the medical personnel are making the hugest effort and sacrifice to deal with this crisis all over. :heart_suit: and support to them.
2231578712686842225; 1; False; 1580244934; El ministro de #Salud, Jaime Mañalich, entregó la información y aseguró que en #Chile "tenemos la capacidad instalada para el diagnóstico específico para esta #infección". Además, confirmó que en nuestro país se estudiaron tres casos sospechosos de #coronavirus que finalmente fueron descartados por la autoridad. Reposted from @meganoticiascl.
2231578697327308211; 0; False; 1580244932; the cure to the #coronavirus :OK_hand:
2231578632365739604; 0; False; 1580244925; We do research on everything and we provide you with the best updates and information. #coronavirus #coronaoutbreak #corona #virus #outbreak #china #wuhan #updates #crn #coronavirusoutbreak
2231578443866674396; 1; False; 1580244913; ATCHOUM #coronavirus
2231511919823847400; 3; False; 1580244906; “A hero dropping off face masks to a police station in Anhui Province in China.“⁣ ⁣ From DarrenPlymouth on Twitter.⁣ ⁣ #news #breakingnews⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣ #worldnews⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣ #coronavirus #wuhanvirus #wuhancoronavirusoutbreak #WuhanCoronavirus⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣ #coronavirusoutbreak #corona #ncov2019 #ncov⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣ #武漢肺炎 #武汉疫情⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣ #China #Wuhan⁣⁣⁣⁣⁣ #StandWithWuhan⁣⁣⁣⁣⁣⁣⁣⁣⁣⁣ #LunarNewYear #NewYear #SpringFestival⁣⁣
2231577437510323270; 1; False; 1580244904; RUS: Очередь в аптеку за медицинскими масками :face_with_medical_mask: ENG: The queue to the pharmacy behind medical masks. #china #china:China: #coronavirus #coronaviruses #corona #instagram #instadaily #news #picoftheday #life #wuhan #video #китай #коронавирус #новости #вирус
2231578078786435840; 0; False; 1580244902; #virus #coronavirus #uk #chinese #wuan #doctor #usa #medicine #flu #eu #europe #brexit #germany #france #italy #indian #russia #kazakistan:Kazakhstan: #azerbaycan:Azerbaijan: #türkiye
2231578044325129277; 0; False; 1580244885; Follow for daily memes. . . . . . . . #tiktokmemes #memes #meme #funnymemes #tiktok #tiktokfunny #follow #followforfollowback #dankmemes #memesdaily #dankmemesdaily #virus #corona #coronavirus #coronavirusmemes
2231578271170734533; 0; False; 1580244882; ☆ please read :exclamation_mark::growing_heart: - ☆ follow us ( @softly.threads ) for more helpful posts! :cactus::ringed_planet::cherry_blossom: - :teddy_bear:| we post daily! :mushroom:| date: 28 jan :cherry_blossom:| follower count: 255 :butterfly:| inspo: @/myself - ☆ mesaage for you all: please stay safe :revolving_hearts::growing_heart::red_heart: - ☆ tags (ignore) :label:: #thread #coolthreads #helpfulthread #selfcarethread #selflovethread #clearskinthread #glowup #photoinspo #vscoaesthetic #explorepage #aestheticthread #meme #wholesome #nichememe #cute #pinterestthread #fff #selfcare #selflove #vscothread #relevant #coronavirus #corona #staysafe #safety
2231578274299643631; 0; False; 1580244882; Yazacak birşey bulamadım .d #geritakip #corona #coronavirus #wuhan
2231578224579468434; 1; False; 1580244876; “WTF YVR In 60”| Episode 84| "Wesley Snipes"| • Watch The Full Episodes @ www.WTFYVR.com (link in bio) • LIKE | SHARE | COMMENT | SUBSCRIBE (on YouTube!) • Listen on Spotify | Apple Podcasts |
2231576910067249064; 1; False; 1580244875; Вот такая очередь в больницу ! И это только начало ! #коронавирус #coronavirus #virus #новости #китай #china #chinaglaze
2231577944602289208; 0; False; 1580244871; :Turkey:Jamaikada 7.7 büyüklüğünde deprem meydana geldi. Depremin etkisi videoda! :European_Union:A 7.7 magnitude earthquake occurred in Jamaica. Earthquake effect in Jamaica! #clinicalnews #coronavirus #virusoutbreak #corona #health #nursing #nurse #wuhan2020 #wuhanvirus #coronaoutbreak #who #china #doctor #hospital #european #europe #crisis #lastnews #cdc #coronavirus #wuhan2020 #outbreak #usa #earthquake #jamaica #deprem #jamaicaearthquake #cuba #usaearthquake #cubaearthquake
2231577069972672803; 0; False; 1580244865; #coronavirus #chine #chinois
2231577877735575159; 4; False; 1580244864; Día 95 de #enero Hendy. #asuncion #paraguay #instavideo #coronavirus #china #instafood #food #foodstagram #foodlover #chinese #chinesefood #yummy #delicius
2231578094456476218; 0; False; 1580244860; A scientist ( and his team ) :thumbs_up_light_skin_tone: Just Grew The #Coronavirus In A Lab #unitebehindthescience #australianscientists #vaccines #climateemergency @abcnews_au
2231578064104483335; 0; False; 1580244857; :police_car_light: Informação nunca é demais ! #cafitunopar #fisioterapiaunopar #utilidadepublica #coronavirus
2231578047478683181; 0; False; 1580244855; With the recent news of the first cases in Canada and multiple others across the globe, the Coronavirus outbreak is affecting the world in many ways, including economically. Read what this virus can mean for the economic and local real estate.⠀ ⠀ https://www.finpedient.com/how-the-coronavirus-outbreak-is-affecting-the-global-economy-real-estate/⠀ ⠀ #coronavirus #breakingnews #realestatenews #realestate #housingmarket #fraservalley #economy
2231578052445156010; 3; False; 1580244855; #farmlife #staysafe #coronavirus
2231578041790984080; 0; False; 1580244854; All jokes aside please please please be careful out there my suppressed immune system friends. To my healthy people: if you can afford to PLEASE stay home if you're sick and PLEASE stay out of public places (gyms, grocery stores, cafés etc). If you can't stay home (like many Americans because capitalism is crushing us) please be mindful and wipe down any shared workspace, keep your distance, and wash your hands. Please wear a mask at the doctor's office if you have a cough or fever. You may not feel "that sick" and can power through, but you can put people like me at very serious risk. Please be mindful :purple_heart: . . . . . . . . . . . . #autoimmunedisorder #autoimmunedisease #coronavirus #SickClub #spoontheory #spoonies #ulcerativecolitis #uc #ibd #crohnsandcolitis
2231578015955268672; 0; False; 1580244851; :face_with_medical_mask:우한폐렴”에서 살아남기:raising_hands_light_skin_tone: • • 신종 코로나바이러스 감염증 예방을 위해서는 마스크뿐 아니라 손을 자주, 깨끗이 씻는 것이 중요하다. • • • 바이러스 감염자의 침 등이 의자, 책상, 벽 등에 묻어 있는 상태에서 제 3자가 이를 손으로 만질 수 있기 때문이다. 감염자의 침 등에 접촉한 손으로 눈이나 입을 만지면 점막을 타고 바이러스 감염이 가능하다. • • • 그리고 면역력이 떨어지면 바이러스 감염도 쉽다. 그래서 면역력을 높이는 식품이나 제품을 강추:thumbs_up: 뉴스킨의 파마넥스 제품중에는 면역력을 높이는 슈퍼푸드 제품이 많다. 레이시맥스, 발효홍삼, G3, 티그린 97 등을 뽑을 수 있다. • • • 미리 감염에 대한 예방 수칙을 잘 지켜서 “소중한 우리의 몸 스스로 챙기자” :thumbs_up::thumbs_up::thumbs_up: • • • • • #jasminesnuskin #자스민뉴스킨 #nuskin #coronavirus #wuhan #코로나바이러스 #우한폐렴 #마스크 #손씻기 #면역 #파마넥스 #예방수칙
2231578001425395632; 39; False; 1580244849; :face_with_medical_mask: No lo iba a colgar hasta mañana... pero viendo que la cosa esta que arde... va a tocar hablar hoy del Coronavirus este que tiene a los chinos tela de preocupados⁣ ⁣⁣ Lo primero... este tipo de virus ya ocasiono dos epidemias anteriores, el síndrome respiratorio de Oriente Medio (MERS) y el el síndrome respiratorio agudo severo (SARS), con unas tasas de mortalidad nada desdeñables del 35% y 18% respectivamente.⁣⁣ ⁣⁣ Al lío... se trata de una nueva cepa de coronavirus que, hasta entonces no se había encontrado en el ser humano que tiene su origen en China, más concretamente en la ciudad de Wuhan, y cuya existencia se comunico a la OMS el 31 de Diciembre de 2019. ⁣⁣ ⁣⁣ Los síntomas, las vías de contagio y las medidas a tomar te las cuento en la infografía y tienes mucha más información en el blog www.medicadoo.es ⁣⁣ ⁣⁣ Solo deciros que no cunda el pánico, al menos en España... que a pesar de que muchas veces los medios de comunicación tratan estos temas de una manera un tanto alarmista, mostrando imágenes que parecen sacadas de películas de apocalipsis zombies y fin del mundo, todo esto parece que por ahora nos queda un poco lejos y si conviene saber que es bastante poco probable que en España suframos un número significativo de casos y las autoridades nos dicen que el riesgo para la salud publica es muy bajo.⁣ ⁣ Aunque eso si... si vas a viajar a China extrema las precauciones y sobre todo... lavado de manos, solución hidroalcoholica a go go y la mascarilla si es necesaria (del tipo FFPII)⁣ ⁣ #consejofarmacéutico #consejomedicadoo #coronavirus #viruschino
2231578000385068593; 1; False; 1580244849; Bolsa é um excelente investimento? Sem duvidas! Investir na bolsa é fácil? COM CERTEZA NÃO!!! . . O mercado é complexo e influenciado por diversos fatores que mts vezes vc n vai nem entender o pq de tal relação! Investir na bolsa é entender um pouco de tudo, de safra de milho a vírus, de funcionamento de trem a complexidade do sistema financeiro! Fica a notícia da @infomoney pra representar bem o falado! . . #investimentos #coronavirus #bolsa
2231577926691131568; 0; False; 1580244840; @ascensionenergies :white_exclamation_mark::white_exclamation_mark::white_exclamation_mark: nothing can stop the great awakening :eye: no need to fear or worry you are powerful beyond belief :dizzy: my pillars of light HIGH VIBRATIONS AT ALL TIMES :woman_genie::genie: LOVE IS OUR SUPERPOWER :revolving_hearts: #coronavirus
2231577895386358775; 0; False; 1580244837; :red_circle:Una alimentación basada en productos enteros y naturales, con presencia de 5 a 10 raciones diarias de frutas y hortalizas, la mitad de ellas frescas, permite el buen funcionamiento de los sistemas defensivos del organismo. :sleeping_face:El descanso nocturno con suficiente sueño de calidad es imprescindible para mantener el número y la actividad de las células inmunitarias que detectan y eliminan los virus antes de que se conviertan en un problema. Además, durante el día :bright_button: conviene realizar paradas en el trabajo y practicar meditación, respiración consciente o alguna técnica de relajación. :warning:Además de estos hábitos, ciertos alimentos y plantas poseen probadas propiedades antivíricas.:warning: El orégano :leaf_fluttering_in_wind: incluye en su composición sustancias antivirales como el carvacrol. La salvia :herb: es una planta aromática que se ha utilizado tradicionalmente para tratar infecciones virales. Puedes prepararte una infusión con 15 g de hojas secas por litro de agua. El hinojo es una planta con sabor dulce que puede combatir ciertos virus, gracias a compuestos como el transanetol. Se consumen las hojas y las flores frescas, que se pueden picar y añadir a ensaladas y salsas. :cross_mark_button:No se recomienda a niños :baby:, ni a mujeres embarazadas:cross_mark_button: :red_circle:El ajo es un alimento antivírico por excelencia. Su eficacia contra los virus se ha probado en estudios en probeta. Conviene consumirlo crudo para aprovechar sus cualidades. Si lo vas a cocinarlo :cooking:, pícalo media hora antes para que interesactúen sus principios activos y enzimas. De esta manera conservará buena parte de sus propiedades. #vidasana #menteycuerpo #virus #coronavirus #tipsaludable #wuhan #prevención #alerta
2231577797372420067; 1; False; 1580244825; Esta foto fue tomada en el mercado de wuhan, (el mercado que les menciones en la post anterior donde se cree que se originó el coronavirus) Hasta el momento hay aproximadamente 4.515 personas infectadas y 106 fallecidos. #crueltyfree #consumoresponsable #coronavirus #wuhan #maltratoanimal
2231577780410317613; 0; False; 1580244823; ÖNCEKI POSTA LÜTFEN BAKIN.Wuhan/china #coronavirus #coronatedavisi #coronavirus #coronaviruses #corona #china #çin #wuhan #coronatreatment #viruscorona #coronas #fenerbahçe #galatasaray #beşiktaş #fenerbahce #dünya#hasta #ateş #bulantı #uykusuzluk #hastane #tedavi #önlem Wuhan/china #coronavirus #coronatedavisi #coronavirus #coronaviruses #corona #china #çin #wuhan #coronatreatment #viruscorona #coronas #fenerbahçe #galatasaray #beşiktaş #fenerbahce #dünya#hasta #ateş #bulantı #uykusuzluk #hastan
2231577452141344346; 0; False; 1580244817; Строительство больницы для заболевших от Корона Вируса 2019-nCoV. Обещали построить до 12 февраля 2020 года. #коронавирус #coronavirus #news #ухань
2231577368227922738; 0; False; 1580244815; #coronavirus #coronavirusoutbreak #coronaviruses #coronaviruschina #coronavirusinfection #coronavirusnews #coronavirusbrasil #coronaviruscanada
2231577700024114489; 0; False; 1580244813; :Turkey:Jamaikada 7.7 büyüklüğünde deprem meydana geldi. Depremin etkisi videoda! :European_Union:A 7.7 magnitude earthquake occurred in Jamaica. Earthquake effect in Jamaica! #clinicalnews #coronavirus #virusoutbreak #corona #health #nursing #nurse #wuhan2020 #wuhanvirus #coronaoutbreak #who #china #doctor #hospital #european #europe #crisis #lastnews #cdc #coronavirus #wuhan2020 #outbreak #usa #earthquake #jamaica #deprem #jamaicaearthquake #cuba #usaearthquake #cubaearthquake
2231577627561414735; 0; False; 1580244805; Noooo not the corona virus :loudly_crying_face: :face_with_tears_of_joy::face_with_tears_of_joy::face_with_tears_of_joy::face_with_tears_of_joy: . . . . . #memes #lol #lmao #haha #memesdaily #memes:face_with_tears_of_joy: #fuckit #hilarious #hilariousmemes #funnyshit #funny #ha #laughmyassoff #laughing #funnymemes #funnymemesdaily #life #facts #sickofyourshit #:face_with_tears_of_joy: #coronavirus
2231577550899278837; 0; False; 1580244796; Um novo vírus que ataca o sistema respiratório e se espalhou a partir da região de Wuhan, na China, preocupa o planeta. Ele pertence à família dos coronavírus, um grupo que reúne desde agentes infecciosos que provocam sintomas de resfriado até outros com manifestações mais graves, como os causadores da Sars (sigla em inglês para Síndrome Respiratória Aguda Grave) e da Mers (Síndromes Respiratória do Oriente Médio). De acordo com as investigações ainda em andamento, o novo coronavírus pode ter origem em serpentes ou morcegos — inclusive se especula que a ingestão de um desses animais teria originado o surto. Apesar de um estudo chinês ter encontrado uma relação do novo coronavírus com cobras, não existe consenso entre os cientistas sobre a origem da doença. Muitos apostam que outro animal possa estar envolvido com o início do problema na China. • • • • • • • • #informação #coronavirus #china #curiosidades #conhecimento #virus #doença #dizpramim #fatos #mundonovo #rumo500seguidores #rumoa500seguidores #saber #segueai #f4f #curta
2231577557617311201; 0; False; 1580244796; #white #people #coronavirus #chickensoup #jokes #memes #hmmm #we #prolly #made #it @theoutsidevoiceshow
2231577477743149531; 1; False; 1580244787; :red_triangle_pointed_up: IMPORTANTE :South_Korea: CORONAVÍRUS :red_triangle_pointed_up: Se você está viajando aqui pela Coreia: Use a máscara KF-94 ou KF-95; Higienize as mãos com álcool em gel; Evite aglomerações; Dessa forma você vai estar estar mais seguro e contribuindo para que essa situação se resolva o mais rápido possível. Caso você tenha alguns dos sintomas do coronavírus, visite o hospital o mais rápido possível. Para saber mais informações, visite o site da Organização Mundial de Saúde: Site: who.int #coronavirus
2231577458843736212; 7; False; 1580244785; Have fun with this people.. :face_with_tears_of_joy: Image ganked from @voluntaryasmine_ _______ #China #Coronavirus #CoronaExtra #Bats #DontEatBats #Outbreak #Viruses #Depopulation #DontEatAnimals #People #Humans #Animals #FunnyShit #Humor #Memes #MemesAreLife #GoodShit
2231577075609673159; 0; False; 1580244777; :Turkey:Jamaikada 7.7 büyüklüğünde deprem meydana geldi. Depremin etkisi videoda! :European_Union:A 7.7 magnitude earthquake occurred in Jamaica. Earthquake effect in Jamaica! #clinicalnews #coronavirus #virusoutbreak #corona #health #nursing #nurse #wuhan2020 #wuhanvirus #coronaoutbreak #who #china #doctor #hospital #european #europe #crisis #lastnews #cdc #coronavirus #wuhan2020 #outbreak #usa #earthquake #jamaica #deprem #jamaicaearthquake #cuba #usaearthquake #cubaearthquake
2231577378212163569; 0; False; 1580244775; (BAŞTAN DİYORUM EĞER BANA ABONE OLMAZSAN SANADA BULAŞIRIM. SONRA SÖYLEMEDİ DEME) geliyoruummm. #china #pekin #shanghai #turkey #virus #corona #coronavirus #önlem #çin #türkiye #japanese #japan
2231577352048163207; 1; False; 1580244772; #coronavirus #mundschutz:face_with_medical_mask: #keinanderesthema
2231577274041080957; 0; False; 1580244763; İlk Lol postumuz takip,beğeni,yorum plss.... . . . . . . . . #loltürkiye #lol #jayce #esports #zed #akali #lolcosplay #lolcosplays #lolmontages #lolmontage #leagueoflegends #facebook #linkedin #instagram #tinder #tiktok #katarina #katarinamontage #jaycee #blitzcrank #qiyana #sett #kassadin #morgana #coronavirus
2231577205977643431; 3; False; 1580244755; Attention 4 real if u around Ontario #ontariocalifornia #Ontario #Ont #Coronavirus
2231577196875808216; 0; False; 1580244753; Nos arredores de Wuhan, na China, a construção de um hospital com mil leitos, para tratar pacientes com coronavírus, se assemelha a uma corrida contra o relógio, com centenas de trabalhadores, dezenas de escavadeiras e seus termômetros para detectar a pneumonia viral. "É preciso trabalhar rápido para combater a epidemia", diz um trabalhador, que prefere não dar seu nome. ⠀ Acesse a notícia completa no .⠀ ⠀⠀ www.inbec.com.br/blog ⠀ #INBEC #PósGraduação #Especialização #Educação #Engenharia #Arquitetura #Blog #Hospital #China #Wuhan #CoronaVirus
2231577176447594764; 0; False; 1580244751; Hay que hp :microbe: virus tan fuerte ! Ósea , nada que hacer !!! #corona #coronavirus #salud #lamadre
2231577125018747292; 426; False; 1580244745; #bayern #coronavirus #news #nachrichten #nachricht
2231577129496294885; 0; False; 1580244745; The unfortunate truth. #coronavirus #virus #rip #life #meme #memenation
2231577067724984473; 1; False; 1580244738; What are ur thoughts on this? - - -YouTube channel in my bio! - -Credit: wigsandtea
2231576368466642133; 0; False; 1580244733; #coronavirus #onehundredthousandinfected I was thinking this was a vaccine promotional campaign and it may yet be but I'm finding a lot of leaks showing and stating much larger casualty lists. Bat soup is bullshit. Check the patent.
2231576582231800247; 1; False; 1580244733; #cuba ve #jamaica da 7.7 şiddetinde deprem olduğu, görüntüler olay yerinden geldiği iddaa edildi. Görüntülerin Twitter’da deprem araştırma sayfalarında alınmıştır.. - #Deprem Amerika sahillerindede hissedildiği söyleniyor! Daha fazlası için @dijitalmedyahaber . #bilim #bilimsel #inovasyon #virus #coronavirus #teknoloji #digitalartwork #digitalart #sağlık #takip #takipet . #çin #wuhan . #deprem . #elazığ #earthquake #göçük #bina . #cuba #cübadeprem #cubaearthquake #jamaica .
2231577015830653005; 0; False; 1580244732; U don goofed #wuhanclan #wuhan #wuhanchina #corona #coronavirus #coronachan #worldwarz
2231577020756508802; 7; False; 1580244732; I FLY to CHINA The video link in the Description! Çin’e Gidiyorum! Video Linki Profilde! . . #corona #coronavirus #coronavirüsü #coronadisease #china #çin #chinavirus #wuhan #vuhan
2231575457907894296; 0; False; 1580244725; :video_camera::television:|| El Aeropuerto Internacional de El Salvador ha habilitado una cámara térmica que permitirá detectar casos sospechosos de #coronavirus para tomar acciones y evitar su propagación. . Más información en el siguiente video.:backhand_index_pointing_up_light_skin_tone:
2231576928162574128; 2; False; 1580244721; I thought disney was disneph or disnegp or disnefg sth like that Very useful tags,: #dankmemescanmeltsteelbeams #anime #virus #fortnite #memes #offensivememes #followforfollowback #cancer #dankmemes #blackops4 #naruto #dbz #tags #fortnitefunny #likeforlikes #likeforfollow #dank #kobe #wuhan #coronavirus #corona #china #disney
2231576925485640204; 2; False; 1580244721; If you’ve played the game you know you’ll be safe in Greenland :heavy_minus_sign: :heavy_minus_sign: #coronavirus #corona #virus #plague #plagueinc #games #gamememes #gamer #expert #science #sciencememes #chemistry #smart #dankmemes #sick #sickday
2231576909901434434; 0; False; 1580244719; #coronavirus
2231576876857949867; 5; False; 1580244715; Post the second slide on your story to fool your friends! - -Follow @coronavirusplague if you fell for it! - -Follow @coronavirusplague for more :skull: - - - - - - - Z - - Tags- #memes #dank #bruhmoment #wwz #dankmemes #ww3 #coronavirus #lmao #lol #meme #corona #yolo #china #disease #plagues #rofl #dead #explore #bruh #clown #clownmemes #w #haha #lmfao #memed #original #relatablememes #virus #plague #plaguememe
2231576862018468226; 1; False; 1580244714; #SonDakika | ALMANYA'DA 3 YENİ CORONA VAKASI! Almanya'nın Bavyera eyaletinde 1 kişinin ölümcül yeni tip #coronavirus 'e yakalandığının bildirilmesinin ardından ülkede 3 yeni vaka daha tespit edildiği bildirildi. Avrupa'da iki ülkede virüs tespit edilmiş oldu: Fransa-Almanya.
2231574751199919530; 0; False; 1580244714; #ExclusivasNotiMundo | #AnaPaulinaCeli, especialista infectóloga, explicó que la #comunidadcientífica todavía realiza estudios necesarios para determinar aspectos del #coronavirus, como la #letalidad y facilidad de contagio. Mira la entrevista en notimundo.com.ec
2231576853880270784; 1; False; 1580244713; #코로나바이러스 #우한폐렴 #코로나바이러스예방 #마스크필수 #kf94마스크 #선물받았당:wrapped_gift: #고마워요:two_hearts: #건강지킴이 #모두건강조심 #coronavirus #wuhanpneumonia #wearafacemask #washyourhands #keepyourhealth
2231576848630767551; 2; False; 1580244712; #coronavirus #patent #angstmache #panik #sos #virus #corona #nopanik #pharma #makes #money #wakeup #awake #highmind #donttrustgovernment #virus #corona #coronavirus #patent #wakeup #donttrustgovernment #pharmacy #pharma #makes #money #impfen #impfung #ruft #impflicht #panik #sos #panikmache #angst #geschäftsmodell #politik #kapitalismus #wirtschaft #awake
2231576835928515805; 1; False; 1580244710; **IMPORTANT** #coronavirusoutbreak #coronaviruschina #coronavirus #china #chinesenewyear #chinesenewyear2020 #wuhanchina #wuhancoronavirus #wuhanpneumonia #wuhan #medical #doctors #nurselife #help #chernobyl #coronavirusoutbreak
2231576789994420494; 2; False; 1580244705; Hong Kong is kinda acting like they're facing anarchy:face_with_tears_of_joy: - #follow4follow #l4l #followforfollow #fff #f4f #instalike #instalikesandfollowers4u #cute #tbt #like4like #followme #instagood #photography #photooftheday #likeforlike #love #instadaily #followback #lfl #picoftheday #germany #infection #coronavirus #virus #bavaria #confirmed #case #wuhan #china #instagram
2231576769231292769; 0; False; 1580244702; It's a privilege to have a tomorrow! #rip #to #all #the #people #who #left #too #soon #australia #bushfiresaustralia #bushfire #kobe #bryant #kobebryant #legend #unbornchild #gianna #la #lakers #8 #24 #coronavirus #bq4life
2231576741893981622; 0; False; 1580244699; #coronavirus #recoveryispossible
2231576711399602649; 0; False; 1580244696; If one of your loved ones has the #coronavirus, there are signs. You can get them help before it turns fatal, or they begin drinking zimas. #alwaysvigilant # corona
2231576664079732269; 1; False; 1580244690; Te compartimos este vídeo con datos específicos sobre el Coronavirus _______________ Fuente: EXPANSIÓN ___________ El virus pertenece a una familia de patógenos que abarca desde resfriados comunes hasta el Síndrome Respiratorio Agudo Severo (SARS), que mató a 648 personas entre 2002 y 2003. La Organización Mundial de la Salud actualmente se refiere a él como 2019-nCoV. ___________________________________________ Se cree que fue transmitido a los seres humanos en un mercado de pescados y mariscos en Wuhan, China. Los pacientes experimentan fiebre, tos, dificultad para respirar, neumonía, dolor en los músculos y no responden al tratamiento normal con antibióticos. ___________________________________________ Hasta el momento, no hay vacunas contra el coronavirus, pero hay cosas que se pueden hacer para reducir el riesgo de infección, como lavarse las manos constantemente y evitar el contacto con personas que puedan estar infectadas. ___________________________________________ Video link: https://www.youtube.com/watch?v=irBF_AOy2TM ———————— #virus #coronavirus #familia #sslud #prevención #sabiasque #loquedebesaber #padres #madres #niños #cuidado #doctor #pediatras #clips #videos #socialmedia #compartir
2231576620107193724; 3; False; 1580244685; LUCHANDO CONTRA EL NUEVO CORONAVIRUS. . Desde el reconocimiento del primer caso el 1ro de diciembre de 2019 de infecciones respiratorias severas de etiología inicialmente desconocida, fue el 31 de diciembre que las autoridades sanitarias declararon el alerta sanitario, y cerraron el mercado de mariscos de Wuhan de donde se diseminó este problema. . A pesar de algunos errores iniciales de estas autoridades de Wuhan de no identificar y alertar con mayor antelación este problema, lo cual implicó contagios y algunos casos en personal de salud, pues a diferencia de la epidemia de SARS, se están tomando las medidas de control epidemiológico mucho más temprano y de un modo más extenso; y con la tremenda ventaja de ya conocer en tiempo récord cuál es el enemigo, lo cual ha permitido disponer de pruebas diagnósticas específicas, y empezar a trabajar incluso en el desarrollo de vacunas. . En China, en específico en la provincia de Hubei, hay ciudades militarizadas, vías de comunicaciones sin uso, desinfección de trenes, autobuses y taxis, controles sanitarios en autopistas y calles, uso masivo de tapabocas, triajes portátiles fuera de los centros hospitalarios para evaluar casos sospechosos y evitar contagios accidentales a otras personas, la construcción de un centro hospitalario especializado de campaña para manejo centralizado de los casos con más de 1000 camas, la vacunación contra influenza para disminuir casos de otros procesos respiratorios; y el trabajo en conjunto con las autoridades de la OMS. . Todos luchando contra un virus que luce más poderoso que GODZILLA; pero que al igual que el SARS y MERS se logrará controlar con estas medidas cuyo mayor impacto se alcanzarán a mediano plazo, ya que todavía debe haber muchas personas en fase de incubación que no han manifestado síntomas, y que potencialmente pudieran contagiar a otros si no son identificados oportunamente. . #coronavirus #ncov #ncov2019 #sars #mers #murcielagos #serpientes #epidemia #brote #infectologia #infecciones #virus #china #wuhan #hubei #beijing #godzilla
2231576597316460262; 3; False; 1580244682; “the 4 L’s of life” #poems #poetry #poemsby dae #2020living #atticuspoetryisapoemstealer #coronavirus
2231576193026448046; 4; False; 1580244682; Поступила информация,то что источник вируса летучии мыши,змеи едят летучих мышей,лазают по деревьям,гнездятся там! Эти шокирующие кадры! Как вы думаете фэйк ? #коронавирус2020 #вирус #coronavirus #китай #ухань #китайновости #коронавирус #короновирус #вирус
2231576396827294902; 3; False; 1580244679; Sry..
2231576527974646087; 1; False; 1580244674; O marketing digital também oferece diversas possibilidades relacionadas ao empreendedorismo. Ou seja, depois de investir nos cursos de formação, você pode abrir uma agência digital de pequeno ou médio porte e oferecer o gerenciamento de campanhas no Google AdWords ou no Facebook entre outra redes sociais para empresas, lojas, escritórios, restaurantes e clínicas da sua região. . :warning::backhand_index_pointing_right_medium-dark_skin_tone:É gratuito iniciar a atuar no mercado, mas o ideal é investir na sua formação a partir de cursos de marketing digital. . :backhand_index_pointing_right_medium-dark_skin_tone:Em geral, os cursos têm duração de uma semana e a maioria são sempre em videoaulas. Ou seja, são cursos rápidos e com uma dinâmica para você sair pronto para atuar no mercado.:winking_face: . Se você quer começar a gerar sua própria renda pela internet, não deixe para amanhã, comece hoje!! 2020 está ainda no dia "57 de janeiro":face_with_tears_of_joy:, essa é a melhor hora para se Iniciar. . Pesquise, estude, coloque em prática suas ideias. Você Não sabe o quão gratificante é poder trabalhar de qualquer lugar do mundo. :globe_showing_Europe-Africa: . :cross_mark::backhand_index_pointing_right_medium-dark_skin_tone:Se você quer aprender mais sobre o marketing digital, me chame no direct! :mobile_phone_with_arrow::winking_face: . . . :no_entry:Baixe meu Livro :no_entry::left_arrow: Link na Biografia da página @fome_desucesso . . Siga-me @fome_desucesso . . Recomendo: @weriquesguga @luannasouza_ @_beatriz.mkt @bernardocipriani @brenomarchesini
2231576494379344651; 3; False; 1580244670; - Sígueme y te sigo :crown: . . . @maluma #maluma #malumaniatica #malumababy #tour #malumatour #kimberly #rosalia #arianagrande #bts #army #badbunny #keniaos #jbalvin #coronavirus #foto #followforfollowback #instagood #inslike #instlove #likeforfollow #follower #instamusic #musicallyapp #maluma #brunomars #acapulcoshore #badabun #carteldesanta #maquillaje #lacasadepapelnetflix
2231576471594337505; 0; False; 1580244667; Year 2020! U must be some type of a GLITCH! Did you use all the cheat codes all at once? Stay safe everyone! #coronavirus #earthquakes #floods #forestfires #volcanoeruptions #etc.
2231576311206186898; 6; False; 1580244665; Dá para ter pena de um povo assim? Da contaminação de outros inocentes sim #Wuhan #coronavirus
2231576450723640270; 1; False; 1580244664; **IMPORTANT** #coronavirusoutbreak #coronaviruschina #coronavirus #china #chinesenewyear #chinesenewyear2020 #wuhanchina #wuhancoronavirus #wuhanpneumonia #wuhan #medical #doctors #nurselife #help #chernobyl #coronavirusoutbreak
2231576446120751648; 2; False; 1580244664; No Chinese food for a while Follow me @negroketchup #stolenmemes #memes #corona #coronavirus #stupid #jokes #dontsueme #ps4 #outside #insideIeatbread #tina
2231576088268705588; 0; False; 1580244664; :syringe: @LowChillZone :microbe: _______________________ | Laugh | Like | Share | . . . . . . . . _____________________ #lowchillzone #lmao #memes #dank #funnymemes #putitinreverse #grammyweekend #420 #bts #clivedavis #worldstar #thisforrachel #gta6 #schoolfights #explorepage #coronavirus #rocnationbrunch #meekmill #roddyricch #nickiminaj #antisocal #adrenalinejunkie
2231576162063544342; 3; False; 1580244662; And they don’t wanna get sick #coronavirus damn fucking people
2231576423294139980; 0; False; 1580244661; Coronavirus Standard recommendations to prevent infection spread include: :man_health_worker:Regular hand washing, :hand_with_fingers_splayed::soap: :man_health_worker:Covering mouth and nose when coughing and sneezing. :man_health_worker:Thoroughly cooking meat and eggs. :man_health_worker:Avoid close contact with anyone showing symptoms of respiratory illness such as coughing and sneezing :sneezing_face:. Coronaviruses (CoV) are a large family of viruses that cause illness ranging from the common cold to more severe diseases such as Middle East Respiratory Syndrome (MERS-CoV) and Severe Acute Respiratory Syndrome (SARS-CoV). A novel coronavirus (nCoV) is a new strain that has not been previously identified in humans. Coronaviruses are zoonotic, meaning they are transmitted between animals and people. Detailed investigations found that SARS-CoV was transmitted from civet cats to humans and MERS-CoV from dromedary camels to humans. Several known coronaviruses are circulating in animals that have not yet infected humans. Common signs of infection include: respiratory symptoms, fever, cough, shortness of breath and breathing difficulties. In more severe cases, infection can cause pneumonia, severe acute respiratory syndrome, kidney failure and even death. Stay safe and SHARE! #coronavirus #wuhanvirus #TheDrA #thedra #doctor
2231575326433967633; 3; False; 1580244661; Wuhan da neler oluyor? #turkey #türkiye #corona #korona #virüs #coronavirüs #sondakika #istanbul #bursa #izmir #ankara #hasta #hastalık #virus #coronavirus #haber #haberler #sondakikahaberler #çin #china #wuhan #güncel #güncelhaber #güncelhaberler #coronaviruses #coronaviruese #new #news #sondakikahaberleri
2231576396701191724; 21; False; 1580244658; Ok!!! I’m on the news. :rolling_on_the_floor_laughing::sneezing_face: I wore it because I didn’t want to spread my germs not to protect myself from coronavirus. :face_with_tears_of_joy: You should see me as a roll model who is responsible for society. LOL :face_with_medical_mask: . . #จิกกล้อง เหมือนรู้ว่าโดนแอบถ่าย ดีที่ใส่หน้ากาก ไม่งั้นเจอความหัวฟูแน่ กำลังยกโบบ้าถ่ายผู้เลย :face_with_tears_of_joy::face_with_tears_of_joy: โอ๊ยฮา แซวได้ แต่อย่าแรง อายเด้อ . #coronavirus #losangeles #fox5news #ca #ca #lax #nrt #airport #usa #mask #disease #virus #novelcoronavirus #epicpicture #epidemic #news
2231576321220851569; 0; False; 1580244649; THIS IS NOT EPIC!! #dankmemes #offensivememes #funnymeme #edgymemes #memelord #memepage #memestagram #instameme #memeaccount #memes #dailymemes #funnymemes #dankmemesdaily #spicymemes #meme #darkmemes #memesdaily #corona #coronavirus
2231576236203137567; 27; False; 1580244639; "daha kötü ne olabilir?" dedikçe daha kötüsü olmaya başladı. ______ #avustralya #coronavirus #elazığ #kobebryant #küba #jamaica
2231576231069159922; 0; False; 1580244638; #BizFlashNews #CoronaVirus
2231576203981193599; 0; False; 1580244635; Ben denedim tuzu biraz az olmuş . . . . . . . . . . . . #corona #coronavirus #çin #çinvirüsü #coronatedavisi #coronaviruses
2231575814584501455; 0; False; 1580244633; China #funnyvideos #funny #memes #meme #coronavirus #corona #china #pen #dankmemes #fortnite #fortnitememes
2231576189418486215; 0; False; 1580244633; **IMPORTANT** #coronavirusoutbreak #coronaviruschina #coronavirus #china #chinesenewyear #chinesenewyear2020 #wuhanchina #wuhancoronavirus #wuhanpneumonia #wuhan #medical #doctors #nurselife #help #chernobyl #coronavirusoutbreak
2231575635420241065; 0; False; 1580244632; вирускитай#коронавирус#коронавирускитай#симптомыкоронавируса#эпидемиякитай#вводвойсккитай#блокировкагородов#эпидемиякоронавирусакитай#коронавирусшанхай#коронавирусухань#коронавирус2020#вирус2020китай#coronavirus#viruschina#coronaviruschina#coronavirus2020#viruschina#нетуедывкитае#сдаютнервыиззавируса#едынетувухани#пустойгородвирускитай#стройкабольницыухань#вкитаенельзябезмасок
2231576167400824709; 1; False; 1580244631; :hotel::shinto_shrine:Çin Korona virüsüyle mücadele için sıfırdan hastane binası yaptılar hemde 48 saatte yani 2 günde koskoca hastane yaptılar şaka değil. :stop_sign:2 günde kompleks binaların oluşturduğu bir hastane nasıl yapılır merak ediyorsanız iyice okuyun detaylar için sağa kaydırın.:mobile_phone_with_arrow: :rolled-up_newspaper::newspaper:Kaynak:https://www.dailymail.co.uk/news/article-7939075/amp/Chinas-coronavirus-hospital-OPENS-today.html?__twitter_impression=true #wuhan #chine #çin #coronavirus #korona #virüs #hastalık #salgın #hastane #bina #inşaat #mimar #inşaatmühendisliği #saglıklıbeslenme #saglikliyasam #sağlıkbakanlığı #sondakika #deprem #haber #ilginç #beğen #paylaş #ff #takip
2231576158691101060; 1; False; 1580244630; Cancel 2020. #coronavirus #WW3 #australiafires2020 #Kobebyantpassingaway #january2020 #unlucky2020
2231576107604483086; 1; False; 1580244624; He thinks she is Chinese :face_with_tears_of_joy: #coronavirus #coronavirusmemes
2231576107287372386; 0; False; 1580244624; HABERLER İÇİN TAKİP EDİN :backhand_index_pointing_right: @darkvebhaber #darkvebhaber #turkey:Turkey: #turkiye #elazighersey #haber #deprem #trump #abd #sondakika #haberler #coronavirus #corona #virus
2231575951123495031; 1; False; 1580244605; :police_car_light: O Ministério da Saúde confirmou hoje (28) o primeiro caso suspeito de coronavírus no país e elevou o nível de atenção para alerta de perigo iminente para a presença do vírus no país. De acordo com o ministro da Saúde, Luiz Henrique Mandetta, uma estudante de 22 anos que esteve na China está internada, em Belo Horizonte, em observação. Mais informações: www.PortalPolitizei.com.br #Saúde #CoronaVirus #Brasil #MindaSaude
2231575936661690313; 0; False; 1580244603; Swipe left for nutrients, remedies and lifestyle choices in order to support your immune system and prevent viral infections. Write your favorite immune remedy in the comments! DM me if you have questions on dosages. #viralinfection #coronavirus #vancouver #immunesupport #immunebooster #virus
2231575745822517006; 0; False; 1580244596; #pray #prayer #nature #indonesia #sydney #carlinhosmaia #bbb20 #anitta #bts #justinbieber #newyork #prayforrevival #prayforhealing #hope #Jesus #life #viruscorona #love #помощь #coronavirus #коронавирус #вирус #virus #china #china:China: #ухань #китай #bbc #news #новости
2231573228877660192; 1; False; 1580244594; @drpeterliu alerta sobre o #coronavirus e dá informações aos brasileiros como se precaver, prevenir do contágio
2231575835453040178; 0; False; 1580244591; #Breakingnews :face_screaming_in_fear::face_screaming_in_fear: DC Department of Health officials announced Tuesday that two people are currently under investigation for novel coronavirus infection in the District. Via @fox5dc #Nexxlvlconvo #coronavirus #news #dmv
2231575731920561751; 1; False; 1580244591; **IMPORTANT** #coronavirusoutbreak #coronaviruschina #coronavirus #china #chinesenewyear #chinesenewyear2020 #wuhanchina #wuhancoronavirus #wuhanpneumonia #wuhan #medical #doctors #nurselife #help #chernobyl
2231575689432527471; 0; False; 1580244578; Just a Music Producer hit the like Button !!! @dennis_d9402 #100likeschallenge #coronavirus #coronavirusmemes #likeforlikes #stingertransition #transitionstinger #intro #youtube #keyboard #guitar #sound #nicebro #givehim #applause #potd #votd #viralvideo
2231575541484772242; 0; False; 1580244577; Китай. Ухань. Очередь в больницу. #коронавирус #coronavirus
2231575711117195127; 1; False; 1580244576; Ok the earthquake is over, back to the last potential disaster. #coronavirus s #corona #earthquake #jamaicanhistory #jamaica #jamaicansbelike #kartel #vybzkartel #jamaicaearthquake
2231575694407937327; 0; False; 1580244574; #BizFlashNews #CoronaVirus
2231575671054660406; 0; False; 1580244572; #dankmemes #darkmemes #memes #coronavirus
2231575431358635278; 0; False; 1580244567; Subsecretario de Salud afirma que el #coronavirus llegará a México. Prepárate con mirespirador.com
2231575621912674543; 0; False; 1580244566; *kung flu intensifies* ~CM #coronavirus #spiderman #spidermanmemes #marvelmemes
2231574768239513050; 1; False; 1580244564; Ｓｙｎｃｈｒｏｍｙｓｔｉｃｉｓｍ . . . #wuhanchan #coronachan #coronavirus #wuhan #wuhancoronavirus #novelcoronavirus #wuhanchina #pol #4chan #ebolachan #nurgle #goodluck #China #winnietheflu #wuhanquarantine #wuhanflu #shtf #MAGA #anime #waifu #corona #makeanimegreatagain #batsoup #synchronicity #synchromysticism #Africa #mememagic #mememagicisreal #koikatsu
2231575607620477853; 0; False; 1580244564; #coronavirus #unitedkingdom
2231575602979188432; 0; False; 1580244563; For all who have been shocked by the sudden passing of @kobebryant his beautiful daughter #gigibryant #mambacita, and the 7 others who perished along with them---TAKE NOTE... IT DID NOT MATTER HOW MUCH #MONEY #FAME /#RACE/RELIGION/#AGE/#SEX ANY OF THE VICTIMS HAD OR WERE... NOR DID IT MATTER THE SAME FOR ALL OF THE FANS OF ALL WALKS AROUND THE WORLD-WHO ALL FELT THE SAME SADNESS UPON HEARING THE NEWS OF THIS HORRIBLE TRADGEDY.... I WOULD HOPE THAT THIS MAY BE A WAKE UP CALL TO EVERYONE TO START TO REMEMBER WHAT IS REALLY IMPORTANT IN LIFE... AND HOW WE ARE ONE IN MORE WAYS THAN WE BELIEVE... THIS I PRAY IN A TIME WHEN #HATE AND #INTOLERANCE HAS BECOME A PANDEMIC MORE DANGEROUS THAN THE #CORONAVIRUS IS.... MY CONDOLENCES TO ALL OF THE LOVED ONES OF THE VICTIMS... MAY THE VICTIMS REST IN POWER... @vanessabryant @theellenshow @jimmykimmel @kingjames @lakers #weareallone #youcanttakeitwithyouwhenyougo #loveisthelegacy
2231574853071412825; 0; False; 1580244557; Coronavirus is spreading rapidly with confirmed cases in 16 countries. Here's what we know so far. Video courtesy of@hashem.alghaili - #coronavirus #coronavirusoutbreak #coronavirusmemes #2019ncov #corona #virus #viruses #epidemic #contagion #pathogen #healthnews #healthtips #wuhan #wuhanchina #wuhanvirus #wuhancoronavirus #china #
2231574587345677533; 3; False; 1580244557; Строительство больницы продолжается полным ходом . День 4 , как думаете через сколько больница начнёт работать ? #коронавирус #вирус #coronavirus #virus #новости #китай #россия #больница
2231575527073111691; 0; False; 1580244554; Saat 23:49 28 Ocak Salı 2020 . . . . #corona #coronavirus #coronavirüsü #coronavirüs #coronavírus #coronavirusmemes #coronavirusoutbreak
2231575490339008683; 0; False; 1580244550; #coronavirus #virus #pineapple #china #news #pictures #drawing #digital #plague
2231575462471880276; 3; False; 1580244547; #louijover #jover #saatchiart #redbubble #society6 #environment #environmentalist #earth #fire #floods #wars #trump #scomomustgo #world #globalvillage #life #shit #coronavirus #joverart #globalwarming #printsavailable #collageart ............Limited Edition gloss poster size, signed and numbered prints for sale email for information , 25 only available louijoverproductions@gmail.com
2231574434077229327; 2; False; 1580244424; With the spread of the coronavirus, it is important to remember everyday habits to help prevent the spread of any respiratory virus. The CDC recommends: *Washing hands often with soap and water or using an alcohol-based hand sanitizer *Avoiding touching your eyes, nose, and mouth with unwashed hands *Avoiding close contact with people who are sick *Staying home when you are sick *Covering your cough or sneeze with a tissue, then throwing the tissue in the trash *Cleaning and disinfecting frequently touched objects and surfaces We carry hand sanitizers, disinfecting wipes, tissues and gloves for your convenience. Get a FREE delivery of these items and stop the spread of respiratory illness at your job or in your community!
2231573115633908854; 18; False; 1580244330; ICH HAB CORONAVIRUS??? :anxious_face_with_sweat: Im video erfährt ihr wie ihr jeden Instagramer wieder heilen könnt.. #likegeil #coronavirus #fake #geldmacherei
2231570445899768488; 1; False; 1580244300; :sneezing_face::face_with_medical_mask: Wash hands often, wear masks, stay healthy! Show your K-POP spirit while protecting yourself from the :police_car_light:coronavirus:police_car_light:
2231570829467733210; 1; False; 1580244213; #coronavirus #coronavirusoutbreak #koronavirus #koronavirüs #coronavírus #coronaviruschina #outbreak #virus #wirus #chinesevirus #çinvirüsü #wuhanvirus #wuhanvirusoutbreak #wuhancoronavirus #vuhan #salgın #salgin #virüs #china:China: #hastalik #hastalık #grip #zatürre #saglikbakanligi #çinden #çinhalkcumhuriyeti #cinhalkcumhuriyeti #korona #vihan #virüsler
2231539764724455301; 0; False; 1580240291; #coronavirus #thatsit #karma :palms_up_together_medium-light_skin_tone: ⠀⠀⠀⠀⠀ ⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀ ⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀ ⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀ ⠀⠀ ⠀⠀ #instagood #like4like #photooftheday #happy #tbt #instadaily #bestoftheday #repost #igers #sun #ootd #instapic #lifestyle #blessed :palms_up_together_medium-light_skin_tone: #beauty #baby #motivation #photography #snapchat:ghost: #sun #music :headphone: #selfie #summer #sky #likeforlike #kizlar #istanbullove #iphonesia
2230545814583807985; 1; False; 1580121803; Die Klausurphase sollte man hier auch noch erwähnen:grinning_face_with_sweat: . . . . #2020 #spongebob #spongebobmemes #politik #politikmemes #sozialismus #australien #corona #coronamemes #fdp #cdu #afd #spd #jusos #grüne #klimapolitik #ww3 #iran #humor #satire #ironie #deutschememes #coronavirus #feuer
2231575478408319740; 0; False; 1580244549; Better sanitize often in these viral times! #fluseason #coronavirus #officehours
2231575462697056305; 0; False; 1580244547; Из-за вспышки коронавируса в Китае миллионы людей в городе Ухань оказались в изоляции - транспортное сообщение с городом было закрыто из-за распространения заболевания:warning: ⠀ И тем не менее, люди пытаются поднять друг другу настроение:hushed_face: ⠀ Вспышка смертельного вируса наступила, когда Китай отмечал одну из самых важных дат в своем календаре - Лунный Новый год:collision: Для Китая этот праздник так же важен, как Новый год для россиян. ⠀ Празднования в стране идут в течение двух недель. Для многих это единственный шанс в году встретиться со своей семьей и обменяться подарками:pensive_face: ⠀ #коронавирус #короновирус #coronavirus #ухань #вспышка #китай #china #китай2020 #изоляция #заболевание #распространение #вирус #смертельныйвирус #новыйгод
2231570947168966972; 0; False; 1580244546; #GAMEPLAY ¿Y ustedes ya se prepararon para el apocalipsis zombie chino?:skull_and_crossbones::skull::microbe: :fire::fire:Ten la oportunidad de disfrutar de tus juegos favoritos sin problemas! :fire::fire: Contáctanos y arma la PC de tus sueños !:smiling_face_with_sunglasses: #zombies #gamer #PcMasterRaces #CoronaVirus #Nvidia #GPU #fullpc_col
2231575438917224677; 3; False; 1580244544; #Repost @pediatra_vegano ・・・ Os coronavírus (CoV) compõem uma família de vírus que receberam esse nome devido às espículas na sua superfície, que lembram uma coroa. Podem causar desde um resfriado comum até síndromes respiratórias graves. Porém, o vírus atual, que teve como fonte um mercado de animais vivos em Wuhan (China), é um nova variante do coronavírus, denominada 2019-nCoV, até então não identificada em humanos. Seguem algumas informações importantes: Quais são os sintomas de uma pessoa infectada por um coronavírus? Pode variar desde casos assintomáticos, casos de infecções de vias aéreas superiores semelhante ao resfriado, até casos graves com pneumonia e insuficiência respiratória aguda, com dificuldade respiratória. Crianças de pouca idade, idosos e pacientes com baixa imunidade podem apresentar manifestações mais graves. Como é feita a confirmação do diagnóstico do novo coronavírus? Exames laboratoriais realizados por biologia molecular identificam o material genético do vírus em secreções respiratórias. Existe um tratamento para o novo coronavírus? Não há um medicamento específico. E também não existe uma vacina, já que a doença é nova. A vacina da gripe protege somente contra o vírus influenza. Como reduzir o risco de infecção pelo novo coronavírus? Lavar frequentemente as mãos, especialmente após contato direto com pessoas doentes ou com o meio ambiente e antes de se alimentar; Usar lenço descartável para higiene nasal; Cobrir nariz e boca ao espirrar ou tossir; Evitar tocar nas mucosas dos olhos; Higienizar as mãos após tossir ou espirrar; Não compartilhar objetos de uso pessoal, como talheres, pratos, copos ou garrafas; Manter os ambientes bem ventilados. Temos casos do novo coronavírus no Brasil? Até o presente momento, não há casos suspeitos ou confirmados no país. Dr. Bruno Shoiti Maehara CRM 139904 fontes: Organização Mundial da Saúde (OMS) / Centro de Controle e Prevenção de Doenças (CDC). #coronavirus #pediatria #epidemia #infectologia #medicina
2231575429227822576; 0; False; 1580244543; Great news for Aussie scientists! Our exclusive story on how they recreated the coronavirus which will speed up testing and a search for a vaccine. It’s not often you see scientists bursting with excitement but they were when @abcnews_au visited. Link to the story in bio. @pennytimms @lisamillarabc @mjrowland68 With @pennytimms . . . . . . . #health #science #journalism #virus #coronavirus #celebrate #Australianjournalist #breakthrough
2231575427632560170; 0; False; 1580244543; Meme nv50% #corona #memesespañol #66 #memes #coronavirus #34 #otakumemes #rezeromemes #rem #momasos #tet #teta #nadal #japon #españa #sdlg #depresiones #chiva #chivas
2231575415779539616; 2; False; 1580244541; Infatti ha ragione. Basta che usate il cervello in teoria ci si arriva #coronavirus
2231575397803212173; 0; False; 1580244539; Tune in at 4pm ET to today’s IT’S ALL ABOUT FOOD podcast: The Vegan Artist's Way: With Hartglass and De Mattei, Stay Healthy During Audition Season...or any season. Featured guest: @cookingwithgad On @prnfm #vegan #vegansofig #vegansofinstagram #actors #auditions #auditionseason #nyc #health #flu #colds #coronavirus #plantbased #vaccines #netipot #humidifier #water #vitamins #supplements #food
2231575390814949527; 0; False; 1580244538; Ste yitler - - - - - @zecta_momos - - - Ya sabes,sigueme para mas contenido original y dale like para saber si les gusta :3 - - - - - - - - Ignorar :v: #recién_horneado #re100horneado #instalike #sigueme #dale_like #dale_me_gusta #followforspam #followforfollow #followme #horneado #hashtag #likeforlike #like4like #comparte #momo #momos_gratis #momos #memes #instalike #tags_for_likes #tagsforlikes #hailgrasa #coronavirus #friends #followers #picsart #hashtag #momos4k #memesespañol #legionholk #instagram #china
2231574972317736103; 0; False; 1580244528; #Repost @medcareae (@get_repost) ・・・ Watch this video :backhand_index_pointing_down: to know more about coronavirus symptoms and its prevention. 𝗦𝗵𝗮𝗿𝗲 𝘁𝗵𝗶𝘀 𝘃𝗶𝗱𝗲𝗼 𝗮𝗻𝗱 𝘀𝗽𝗿𝗲𝗮𝗱 𝗮𝘄𝗮𝗿𝗲𝗻𝗲𝘀𝘀! Book your appointment in less than a minute by connecting with Mira & Leo at www.medcare.ae .#coronavirus #2019_nCov #coronavirusoutbreak #coronavirusoutbreak2020
2231573402120249855; 0; False; 1580244528; I thought he lookin some @dangershewrote pics but he was in that Johnny Sins shit:face_with_tears_of_joy::face_with_tears_of_joy::face_with_tears_of_joy: • • • • • • #danger #johnnysins #coronavirus #spanishmemes #spanish #meme#memeschistosos #funnymemes#void #edgy#pornhubmeme#pornhub#weedporn #camera #cameraporn
2231565905675301344; 11; False; 1580244526; This too will be ignored, because they’re just human beings, who care about that?as long as it’s not animals locked up in their knees, then it’s ok! :man_tipping_hand: China’s one of many special torturing techniques for Uyghur ethnic minorities like this ,did not get enough or maybe any attention by the ones who could make a difference, but the coronavirus got so much attention that the news media is flooded by the updates. People dying suddenly without any warning, with the disease spreading inside their body so fast, instantly killing them. May god help us find the cure for this illness. Why is an illness getting so much attention and coverage? Because it’s risking people’s lives that are here in Canada and America and the rest of the world. Why doesn’t the mass concentration camps of China that are being held, raped, killed, tortured and their organs being harvested , doesn’t get the same attention? Because it’s not affecting anyone else over here, Or anywhere else due to the sickness of mass hypocrisy inside us. We become human when the troubles of others effect us physically, but if it doesn’t affect us physically, emotional affects doesn’t stand a chance for us to act and feel empathetic towards them. We become worse than animals and find it irrelevant of the sufferings and screams of innocent lives. #torture #china #chinatown #china:China: #chinese #chinesetorture #uyghur #uyghurmuslims #uyghurs #uighur #uighurmuslims #ethniccleansing #concentrationcamps #lockedup #muslims #irrelevant #whocares #blindeye #humanrights #humanrightswatch #humanrightscampaign #humanrightsactivist #humanrightsviolations #unitednations #dosomething #coronavirus #godwillprovide #godisgreat #godwillrise #inshallah:red_heart:.
2231575284978016326; 0; False; 1580244526; Just off down to my local Chinese restaurant to pick up my order! #coronavirus
2231575280573257954; 0; False; 1580244525; Onde eu assino?! . . . . . . #coronavirus #carnaval2020 #foliões #blocodecarnaval #perigo #virusletal #todocuidadoépouco #saudeebemestar #atenção #prudencia
2231575273827030138; 0; True; 1580244524; Almanya'nın Bavyera eyaletinde 1 kişinin ölümcül yeni tip koronavirüse yakalandığının bildirilmesinin ardından eyalette 3 yeni vakanın daha tespit edildiği bildirildi. Bavyera Sağlık Bakanlığı, dört Alman hastanın da aynı şirkette çalıştığını ve #koronavirüsü Çin'den gelen bir çalışandan kaptıklarını bildirdi. #coronavirus #corona #china #germany:Germany: #germany #wuhan #turkey #abd
2231575254066082864; 0; False; 1580244522; #coronavirus #prevencao #saude
2231575232605533727; 0; False; 1580244519; USDJPY Daily & Weekly. . . Patience is the new game. . . ************************************* There is no Gain without Pain ! . . #forex #forever #financialfreedom #2020 #financialmarkets #stockmarket #motivation #discipline #consistency #gbpusd #millions #russia #trader #perserverance #growth #nyc #bitcoin #btc #trade #gold #money #gbpaud #eurusd #tesla #netflix #trading #usdjpy #coronavirus #corona #ronaldo
2231575226685011141; 0; False; 1580244519; Ciclo do Coronavirus (dados OMS). #coronavirus #formasdecontagio #contagiocoronavirus #oms #china:China: #perigodevida #informese
2231575210854016203; 0; False; 1580244517; With the Coronavirus outbreak, we want to ensure that everyone remains healthy. The coronavirus is a respiratory illness that was first detected in China and continues to expand. As of now, the U.S has 5 confirmed cases of this virus and is rapidly expanding. Please know the signs and symptoms and seek medical help if you start to notice them. #coronavirus #coronavirusoutbreak #respiratory #illness #medical #flu #nursing #certifiednursingassistant #healthylifestyle #staypositive #RioRising #virus #treatment
2231575190957858379; 158; False; 1580244514; :warning:PLEASE SHARE THIS:warning: Please share this URGENT post about the coronavirus epidemic with your followers as the origin of the virus has been traced to the zone of the Wuhan market where live wild animals like snakes, rats, bats and monkeys were traded before China instituted a temporary ban yesterday. But a temporary ban is NOT enough, WE MUST use our social media platforms to spread awareness and BAN WILD ANIMAL TRADING WORLDWIDE as this is EXACTLY what caused the SARS virus that killed nearly 800 people in 2003! SARS was 17 years ago and yet these markets are doing the exact same thing, selling live wild animals in unhygienic conditions that create diseases with devastating consequences for the entire human race! This new virus, which has no vaccine, has killed 106 people with more than 4500 confirmed cases in more than a dozen countries, numbers which have increased nearly 60% SINCE YESTERDAY and 60 million more people are on lockdown to prevent further spreading. - :police_car_light:PLEASE NOTE: “Experts say symptoms can be very difficult to detect and that many of those who died from the disease had underlying health conditions that involved weakened immune systems, like hypertension, diabetes or cardiovascular disease.” (@time ) - Please pray for the world and share this URGENT post with your followers and tag people, celebrities, influencers and news media that need to see this and let’s work together to PERMANENTLY ban the trading of wild animals that create these deadly viruses! Via @karmagawa #coronavirus #endanimalcruelty #coronavirusoutbreak #disease #diseaseprevention #epidemic #virus
2231575081830413471; 0; False; 1580244510; #coronavirus #wuhan
2231574149837405344; 0; False; 1580244507; #cuba ve #jamaica da 7.7 şiddetinde deprem olduğu, görüntüler olay yerinden geldiği iddaa edildi. - Daha fazlası için @dijitalmedyahaber . #bilim #bilimsel #inovasyon #virus #coronavirus #teknoloji #digitalartwork #digitalart #sağlık #takip #takipet . #çin #wuhan . #deprem . #elazığ #earthquake #göçük #bina . #cuba #cübadeprem #cubaearthquake #jamaica .
2231575056698108673; 0; False; 1580244498; Interested? HIT ME DM ; ) #coronavirus #clothing #skullclothing
2231575043235093889; 4; False; 1580244497; Super pleased my editor at @fodorstravel reached out to ask me to write this piece on the new #coronavirus. Here’s what you need to know, as of last night anyway — things change rapidly in the virus world! https://www.fodors.com/news/news/should-you-change-your-travel-plans-because-of-the-coronavirus
2231574957695873285; 0; False; 1580244487; Türkler Kral Ya kdkdkdkd . . @coronasalgini . . #takipcikazan #takipçikazan #coronavirus #corona
2231574924501534680; 6; False; 1580244485; #ElPaísHOY El director del Servicio Nacional de Salud (#SNS), #ChanelRosaChupany, informó hoy que se tiene contemplado habilitar de ocho a 10 hospitales con salas de #aislamiento ante el posible contagio del #coronavirus en el país. (Busque la noticia completa en el link de la bio) #PeriódicoHOY
2231574911097615423; 14; False; 1580244481; Hay siete casos sospechosos de #coronavirus en Sudamérica. Ecuador, Perú, Colombia y Brasil trabajan para confirmar o no la presencia de la neunomía china en la región.⁣ ⁣ En el caso de Ecuador, el paciente, de nacionalidad china, está asilado en el hospital Eugenio Espejo de Quito. Sus muestras fueron enviadas al Centro para el Control y Prevención de Enfermedades de Atlanta, Estados Unidos.
2231574571599913535; 1; False; 1580244475; :face_with_tears_of_joy::face_with_tears_of_joy::face_with_tears_of_joy: . . #coronavirus تَاَبَعَ بَيَجَنَاَ نَنَشَرَ كَلَ شَيَ :Iraq::victory_hand::red_heart: ƒσℓℓσω мє : @king_shingal_official #The_United_Nations_saved_Iraq_from_CR_against_the_demonstrators #Hello_world #There_are_people_Making #Revolution_now_in_iraq ! #Show_your_support_for_the #right_of_Iraq_people_to #protest_peacefully #Save_the_Iraqi_people #HELP_Iraq #saveIraqipeople #king_shingal ‏ #٢٥_اكتوبر_ثورة_التغييرر #٢٥_اكتوبر_عراق_التغييرر ‏⁧#نازل_اخذ_حقي⁩ #مليونية_ثورة_اكتوبرر ‏⁧#العراق_يتعرض_لاباده_جماعيه⁩ ⁧#اوقفوا_قتل_شباب_العراق⁩ ⁧#اوقفوا_اطلاق_الرصاص⁩ #انقذو_كربلاء #انقذو_كربلاء_مجزرة_الان_انقذونا ‏‮ ‬‏‪#الاعتصام_الطلابي #الاعتصام_الطلابي_الموحد #العصيان_المدني_الشامل #العصيان_المدني #٢٥_اكتوبر_عراق_التغييرر ‏⁧#نازل_اخذ_حقي⁩ #مليونية_ثورة_اكتوبرر ‏ ⁧#اوقفوا_قتل_شباب_العراق⁩ #انقذو_كربلاء #مهلة_الناصرية #العراق #بغداد
2231574742771711545; 0; False; 1580244461; Dua to protect urself from coronavirus. #coronavirus
2231574676449072705; 0; False; 1580244453; @grandmamemes can confirm . . . #meme #memes #funny #dankmemes #dank #funnymemes #memesdaily #lol #4chan #cringe #tumblr #wtf #edgy #like4likes #followme #quotes #instagood #aesthetic #rofl #cancer #plague #coronavirus #corona #offensivememes #memepage #dailymemes #follow #solidmemes #hilarious #haha
2231574621690190850; 3; False; 1580244446; Issa joke
2231574587287029826; 0; False; 1580244442; Going to die within 2 weeks. #dankmemes #offensivememes #funnymeme #edgymemes #memelord #memepage #memestagram #instameme #memeaccount #memes #dailymemes #funnymemes #dankmemesdaily #spicymemes #meme #darkmemes #memesdaily #corona #coronavirus
2231574433282442421; 835; False; 1580244442; Residents in Wuhan, China are shouting encouragement and singing songs from their apartment windows to boost morale amidst the coronavirus quarantine. :speaker_medium_volume: Wuhan is the centre of the deadly outbreak, and all 11 million residents have been advised to stay at home. Click the link in the bio to find out more. :backhand_index_pointing_up: #china #coronavirus #wuhan #bbcnews
2231574458966150566; 0; False; 1580244427; :play_button: SANIDAD. :red_circle: Ya son 16 los países afectados por el coronavirus, de los cuales 2 son europeos: Francia, con cuatro casos registrados y Alemania con tres, el primero se detectó el 28 de enero en el sur de Baviera. #actualidad #news #sociedad #salud #sanidad #coronavirus #el_soplon #el_soplon_
2231574351038185804; 0; False; 1580244414; #coronavirus #meme #memes #lol #dank #lmao
2231574313652188870; 0; False; 1580244410; What we know so far #coronavirus #coronaviruschina #coronavirus2020 #coronavirusnews #coronavirusoutbreak #coronavirusawareness
2231574299390370786; 0; False; 1580244408; YO Y MI HUMILDE OPI NIon :smirking_face: #hacecalor #duerme #adormir #cortedepelo2020 #soyunareyna #ytutbmcariño #verano2020 #coronavirus #cervezasera #yonitomo
2231574284644331210; 0; False; 1580244406; Reason the Torah says wash yourself and your clothing after contact. . . #Repost @who ・・・ Here are some facts about the new #coronavirus (2019-nCoV) #MythBusting
2231574238297839057; 0; False; 1580244401; Just in case some of you thought this was just some right wing conspiracy bullshit. #coronavirus #pandemic #epidemic #yourebeingliedto #wakeup #prepare
2231574235294080109; 0; False; 1580244400; Wow just wow #coronavirus
2231574042003768393; 0; False; 1580244400; ‪#Argentina Ginés González, ministro de Salud en dice que están en alerta preventiva por el #coronavirus . No hay casos sospechosos hasta el momento. Reporte de @carlosi_suarez ‬
2231574200640208895; 0; False; 1580244396; Buena Semana #coronavirus
2231574187605441753; 1; False; 1580244395; #coronavirus #helpforotherswithcoronavirus
2231574149235823877; 0; False; 1580244390; Síguenos para mas contenido :blue_heart: - - - - #memesdaily #elgoth #meme #memesgraciosos #memesenespañol #memesespañol #memes:face_with_tears_of_joy: #memes #goth #siguemeytesigo #gothjaidefinichon #chileanmemes #jaidefinichongoth #china #coronavirus #gatitos #kakarot #dylantero #instagram #instamemes #dylanteromeme
2231574140886909563; 0; False; 1580244389; :megaphone::megaphone::megaphone:Como prevenir o novo Coronavírus?:megaphone::megaphone::megaphone: . . CUIDADOS BÁSICOS orientados pelo Ministério da Saúde reduzem o risco geral de contrair/transmitir infecções respiratórias em geral, como o novo CORONAVÍRUS. Evitar contato próximo com pessoas que sofrem de infecções respiratórias agudas; LAVAR AS MÃOS FREQUENTEMENTE, principalmente antes de se alimentar ou após contato direto com pessoas doentes ou com o meio ambiente; Utilizar lenço descartável para higiene nasal; Cobrir nariz e boca quando espirrar ou tossir; Evitar tocar mucosas de olhos, nariz e boca; Higienizar as mãos após tossir ou espirrar; Não compartilhar objetos de uso pessoal (talheres, pratos, copos ou garrafas); Manter os ambientes bem ventilados; Evitar contato próximo a pessoas que apresentem sinais ou sintomas da doença; Evitar contato próximo com animais selvagens e animais doentes em fazendas ou criações. Profissionais de saúde: utilizar medidas de precaução padrão, de contato e de gotículas (mascára cirúrgica, luvas, avental não estéril e óculos de proteção). . . . Fonte: Ministério da Saúde Para mais informações sobre o CORONAVÍRUS: http://www.saude.gov.br/saude-de-a-z/novocoronavirus . . . - Haya Fisioterapia . .(16)99453-7949 Rua Adolfo Cattani , 643 - São Carlos - SP . #prevencao #coronavirus #hayafisioterapia @minsaude
2231574133707995435; 0; False; 1580244388; Re100 horneado . . . #momos #memes #momos4k #sdlg #risa #coronavirus #momitos #momazos #memero #re100horneados #emprendimiento #caracajada
2231574091848424910; 0; False; 1580244383; #meme #memes #мемы #мемасы #humour #stereotypes #slavmemes #slavic #slavstyle #slavsunited #slavs #squattingslavsintracksuits #comrade #communism #communismmemes #sovietrussia #lifestyle #russian #russia #vladimirputin #владимирпутин #putin #путин #coronavirus #коронавирус
2231574075944392441; 0; False; 1580244381; Pay attention please :folded_hands: #coronavirus #virus #payattention #china #world
2231573468019889426; 0; False; 1580244374; #knowthequran #coronavirus #virus #china #canada #muslims #dua #staysafe #muslims #ottawa #toronto #newyork #lahore #beijing
2231572615754206265; 1; False; 1580244372; Família Brasileira infectada com coronavírus nas Filipinas. #coronavirus #coronavirusbrasil #brasil #brasilia #familia #mundo #youtube #instagram #instagramer #jornalismo #jornal #tvglobo #sbtesporterio #rjtv #reporter #viagem #carnaval #amigos #amigas #amizadeverdadeira @fatimabernardes #fatimabernardes
2231573918993852449; 0; False; 1580244363; #corona #virus #coronavirus
2231573682644188258; 0; False; 1580244353; Düğün'de Drop Kovalayan Alfa DAMAT :video_game::game_die::beaming_face_with_smiling_eyes: . . #corona #alfa #alfaromeo #pug #papatya #coronavirus #gündem #haber #dugun #gelin #atari #puglove #pubg #demir #hayatadair #play #studio #photooftheday #fotoğrafçılık #resim #sandalye #bebekler
2231573807894381778; 4; False; 1580244349; Como a aromaterapia pode nos ajudar com o vírus que vem trazendo questionamentos em todo o mundo? . Muito importante estar atento e se precaver, mas sem pânico! . Manter a nossa vibração alinhada a confiança de que tudo está bem! :slightly_smiling_face: . Se hidratar, se nutrir com alimentos e pensamentos positivos. . Saúde é prevenção! :police_car_light: . Então vamos falar de um óleo essencial perfeitamente adequado para esse momento e que toda a família pode usar: . O óleo essencial de Ravintsara :herb:(Cinnamomum camphora qt cineol). Indicado no caso de infecções que afetam a esfera respiratória, sua ação antiviral e seus efeitos estimulantes sobre o sistema imunológico são de fato poderosos e reconhecidos por todos os profissionais e seguidores da aromaterapia. . O óleo essencial de Ravintsara é altamente concentrado em álcoois e segundo os estudos feitos por vários cientistas as diferentes moléculas que encontramos no oléo essencial de Ravintsara (1,8 cineol, alfa-terpineol e monoterpeno) possuem propriedades como: Antiviral, antiifeccioso, antibiótico, imunoestimulador e antibacteriano. Seu espectro de ação é muito amplo e ele é muito eficaz e seguro para todas as idades. . Então respire ravintsara, e não pire!:herb: . . . . #virus #coronavirus #ravintsara #oleosessenciais #aromaterapia
2231573557643900954; 0; False; 1580244348; This is getting serious #coronavirus
2231573035664555255; 0; False; 1580244344; #erkältung #niessen #coronavirus #china #fett #comedyvideo #comedydeutschland #krankheit #musikvideo #musiker #tanz #tänzer #lustigevideos #witzigevideos #deutschesmeme #deutschememes #assitv #witz #witzig #witzigesvideo #witzigebilder #witzigesbild #lustig #lustigebilder #lustigesbild #klassikmemes #flachwitz #spruch #chatprank #schwarzerhumor
2231573733471581313; 0; False; 1580244341; ...maybe there is someone who wants to tell us something?.... #illuminati #newworldorder #11september #freemason #truth #illuminaticonfirmed #mkultra #conspiracy #illumination #illuminatis #agenda #flatearth #god #love #illuminatiam #illuminations #art #photography #trumpsimpson #illuminatiexposed #illuminatie #illuminatieye #illuminaticrew #predictions #coronavirus #illuminating #kobebryant #illuminatiglass #freemasonry #simpsonpredictions
2231573537052145231; 0; False; 1580244340; guess i'll just die???⁠ ⁠ (seen from @internet)⁠ ⁠ #humanbetter #funny #meme #lol #humor #comedy #instagood #cute #follow #instalike #wellness #humor #life #struggle #mentalhealth #wellness #selfcare #repost #tumblr #coronavirus #wuhanvirus #virus #influenza #health
2231573487893792274; 8; False; 1580244338; Killer flies! Killer car! Killer outfit! The Doctor and the Brigadier's leather glove supplier still eludes me :expressionless_face::gloves:
2231573301096771327; 1; False; 1580244333; El ministro de Relaciones Exteriores, Teodoro Ribera, confirmó que cinco chilenos que residen en Wuhan, #China, están en cuarentena debido al #coronavirus. “Existen nueve estudiantes universitarios chilenos que estudian en #Wuhan, República Popular China. De estos nueve estudiantes, cuatro no están hoy día en la ciudad de Wuhan; están fuera de ella, porque algunos están estudiando o haciendo pasantías en otros lugares de China o en otros países de alrededores”, informó Ribera. De esta manera, detalló que “hay cinco chilenos estudiantes, solteros, que están en Wuhan, y cuatro que residiendo en Wuhan hoy día no lo están“. “Lo que estamos haciendo es reforzar la capacidad de respuesta de la Cancillería para brindarles una mejor asistencia a estos estudiantes“, agregó el canciller.
2231573627077394878; 0; False; 1580244328; #Coronavirus From @alphacentauriii
2231573591895148639; 0; False; 1580244324; 𝐃𝐄𝐒𝐓𝐀𝐂𝐀𝐃𝐎 | :speaking_head::speaking_head: . El grupo suizo de banca privada Julius Bär calcula que el brote del coronavirus puede tener un impacto en el Producto Interior Bruto (PIB) de China de entre 0,5 y 2 puntos porcentuales, en función de cuánto se prolongue la crisis, ha avanzado hoy su directora de gestión de carteras para Iberia, Almudena Benedit, en un encuentro informativo. . Benedit ha precisado, no obstante, que en este momento es muy difícil cuantificar el impacto económico del coronavirus, entre otros motivos porque aún se desconoce si el Gobierno chino pondrá en marcha estímulos para paliar sus efectos y cuáles serán. . La responsable de Julius Bär ha destacado que, por los datos que se conocen, la virulencia de este brote es menor que la del SARS, otro brote de coronavirus que se detectó en noviembre de 2002 en Cantón (China). El impacto del SARS en el PIB chino se situó en torno a un punto porcentual. . #Destacado #Economía #Banca #Salud #Coronavirus #Cuarentena #PIB #Impacto #China #Brote #Virulencia #SARS #Vacunas #Paraguay #RevistaPLUSpy :memo:Lee más noticias en @RevistaPLUSpy – link en BIO :pushpin:
2231573596216772942; 3; False; 1580244324; Інтернет-користувачі помітили подібність між коронавірусом із Китаю та Resident Evil :woman_zombie::man_zombie::microbe: ⠀ Нагадаємо про страшні та реальні факти: у Китаї продовжує розповсюджуватися новий коронавірус. Від нього вже загинули понад сотня людей. Медики кидають усі доступні ресурси на боротьбу з новим захворюванням. ⠀ Обговорення цього страшного явища продовжуються по всьому світу. Деякі Інтернет-користувачі, досліджуючи дану проблему, наштовхнулися на різного роду факти для проведення аналогії між подіями в Китаї та сюжетом гри Resident Evil. ⠀ Справа в китайській біотехнічній корпорації, якій належить вірусологічна лабораторія в Ухані, де й зафіксували вперше коронавірус. Її логотип дуже нагадує символ #Umbrella Corporation із франшизи #ResidentEvil. Різняться тільки деякі кольори. ⠀ Також іншим «натяком» для користувачів стало те, що назва вірусу (Corona) є анаграмою слова raccoon (щоправда, без однієї букви «c»). Нагадаємо ж, що події гри Resident Evil відбуваються в місті Raccoon City. У всьому цьому дехто вже вбачає всесвітню змову, проте ми радимо не піддаватися паніці та зберігати спокій. ⠀ #gi_ігри #geek_informator #residentevil3 #RaccoonCity #coronavirus #virus #epidemiology #china
2231573588129092095; 0; False; 1580244323; If u get the coronavirus. Drink dettol. :face_with_tears_of_joy::face_with_tears_of_joy::face_with_tears_of_joy: #meme #dankmemes #coronavirus
2231573577895719956; 0; False; 1580244322; — :nazar_amulet: @pacorodriguez @IndicePolitico #AMLO #coronavirus #primerasplanas
2231573101119065886; 0; False; 1580244309; :down_arrow::down_arrow: #coronavirus #funny #memes #uk #banter
2231573441437652233; 1; False; 1580244306; Cada juego tiene su público... ¿no? #USA #CoD #CallofDuty #China #coronavirus #Fire #Firewatch #Australia #Plague
2231573439449646805; 0; False; 1580244306; #type1diabetes #t1d #t1dmom #diabetes #diabadass #2020 #earthquake #fire #volcano #coronavirus #zombie
2231573430651254632; 2; False; 1580244304; #china #medien #unrecht #welt#traurig #wut #kotze #warum #ekelhaft #coronavirus #schweigen #schlimmergehtimmer #menschenrechte #menschlichkeit #gewissen #:clapping_hands: #schaunichtweg #gutenacht #instagood #spruch #sprüchezumnachdenken #:woman_raising_hand_light_skin_tone: #dortmund#uiguren
2231573382968351370; 0; False; 1580244299; #film #pancarte #carton #dragon #lsd #alberthoffmann #hallucination #vol #defonce #voyage #street #bifle #grossecorne #francoishollande #comeback #presidentiel #2022 #apocalipse #coronavirus #hashtag #taistoietsuce #malbouf #vegan #steakdedragon #gilletjaune #gilet #rasoir #moussearaser #viril #testosterone
2231572920009079038; 10; False; 1580244297; #ebola#coronavirus#memes #funnymemes #funnyvideos
2231573126832051897; 0; False; 1580244286; #coronavirus #cina
2231573190113905471; 1; False; 1580244276; #Coronavirus
2231573175720048708; 0; False; 1580244274; When there is an international conference about the Corona Virus and all of a sudden the President of China starts Sneezing & Coughing #coronavirus
2231573152290684924; 0; False; 1580244271; #meme #coronavirus
2231571677748444157; 0; False; 1580244266; #residentevil #coronavirus #hongkong #china
2231573082053931404; 0; False; 1580244266; #Internacionales Ginebra (EFE).- El Gobierno chino ha aceptado que la Organización Mundial de la Salud (#OMS) envíe expertos internacionales lo antes posible para que colaboren en la lucha contra el #coronavirus, anunció este martes la entidad sanitaria. Su presidente, Tedros Adhanom Ghebreyesus, se reunió con el presidente chino, Xi Jinping, con quien llegó a la conclusión de la conveniencia de que especialistas de otros países puedan contribuir a entender mejor ese brote epidémico, del cual todavía muchos aspectos se desconocen. Xi y Tedros también debatieron cuestiones claves de su colaboración frente a esta emergencia sanitaria, como la necesidad de que China siga compartiendo información y material biológico con la OMS. Link en bio para más detalles #ElNacionalRD
2231573090037606586; 0; False; 1580244264; E-mail for E-mail for more information #coronavirus #corona #coronamasks #china #chinatravel
2231573047919713371; 0; False; 1580244259; #2020 #ww3 #wwiii #corona #coronavirus #china #iran #usa #trump #japan #australia #texas #washington #memes #dankmemes #trending #white #apple #memes #epic #lmao #haha #dankmemesdaily #dankmeme #funnymemes #follow #explorepage #instagood #instagram #1
2231572908995928211; 0; False; 1580244249; :face_with_tears_of_joy::face_with_tears_of_joy: #meme #dankmemes #coronavirus
2231572958823051686; 0; False; 1580244248; #coronavirus ya llegó y es un éxito
2231572939143541978; 0; False; 1580244246; Coronavirusu "Coronavirüsler (CoV), soğuk algınlığından Orta Doğu Solunum Sendromu (MERS-CoV) ve Şiddetli Akut Solunum Sendromu (SARS-CoV) gibi daha ciddi hastalıklara kadar hastalıklara neden olan büyük bir virüs ailesidir . Yeni bir koronavirüs (nCoV) , daha önce insanlarda tanımlanmamış yeni bir suştur . Koronavirüsler zoonotiktir, yani hayvanlar ve insanlar arasında bulaşırlar. Ayrıntılı araştırmalar SARS-CoV'nin misk kedilerinden insanlara ve MERS-CoV'un dromedary develerden insanlara bulaştığını buldu. Bilinen birkaç koronavirüs henüz insanları enfekte etmeyen hayvanlarda dolaşmaktadır. Enfeksiyon belirtileri arasında solunum semptomları, ateş, öksürük, nefes darlığı ve solunum güçlüğü bulunur. Daha ciddi vakalarda, enfeksiyon pnömoniye, ciddi akut solunum sendromuna, böbrek yetmezliğine ve hatta ölüme neden olabilir. Enfeksiyonun yayılmasını önlemek için standart öneriler arasında düzenli el yıkama, öksürme ve hapşırma sırasında ağız ve burnun kapatılması, et ve yumurtaların iyice pişirilmesi yer alır. Öksürme ve hapşırma gibi solunum yolu rahatsızlığı belirtileri gösteren kişilerle yakın temastan kaçının." -WHO @who @thd_genelmerkez @thd_ok #coronavirus #nurse #nursing #hemsire #hemsirelik #health #saglik
2231572924909197080; 0; False; 1580244244; :cyclone: @realdonaldtrump doing his part :cyclone: •⁣ Send this to a friend:cyclone: •⁣ •⁣ #meme #memes #ps4 #wshh #hood #coronavirus #funny #xbox #dankmemes #offensivememes #edgymemes #spicymemes #69 #memepage #gaming #dank #memesdaily #shitpost #dankmeme420 #hiphop #witcher #worldstar #grapejuiceboys #playstation #worldwar3 #sexy #corona #weed #reddit #420
2231572925077482012; 0; False; 1580244244; Yas let's go Follow @shacomain69 #meme #memepage #follow #promo #youtube #lol #meme #nhentai #dm #pokemon #pokemonmeme #cod #fortnite #leagueoflegends #honghong #coronavirus
2231572877966340556; 0; False; 1580244239; . . . . . . . #meme #memes #offensivememes #offensive #feminist #feminists #feminism #corona #coronavirus #depression #suicide #gay #chingchong #china
2231572843261454201; 0; False; 1580244234; :red_heart::sun::sun::sun: #corona #coronavirus #wrx #coronaviruschina #china #virus #viruschina #coronachina #coronaviruseschina #life #australia #fire #forestfire #coala #saveaustralia #jdm #car #tuning #subaru #impreza #like #follow #tuning #tuningcars #cars #supercars
2231572842466379214; 0; False; 1580244234; #País: :triangular_flag:IMPORTANTE| :bookmark_tabs::briefcase::hospital: #ComunicadoOficial - Caso asociado a sospecha de #coronavirus :backhand_index_pointing_right:
2231572750132337981; 3; False; 1580244223; Şunu hatırlayan 3-5 kişi? . . . Kurucular @asringkc0 @talhauygaar18 . . . . #fortnite #fortnitedance #fortniteclips #pubg #pubgmobiletürkiye #pubgmobile #pubgtürkiye #pubglite #pubglitemobile #pubgdance #apexlegends #grandtheftauto #gta5 #zula #zulaoyun #günaydın #fortniteshop #fortnitevbucks #leagueoflegends #lol #loltürkiye #leagueoflegendstr #leagueoflegendsmemes #corona #coronavirus #kobebryant #callofduty #cod #callofdutymobile #callofdutymodernwarfare
2231572737222499074; 0; False; 1580244222; Its been a while. Ive been going through a lot of mental health struggles but hope to be more consistent. Anyway, you may have heard about this coronavirus going around. Well apparently 2 students are being tested for it at Miami university. They had traveled to China and had symptoms consistent with the virus. Will update more as info becomes available. The risk of spreading has been reported as “low”. See the next picture for info on the virus. #coronavirus #virus #health #ohiohealth #publichealth #awareness #toledohealth #medicine #cdc #isolation #travelohio
2231572717426046307; 0; False; 1580244219; I am sick #memes #meme #corona #virus #coronavirus #rat #funny #humor #tiktok
2231572672353387609; 0; False; 1580244214; :flushed_face: uummmm #meme #dankmemes #coronavirus
2231572347410938806; 6; False; 1580244209; #Tesla is helping with efforts to suppress the #coronavirus.
2231572569275214162; 1; False; 1580244202; Denver, are you afraid of the Corona virus? Come on down to @thebrutalpoodledenver and do a little Kung Flu Fighting with The Brutal Noodle. When it comes to your health why risk it when you can have brisket? This dish is PHOking delicious. The recipe has been passed down by at least 10 generations. Do yourself a flavor and get some noods. #pho #soup #coronavirus #denver
2231572338521085317; 0; False; 1580244201; #coronavirus #memeimages #newestmemes #todaymemes #recentmemes #decentmemes #memearmy #memedose #memehumor #questionablememes #sickmeme #oldmeme #unusualmeme #memeculture #memehour #bizarrememe #scarymeme #sarcasm #goofymemes #entertaining #ironic #stupidmemes #crazymemes #lightmeme #annoyingthings #memehearted #wtfmeme #dogmemes #catmeme #fortnitememes
2231572521282889124; 0; False; 1580244196; #País: :triangular_flag:IMPORTANTE| :bookmark_tabs::briefcase::hospital: #ComunicadoOficial - Caso asociado a sospecha de #coronavirus :backhand_index_pointing_right:
2231572499960064659; 0; False; 1580244194; #meme#memes#dailymemes#funny#coronavirus#bestmeme#bestmemes#bestmemesever #bestmemesdaily #dankmemes #memes:face_with_tears_of_joy: #memez #memepage #memestagram
2231572495950318422; 0; False; 1580244193; Happy Chinese New year 2020; still din't buy a red shirt this year; these are my siblings, don't ask me for their number again. This photo is from 2018 not 2020. #recycle #reuse #repeat #coronavirus #budlight #bintangbeer #washyourhands
2231572462823893824; 3; False; 1580244189; #gouvernement #wuhan #virus #corona #coronavirus #chine #china #epidemiology #wuhanchina #france #epidemie #paris #bordeaux #new #news #alert #alerte #2020 #infection #infected #instagood #instagram #insta #oms #warning #picoftheday #pekin #epicenter
2231572418923681517; 0; False; 1580244184; #ww3 #versus #coronavirus #memeoftheday #bestmemes #trending #memesdank #lightworker #alien #singer #musician #whatsup #instagood #instagram
2231572378517084433; 3; False; 1580244179; FAST 9 (Trailer Release Friday)⁣ ⁣ He’s lived his life a quarter mile at a time. The Road To #F9 Concert & Trailer Drop is this Friday at 8:00PM.⁣ ⁣ Turn on post notifications⁣ ⁣ Movie Schedule : Link in bio⁣ ⁣ #SilverbirdGhana #tuesdayMotivation #Ghana #nigeria #lagos #accra #2020goals #moviepremiere #january #afro #shatta #tuesdayMood #cinema #Ghanaians #marriage #momo #sark #mendeservebetter #MichealJackson #ghanaianwedding #naijawedding #titi #tuesdathoughts #instablog #nollywood #coronavirus⁣
2231572340257209181; 0; False; 1580244174; Qué es el Coronavirus⁣ Son una extensa familia de virus, algunos de los cuales pueden ser causa de diversas enfermedades humanas. Esta nueva cepa ha sido identificada en Wuhan, China⁣ ⁣ Síntomas:⁣ Fiebre⁣ Tos⁣ Dificultad para respirar⁣ Problemas Gástricos⁣ Diarrea⁣ Casos graves:⁣ Neumonía⁣ Síndrome respiratorio agudo severo⁣ Insuficiencia renal⁣ ⁣ Cómo se transmite?⁣ Circula entre animales pero se puede transmitir de humano a humano⁣ Vía aérea, contacto con secreciones, o con objetos contaminados⁣ Aún no existe un tratamiento o vacuna, sin embargo se pueden tratar los síntomas⁣ ⁣ Cómo prevenir⁣ Usar pañuelos para cubrirse la nariz y la boca al toser o si estornuda⁣ Lavarse las manos de manera frecuente⁣ Evitar las aglomeraciones y contacto con personas infectadas⁣ Acudir al médico apenas identifique el problema⁣ ⁣ ¿Podría expandirse globalmente?⁣ Hasta el momento la preocupación por el brote es a nivel regional (Wuhan, China)⁣ Ya hay más de 4.500 casos en 8 naciones: Tailandia, Japón, Corea del Sur, Taiwan, Singapur, Arabia Saudita, Macao, Hong Kong y Estados Unidos⁣ ⁣ #Vincenti #Coronavirus #Salud ⁣
2231572233779493564; 0; False; 1580244162; #meme #funny #china #Chinese #coronavirus
2231572149307511170; 64; False; 1580244152; ¿De que tengo que hacer el próximo? . . . . . . . #humor #estefania #memes #memesgraciosos #memesespañol #memesvirales #viral #risas #gracioso #beber #discoteca #fiesta #cristopher #mediaset #coronavirus #telecinco #china #tabaco #fiesta #laisladelastentaciones #nickiminaj #karolg #tusa
2231571488922005370; 79; False; 1580244149; Kevin Carpenter who arrived today at the Norman Manley International Airport in Kingston from Toronto, Canada, one of the countries that have recorded a case of the #coronavirus, says there was no screening for the virus upon his arrival. He also said he noticed people wearing masks at Toronto's Pearson International Airport. (:film_projector:: @taylor2nd) #GLNRToday
2231572071677545410; 0; False; 1580244142; . . . . . . . . #memesenespañol #memesgraciosos #memes #memechile #memeschile #meme #coronavirusmemes #coronavirus #chile
2231571915239482881; 0; False; 1580244124; Wait a minute... :dizzy_face: Follow @dyinghobo :raising_hands: Follow @dyinghobo :raising_hands: #dankmemes #memes #meme #dankmeme #funnymemes #coronavirus #coronavirusmemes #corona #darkhumor #darkhumormemes #lol #funny
2231571870603594070; 1; False; 1580244118; #china is offended by this picture, please repost. #coronavirus #chinaisasshoe
2231571850346609086; 0; False; 1580244116; #coronavirus #corona #memes #meme
2231571697925245087; 1; False; 1580244116; Coronavirus is a respiratory infection that can cause severe lung disease, including pneumonia.⁠ ⁠ Here are the best ways, according to the World Health Organization, to reduce your risk of #coronavirus infection.⁠ ⁠ Please also be mindful of travel and make sure you are up-to-date on all vaccinations!⁠ ⁠ #sicklecell101 #sicklecell
2231571055223155351; 9; False; 1580244114; Wuhan sakinleri karantina bölgesinden çıkmaya çalışıyor. . . . . . . . #turkey #türkiye #corona #korona #virüs #coronavirüs #sondakika #istanbul #bursa #izmir #ankara #hasta #hastalık #virus #coronavirus #haber #haberler #sondakikahaberler #çin #china #wuhan #güncel #güncelhaber #güncelhaberler #coronaviruses #coronaviruese #new #news #sondakikahaberleri
2231571797160589794; 0; False; 1580244110; #lacinaevicina#amala#coronavirus#eriksen#calciomercato
2231571723905087549; 0; False; 1580244101; #coronavirus #corona #memes #meme
2231571724323719174; 22; False; 1580244101; Just get some hand sanitizer and a face mask and sell them a nice big house :OK_hand: #coronavirus #actuallyagents #realestate
2231571689166552191; 0; False; 1580244097; Safeguard antibacterial y la prevención de enfermedades. . El correcto lavado de manos con un jabón antibacterial es fundamental ya que ayudará a reducir el riesgo de enfermedades cotidianas como: el resfrío, tos, diarrea y erupciones en la piel entre otras. . Es por eso que Safeguard se une a esta misión, ya que está científicamente probado que al lavarse las manos con Safeguard estás eliminando el 99.9% de los gérmenes y reduciendo así el riesgo de enfermedades en tu familia. . El lavado de manos con un jabón anti-bacterial es un hábito muy importante que debemos impulsar para que las personas cuiden su salud y prevengan el contagio de infecciones. . “El contacto de las manos con la piel es una de las causas principales de de transmisión de gérmenes, que puede ser reducido significativamente cuando las personas, especialmente los niños, son más cuidadosos con su higiene y se lavan las manos correctamente. . El lavado de manos en el hogar debe ser costumbre de todos los miembros, en especial antes y después de cocinar y/o de comer o beber, luego de ir al baño, tras cambiar pañales, luego de toser, estornudar y soplarse la nariz. . También hay que lavarse las manos luego de estar en contacto con animales, ya sea tocándolos, dándoles de comer o limpiándolos y, en especial, luego de manipular la basura. . Para lograr un adecuado lavado de manos, hay que mojarlas con agua corriente y enjabonarlas, frotarlas hasta formar espuma y frotar el dorso, palmas, entre los dedos y debajo de las uñas por aproximadamente 30 segundos y finalmente enjuagar con agua y secar con toalla de papel. . #Safeguard #EnfermedadesVirales #coronavirus #Virus #antibacterial #PuertoOrdaz
2231571676448286626; 0; False; 1580244095; Hell naw I’m dashin :rolling_on_the_floor_laughing::man_shrugging_medium_skin_tone: #coronavirus #funnymeme #hoodmeme #lmao:face_with_tears_of_joy::face_with_tears_of_joy::face_with_tears_of_joy:
2231571671951652669; 0; False; 1580244095; #coronavirus
2231571602863795803; 0; False; 1580244087; You like my taste in memes?Why not leave a follow to see it more often. #americanmemes #darkmemes #dankmemes #darkhumor #memes #dailymemes #offensivememes #offensive #hilariousmemes #fun #dailymemes #dank #firememes #coronamemes #coronavirus #chinamemes
2231571608844413755; 0; False; 1580244087; What has horns must not be hid in a sack. #VillageElder #CoronaVirus #osprey
2231571538188238703; 0; False; 1580244079; Respecto al Coronavirus:index_pointing_up_light_skin_tone:sigamos estas medidas preventivas que nos brinda la facultad de Medicina de la Universidad Nacional Mayor de San Marcos:double_exclamation_mark: . Más vale prevenir que lamentar :folded_hands: . . #coronavirus #unmsm #prevención
2231571509189964101; 0; False; 1580244075; #meme#memes#dailymemes#funny#coronavirus#bestmeme#bestmemes#bestmemesever #bestmemesdaily #dankmemes #memes:face_with_tears_of_joy: #memez #memepage #memestagram
2231571321233802631; 0; False; 1580244065; The OutBreak Is Spreading! Posted by @kingrando_loser and @koalalitymemes • #coronavirus #plague #blackplague #tiktok #offensivememes #schoolshootingmemes #dankmemes #memes #wholesomememes #memesdaily #funniestmemes #offensive #edgymemes #wholsomemes #edgy #offensivememes #dankmemes #dank #funny #funnymemes #memesdaily #dankmemes #offensivememes #offensive
2231571409197772177; 0; False; 1580244063; Det osynliga som inte syns. The unwatch that you cant see. Ikväll är första kvällen i mitt vuxna liv som jag inte äter choklad eller kaka. Samt att svära är inte så jävla farligt. Fan! #not #bambionice more #mårran unwatcheblt felstavat. Könsord är ju inte heller så farligt. Om ni lär era barn att inte döda blir världen bättre förutom #coronavirus #cordoba #celsius
2231571397512745944; 0; False; 1580244062; #coronavirus #corona #memes #meme
2231571350198180053; 0; False; 1580244059; Register now for #MSSNY’s Medical Matters webinar “Virtual Drill: Incident Command System & Crisis Communications” on Feb. 19th at 6:00-8:00 pm and learn how to combat a public health emergency like the Wuhan #Coronavirus. http://ow.ly/m0Z030qd57i / link in bio
2231571353042290733; 0; False; 1580244057; :face_with_open_mouth: :squinting_face_with_tongue: :squinting_face_with_tongue: #madeinchina #hechoenchina #coronavirus #marimbella
2231571235744483384; 13; False; 1580244053; video from Wuhan #coronavirus #china #virus #wuhan #sars #epidemic #2019nCo
2231571299113642511; 0; False; 1580244050; Si continua a sentir parlare di #infezione da #nuovo #coronavirus (CoV), ma capiamo bene di cosa si tratta: I coronavirus sono un particolare tipo di virus appartenente alla famiglia coronaviridae. Questi tipi di virus si chiamano così perché i loro virioni (la parte infettiva) appaiono al microscopio elettronico come piccoli globuli, sui quali ci sono tante piccole punte che ricordano quelle di una corona. Tali virus sono spesso tra le cause del raffreddore comune, quindi non sono così rari, ma alcuni sono più aggressivi di altri. Viene semplicemente definito “nuovo coronavirus” un coronavirus da poco identificato e le cui caratteristiche non sono ancora completamente note. Stando alle informazioni fornite finora dalle autorità sanitarie, il nuovo coronavirus inizialmente causa sintomi simili a un’influenza: congestione nasale (naso chiuso), mal di gola, spossatezza e febbre. In alcuni casi la malattia progredisce, creando un’infiammazione delle strutture più interne dei polmoni, e in mancanza di cure adeguate o per la presenza di precedenti malattie può rivelarsi mortale. Come ci si #protegge dal nuovo coronavirus? Le raccomandazioni delle autorità sanitarie per ridurre il rischio di infezione sono simili a quelle indicate per le altre malattie infettive, ovvero: • lavarsi spesso le mani con acqua e sapone per almeno 20 secondi; • utilizzare spesso igienizzanti mani; • evitare di toccare gli occhi, il naso o la bocca con mani non lavate; • starnutire e tossire in un fazzoletto o portandosi l’incavo del gomito alla bocca (in questo modo non si contaminano gli oggetti che si toccano con le mani e, al tempo stesso, non ci si porta nulla alla bocca dopo che si sono toccate superfici che potrebbero essere contaminate); • fare attenzione alle pratiche alimentari (evitare carne cruda o poco cotta, frutta o verdura non lavate e le bevande non imbottigliate) • pulire e disinfettare oggetti e superfici che possono essere stati contaminati.
2231571293141389614; 0; False; 1580244050; Very ironic Don’t forget to follow @the.ww3.drafting for more!!! #ww3 #ww3memes #ww3meme #iranpolitics #uspolitics #ww3alternate #ripkobe #kobe #ripkobebryant #ww3thepayback:fire: #ww3hasbegun #memed #ww3hasalreadybegun #thegreatplague #plagueoflondon #coronavirus #coronavirusgoaway #doomed #2020sucks
2231570347493039276; 2; False; 1580244050; A session a day keeps the doctors away! #cryopod #cryocenters #feelthefreeze #coronavirus #cryotherapy #cryochamber #coldaf #cryocenters #cryo #coldtherapy
2231571260540784305; 0; False; 1580244046; Birileri bişeyler planlamış :face_with_monocle: "Contagıon" - Salgın" filmi yapım 2011 Corona virüsüne bezner konu işlemiş Ekte final sahnesi var. Film çok başarılı değil, ama mevzu kafa karıştırıcı :skull_and_crossbones: #corona #contagion #movie #film #coronavirus #shot #cinema
2231571244403133564; 1; False; 1580244044; Virus n'a pas de nationalité #jenesuispasunvirus #coronavirus
2231571240248777613; 0; False; 1580244043; Çin'in #coronavirus için özel olarak yaptığı hastanenin inşaatının tamamlandığı belirtiliyor. #coronavirus #gundem #gündem #siyaset #sondakika #siyasi #tsk #dışpolitika #politika #politics #haber #haberler #türkiye #ankara #istanbul #izmir #antalya #bursa #msb #denizli #vatan #anadolu #turksilahlikuvvetleri #trump #putin #abd #rusya #türkiye #iran #çin
2231570951278237746; 2; False; 1580244009; :grimacing_face::grimacing_face::grimacing_face: - - - #shanedawson #rylandadams #garrettwatts #morganadams #andrewsiwicki #shyland #shanedawsonmemes #youtube #youtuber #youtubers #meme #memes #coronavirus
2231570945583945219; 1; False; 1580244008; 2,800 sqft 4 bedrooms Irvine Brand new Detached Home
2231569754242642430; 0; False; 1580243948; Шанхай, знаменитая Нанкинская улица (точнее, её восточная часть; точный адрес - 南京东路616号). Очередь в аптеку за медицинскими масками :face_with_medical_mask: ° вирускитай#коронавирус#коронавирускитай#симптомыкоронавируса#эпидемиякитай#вводвойсккитай#блокировкагородов#эпидемиякоронавирусакитай#коронавирусшанхай#коронавирусухань#коронавирус2020#вирус2020китай#coronavirus#viruschina#coronaviruschina#coronavirus2020#viruschina#нетуедывкитае#сдаютнервыиззавируса#едынетувухани#пустойгородвирускитай#стройкабольницыухань#вкитаенельзябезмасок
2231567312912345783; 3; False; 1580243575; Ученые в Гонконге разработали вакцину от коронавируса. ⠀ Я уже довольно сильно переживала из-за этой болезни. Боюсь вирусов. ⠀ Надеюсь, что новость не окажется фейком. И скорейшего выздоровления всем болеющим.
2231547911799744290; 9; False; 1580242765; شيوع ويروس كرونا به سرعت در حال گسترش است. چين شرايط فوق اضطراری اعلام کرده و مطابق با آن سازمان ملل نیز باید شرایط اضطراری اعلام می کرد. ویروس کرونا در پاکستان مشاهده شده است. روز دوشنبه همچنین تصویری از انتقال یک فرد مظنون به کرونا در ترکیه هم در رسانه‌ها منتشر شد. شمار کسانی که به دلیل ابتلا به ویروس جدید کرونا جان خود را از دست داده‌اند از ۱۰۶ نفر گذشته و نزدیک به یک هزار و ۳۰۰ مورد جدید ابتلا به این بیماری تایید شده است. ۱- از دست دادن با یکدیگر خودداری کنید. ۲- از مسافرت های غیر ضروری خودداری نمایید. ۳- از سفر به کشورهای آسیایی حتما خودداری کنید. ۴- در مترو و مکان های عمومی از ماسک های مناسب استفاده کنید. ۵- حتما از سرم های مناسب شستشوی بینی در طول روز استفاده کنید. ۶- هر روز از مواد غذایی حاوی ویتامین C مصرف کرده و مایعات کافی میل کنید. ۷- در طول روز از ژل های ضدعفونی دست استفاده کنید. ۸- از حضور در مکان های عمومی و پر تردد اجتناب کنید.مترو، ترمینالها، فرودگاه، بازار و ... مکانهای پر تردد با ریسک بالا هستند. ۹- از حضور غیر ضروری در بیمارستانها و مراکز اورژانس حتی المکان خودداری نمایید. مواظب خودتون باشید. ١٠- از حضور در مراكز خريد پرندگان و حيوانات خودداری کنید. ۱۱- از خرید گوشت پرندگان وحشی مخصوصا از شمال کشور بشدت خودداری کنید. فیلم هایی که از ووهان به بیرون درز کرده بسیار ناراحت کننده ست.#کرونا #چین #شیوع #بیمارستان #ویروس #کروناویروس #مرگ #ایران#coronavirus #world#china #wuhan #asia #europe
2231554150298509188; 2; False; 1580242006; @xiaomi.chile tkm ... .. . #stolen #stolenmemes #chilean #chileanmemes #memechile #memechileno #f4f #xiaomi #xiaomichile #corona #coronavirus #memesimpson #simpsons #simpsonsmemes
2231546531520278751; 1; False; 1580241098; None
2231489083807465021; 0; False; 1580234250; Então quer dizer que o coronavirus chegou no Brasil? Interessante #plague #plaguedoctor #cyberpunk #coronavirus
2231366907593214055; 0; False; 1580219685; I'm so scared. :anxious_face_with_sweat::face_screaming_in_fear: Make sure to tell your friends and family you love them. Share this to spread awareness. - - - - - #coronavirus #news #scared #breakingnews #warning #plague #epidemic #virus #stayinformed #apocalypse #endoftheworld #share #corona #china #disease #sadtruth
2231218527419100108; 1; False; 1580201997; At least 106 people have died from a new coronavirus in China following an outbreak in the central city of Wuhan, forcing a government lockdown in almost 20 cities that in effect has quarantined an estimated 56 million people. More than 4,520 cases have been reported globally, most of them in China and especially in Wuhan and nearby cities in Hubei province. WHAT IS CORONAVIRUS? According to the World Health Organization (WHO), coronaviruses are a family of viruses that cause illness ranging from the common cold to more severe diseases such as Middle East Respiratory Syndrome (MERS) and Severe Acute Respiratory Syndrome (SARS). These viruses were originally transmitted between animals and people. SARS, for instance, was believed to have been transmitted from civet cats to humans while MERS travelled from a type of camel to humans. Several known coronaviruses are circulating in animals that have not yet infected humans. The name coronavirus comes from the Latin word corona, meaning crown or halo. Under an electron microscope, the image of the virus is reminiscent of a solar corona. A novel coronavirus, identified by Chinese authorities on January 7 and named 2019-nCoV, is a new strain that had not been previously identified in humans. Little is known about it, although human-to-human transmission has been confirmed. What are the symptoms? According to the WHO, signs of infection include fever, cough, shortness of breath and breathing difficulties. In more severe cases, it can lead to pneumonia, severe acute respiratory syndrome, kidney failure and even death. The incubation period of the coronavirus remains unknown. Some sources say it could be between 10 to 14 days.
2230892349683481346; 0; False; 1580163113; :grinning_face_with_sweat: FOLLOW @KickAssCorridos :heavy_minus_sign: :heavy_minus_sign: :heavy_minus_sign: :heavy_minus_sign::heavy_minus_sign::heavy_minus_sign::heavy_minus_sign::heavy_minus_sign::heavy_minus_sign::heavy_minus_sign::heavy_minus_sign::heavy_minus_sign::heavy_minus_sign::heavy_minus_sign::heavy_minus_sign::heavy_minus_sign::heavy_minus_sign::heavy_minus_sign: #mexicanmemes #hispanicmemes #mexicansbelike #hispanicsbelike #mexicantarugadas #mexicanproblems #hispanicproblems #beingmexican #beinghispanic #memesmexicanos #memeshispanos #memesmexico #mexicanmemeswey #truemexicans #truemexicansbelike #nomames #nomameswey #memesderisa #takuachememes #corridosybandas #narcocorridos #funnymexicanmemes #regionalmexicano #mexicanfacts #latinosbelike #latinoproblems #coronavirus #mexicomedy :heavy_minus_sign::heavy_minus_sign::heavy_minus_sign::heavy_minus_sign::heavy_minus_sign::heavy_minus_sign::heavy_minus_sign::heavy_minus_sign::heavy_minus_sign::heavy_minus_sign::heavy_minus_sign::heavy_minus_sign::heavy_minus_sign::heavy_minus_sign::heavy_minus_sign:
2082482433656956273; 1; False; 1562471273; New s.media site for indigos &iconoclasts alike :prohibited::ewe: #kobebryantdied in helicopter on #kobebryantcartoon in 2016 also:man_shrugging_medium-dark_skin_tone::thinking_face: #orwell #edwardsnowden #billgates #patent #viral #coronavirus #iran #china NSA #theylive #pedoelitist #epsteindidntkillhimself #orlandobrown #westworld #harveyweinstein #elsagate #oprah personofinterest #theylive #vacinnes humanity #plauge trending #kobebryantconspiracy #metzizahbpeh #pizzagate #pedophilialegalizationmustbestopped #rickygervaise behindthescenes #adrenochrome #lebronjames #humantraffickingawareness #organharvesting 333me.life now since they cancelled my Youtube like they cancelled #issackappy Good job every1 ,I feel so good that I'm dedicating my entire life into Channeling divEYEness, even tho the algorithm suppresses my content:eye::OK_hand_medium-dark_skin_tone:w3 ar3 th3 saviors-take care+stay aware. 333me.life
2231571233220871971; 1; False; 1580244043; :upside-down_face: #coronavirus #coronovirus #deprem #domuzgribi
2231571099420910030; 8; False; 1580244032; fake moan if u want, ill nut in u. Now fake moan in that delivery room
2231569784307436836; 3; False; 1580244028; :warning:CORONAVIRUS People collapsing in Wuhan for the coronavirus spreading around the world. 28|01|2020 107 died and more than 4500 cases, the virus is spreading faster and a vaccine will be ready in months. . #coronavirus #viruschina #collapsingpeople #staysafe #Wuhan #virus #chinavirus #meixingredwinetown #china #spreading #videos #warning #attention
2231570908439530668; 0; False; 1580244025; #memes #memesdaily #spicymemes #dankmemes #deutschememes #deutsch #humor #haha #lol #witzig #lustig #lmfao #funnymemes #funny #fun #offensivememes #schwarzerhumor #englishmemes #english #china:China: #coronavirus #run #running
2231571087744141438; 7; False; 1580244025; Meus pêsames :black_heart::pensive_face: VEJA NOS STORIES DO :backhand_index_pointing_right: @noveladigital Sigam: @agoracelebridades :down_arrow: Marque os Amigos :down_arrow: . . . . . . . . . . . #carlinhosmaia #amordemae #brunamarquezine #neymarjr #anitta #tatawerneck #famosos #bbb20 #gabibrandt #julianapaes #jojotodynho # #mariliamendonca #sotocatop #grazimassafera #gusttavolima #sauloponcio #ivetesangalo #brumadinho #thevoicekidsbrasil #eramosseis #bomsucesso #anitta #neymarjr #sexeducation #fofocalizandonosbt #leodias #novelas #famosos #caiocastro #harianyalmeida #guguliberato #rodrigofaro #coronavirus
2231570999462797320; 0; False; 1580244015; Post Muto #eriksen #fcinter1908 #coronavirus
2231570935064987827; 0; False; 1580244007; Ahahahahah • • • • • • • • #meme #memeita #memeitaliani #blackhumor #sessodrogaepastorizia #pastorizianeverdies #dankmemes #dank #battutesquallide #battutedivertenti #cinesi #coronavirus #virus #scherzo #ridere #sifaperscherzo #nascecresceignora #nascecrescerespawna
2231570842452935716; 0; False; 1580243996; No misleading information please #coronavirus https://www.bbc.com/news/blogs-trending-51271037@
2231570812171581346; 0; False; 1580243992; Be safe everyone!!! #coronavirus #ICELONDON2020 #ICELONDON #betconstructdevelopmentoffice #betconstructmemes #softconstruct #softconstructmemes #officememes #London
2231570782272732287; 0; False; 1580243989; Países y territorios con reporte de casos confirmados para #2019ncov #coronavirus #valdiviacl #epidemiología #saludglobal reporte de situación del 28 de enero de 2020
2231570642888841503; 0; False; 1580243972; es Bud Lightyear wey #coronavirusmemes #coronavirus #foosgonewild #modelovirus #modelotime #fortnite #tekashi69 #ese #vato #cholo #budlightvirus #wuhan #wuhanchina
2231570511858907757; 0; False; 1580243957; Com Alessandra Lucchesi, vigilância epidemiológica da Sesap #sarampo #coronavirus #band
2231570501632183983; 0; False; 1580243955; :grimacing_face: :face_with_tears_of_joy: #coronavirus #humor #marimbella #hombres #tapabocas
2231570391237832259; 1; False; 1580243954; Please stay safe @ayulrast dan kawan" WNI disana:folded_hands::folded_hands::folded_hands: . Repost from @ayulrast MasyaAllah, terharu sekali malam ini. Tepat pukul 21:15 gasengaja buka jendela, banyak banget teriakan dari masyarakat Wuhan yg bilang "武汉加油!" (Wuhan jiayou!) Yang artinya "Semangat Wuhan!" Seketika merinding, campur haru :'))) . Teriakan ini dilakukan untuk saling support satu sama lain, seluruh warga Wuhan, biar kita ngga ngerasa sendirian:smiling_face_with_smiling_eyes: Aku bener-bener kali pertama ngerasain pengalaman ky gini, Semangat Wuhan, semangat temen-temen Indonesia, jiayou!:red_heart::red_heart::red_heart: . Maafkan suara sy yg berisik . #wuhanchina #coronavirus #wuhanjiayou
2231570483177666551; 2; False; 1580243953; Stay happy and healthy everyone! #samoyed #samoyeds #samoyeddog #samoyedpuppy #samoyedpuppies #samoyedsofinstagram #samoyedlife #samoyedlove #samoyedlover #samoyedpage #samoyedfans #samoyed_feature #samoyedclub #samoyedsmile #samoyedworld #teamsamoyed #dogsofinstagram #puppiesofinstagram #dog #dogstagram #dogs #doggo #coronavirus
2231570486442034924; 14; False; 1580243953; Azərbaycan mənim bəxtsiz anam oyy...Cahilliyin bu qədər olacağına inanmırdım. Sizin üçün ən güclü müsəlman ölkələrindən biri olan Pakistan belə hal-hazırda Çinə çox böyük dəstək edir. Bəşəriyyət üçün dua etməkdən, onlara dəstək olmaqdan girib postların, xəbərlərin altından onlara pis təhqirlər, alçaldıcı sözlər, şit-şit qarğışlar edirik. Biz nə zaman bu vəziyyətə gəlib çıxdıq ? Bizim müəllim həmişə dərsə çağırdığı şagird “ iki dəqiqə təkrarlıyım gəlirəm” deyəndə, müəllim də qayıdıb deyərdi ki, yeməklə doymayan yalamağla doymaz. Sizlər də yığın ordunuzu, keçirin başınıza maskaları gəlin çinliləri qırın. Onsuz da utancverici hərəkətlər edirsiz. Ay qardaş, elə sizlər də yeməklə doymamısız, yalamaqla doyan deyilsiniz. Belə türkün məsəli.. #coronavirus
2231570465193922182; 0; False; 1580243951; Penso che fucileranno tutti i cinesi in Italia~Boi #meme #memes #video #videos #funny #funnyvideo #funnyvideos #post #instagram #ridi #risata #funnypost #ridichetipassa #instagram #instagramphotos #instagramvideos #instalike #instagood #michaeljackson #coronavirus
2231570447426027557; 1; False; 1580243949; Almanya'da 3 yeni corona virüs vakası tespit edildi. #bilgi #bilgiler#gündem #sondakika#haber #koronavirüs #coronavirus
2231570415287916408; 13; True; 1580243945; Meus pêsames :black_heart::pensive_face: Sigam: @noticiasplay :down_arrow: Marque os Amigos :down_arrow: . . . . . . . . . . . #carlinhosmaia #amordemae #brunamarquezine #neymarjr #anitta #tatawerneck #famosos #bbb20 #gabibrandt #julianapaes #jojotodynho # #mariliamendonca #sotocatop #grazimassafera #gusttavolima #sauloponcio #ivetesangalo #brumadinho #thevoicekidsbrasil #eramosseis #bomsucesso #anitta #neymarjr #sexeducation #fofocalizandonosbt #leodias #novelas #famosos #caiocastro #harianyalmeida #guguliberato #rodrigofaro #coronavirus
2231570396482747703; 1; False; 1580243943; Der "neuartige" Coronavirus heißt nun 2019-nCoV = 2019-new coronavirus. In Wuhan 2019 im Dezember begann die Infektionsreihe. Auf einem Meeresfrüchte-/Essens-Markt sind die ersten Fälle ausgebrochen. 44 Betroffene waren es nämlich bis Anfang Januar, die meisten von diesen waren auf dem Markt. Ein chinesisches Sprichwort besagt "Wir essen alles was Beine hat, aber kein Tisch ist und alles was Flügel hat, aber kein Flugzeug ist". Zudem solltet ihr wissen, dass es oft auch wilde Tiere sind, die auf den Märkten meist noch lebend verkauft werden. - Eine einzige Wirtszelle kann von mehr als nur einem Virus befallen sein - Bestimmte Fledermäuse scheinen eine Immunität gegen diese Viren zu haben, so dass sich die Viren in ihren Zellen total wohl fühlen, weil sie nicht eliminiert werden und sich hier munter vermehren und weiterentwickeln können - Also tun sie das auch, mutieren & rekombinieren so vor sich hin und tauschen Geninformationen mit anderen Viren aus... - Plötzlich sind sie so "gut" geworden, dass sie nicht nur Fledermäuse oder andere Tiere befallen können, sondern eben auch Menschen... und von Mensch zu Mensch übertragbar werden - So war es beispielsweise auch schon beim SARS-Virus mit Ausbruch im Jahr 2002 - Der neue Coronavirus kann nun also auch Menschen infizieren und erreicht damit das plötzlich berühmte Infektionspotenzial. • Zum aktuellen Wissenstand wird im Folgenden was kommen. • #wuhan #wuhanvirus #china #infektion #outbreak #viren #virus #coronavirus #krankheit #arzt #ärztin #instadoc #instadoctor #medfluencer #wissen #medizin #mehrmedizin
2231570358514682398; 0; False; 1580243938; :slightly_smiling_face::upside-down_face: . . . #meme #memes #memesdaily #spicymemes #unusual #dankmemes #coronavirus #apocalypse #outbreak
2231570300984894677; 0; False; 1580243931; #corona #coronado #corona:beer_mug: #coronabeer #coronavirus #coronavirusmemes #beer
2231570012232304788; 0; False; 1580243930; #memes #dankmemes #coronavirus
2231570273302393503; 1; False; 1580243928; Uwaga uwaga! Wstawka do mojego Instastory. wejdź w mój profil i znajdź "SARS, MERS itp", żeby poczytać czy zadać pytanie. Zestawiłam Wam dane do samodzielnej oceny - kolejno: Epidemia SARS, MERS i 2019-nCoV. Na końcu tabelka zestawiająca najważniejsze cechy tych korona wirusów. Można podesłać znajomym. #coronavirus #koronawirus #SARS #MERS #chiny #china #epidemia #epidemy #virus
2231570187503582501; 3; False; 1580243924; #SonDakika Almanya'da 3 Corona Virüs vakası daha doğrulandı. . . . #coronavirus #corona #virus #coronaviruses #coronavirüsü #wuhancorona #chinavirus #deprem #elazığ #elazığdeprem #sivrice #Wuhan #WuhanCoronovirus #WuhanOutbreak #WuhanSARS #coronovirus #CoronavirusOutbreak #germany #germanycorona
2231570232216692092; 23; True; 1580243923; Meus pêsames :black_heart::pensive_face: Sigam: @noticiasplay :down_arrow: Marque os Amigos :down_arrow: . . . . . . . . . . . #carlinhosmaia #amordemae #brunamarquezine #neymarjr #anitta #tatawerneck #famosos #bbb20 #gabibrandt #julianapaes #jojotodynho # #mariliamendonca #sotocatop #grazimassafera #gusttavolima #sauloponcio #ivetesangalo #brumadinho #thevoicekidsbrasil #eramosseis #bomsucesso #anitta #neymarjr #sexeducation #fofocalizandonosbt #leodias #novelas #famosos #caiocastro #harianyalmeida #guguliberato #rodrigofaro #coronavirus
2231570080819436990; 0; False; 1580243905; #coronavirus
2231570055274152751; 0; True; 1580243902; Meus pêsames :black_heart::pensive_face: Sigam: @noticiasplay :down_arrow: Marque os Amigos :down_arrow: . . . . . . . . . . . #carlinhosmaia #amordemae #brunamarquezine #neymarjr #anitta #tatawerneck #famosos #bbb20 #gabibrandt #julianapaes #jojotodynho # #mariliamendonca #sotocatop #grazimassafera #gusttavolima #sauloponcio #ivetesangalo #brumadinho #thevoicekidsbrasil #eramosseis #bomsucesso #anitta #neymarjr #sexeducation #fofocalizandonosbt #leodias #novelas #famosos #caiocastro #harianyalmeida #guguliberato #rodrigofaro #coronavirus
2231570052205749571; 1; False; 1580243902; - - - #meme #memes #funny #fun #Honduras #dank #lol #fortnite #tiktok #twitter #chiste #dankmemes #ToyStory #humornegro #ww3 #español #fuerajoh #Thanos #pewdiepie #jakepaul #mrbeast #tfue #ninja #catracho #Coronavirus #catrachos
2231568297567619038; 2; False; 1580243891; En minutos comenzamos !!! Kazadores de Sueños ! Hoy temas como la pandemia de la gripe China , también hablaremos de celos , #JorgeRowinsky Esto y más desde las 22hs en La Nueva 87.9 Fm desde #Madrid y por la #app #LaNueva879 o nuestras páginas de Facebook :microphone: https://www.facebook.com/la879fm/ :television: https://www.facebook.com/kazadores/ no dejes de comunicarte a nuestro whatsapp en línea directa :telephone: 0034-619 667 101 #coronavirus #gripechina #madrid #celos #kazadoresdesueños #katherinshymitzk #debatekazador #uruguayosporelmundo
2231569866540914343; 1; False; 1580243880; En minutos comenzamos !!! Kazadores de Sueños ! Hoy temas como la pandemia de la gripe China , también hablaremos de celos , #JorgeRowinsky Esto y más desde las 22hs en La Nueva 87.9 Fm desde #Madrid y por la #app #LaNueva879 o nuestras páginas de Facebook :microphone: https://www.facebook.com/la879fm/ :television: https://www.facebook.com/kazadores/ no dejes de comunicarte a nuestro whatsapp en línea directa :telephone: 0034-619 667 101 #coronavirus #gripechina #madrid #celos #kazadoresdesueños #katherinshymitzk #debatekazador #uruguayosporelmundo
2231569868528810806; 0; False; 1580243880; O Ministério da Saúde confirmou hoje (28) o primeiro caso suspeito de coronavírus no país e elevou o nível de atenção para alerta de perigo iminente para a presença do vírus no país. De acordo com o ministro da Saúde, Luiz Henrique Mandetta, uma estudante de 22 anos que esteve na China está internada, em Belo Horizonte, em observação. “O que muda é o grau de vigilância nessa fase. Aumenta a nossa vigilância de portos e aeroportos, triagem de pacientes, o uso de determinado equipamentos de proteção, mas o nosso foco principal nesta fase é a vigilância”, disse Mandetta, em entrevista coletiva para falar sobre as medidas tomadas pelo governo para evitar a entrada do vírus no país. Veja os detalhes clicando no link do perfil ou acessando odiamais.com.br #Coronavirus #Gripe #Brasil #ODiaMais
2231569809381049492; 0; False; 1580243873; No te pierdas este viernes. EL NUEVO SHOW DE LAS NOTICIAS TRÍGIDAS!!. Veremos... El terrible CORONA VIRUS!! :face_vomiting::face_with_head-bandage:. Al estilo de QUE TRÍGIDO. . . . #reir #pensamientopositivo #rietechile #trigido #quetrigido #television #informativo #hoy #chilegram #informate #actualidad #humoristas #instachile #buenosdias #servicios #producer #weones #farandula #youtube #youtuber #santiagodechile #coronavirus #standup #productor #informacion #quito #sieschilenoesbueno #chile
2231569771506564131; 0; False; 1580243868; #meme#memes#dailymemes#funny#coronavirus#bestmeme#bestmemes#bestmemesever #bestmemesdaily #dankmemes #memes:face_with_tears_of_joy: #memez #memepage #memestagram
2231569752243956881; 3; False; 1580243866; :rolling_on_the_floor_laughing::woman_facepalming_light_skin_tone: . #qanons #CoronaVirus #antivax #stayvigilant
2231569460438646253; 0; False; 1580243865; The first person to offer a moment of silence to victims of new #Coronavirus #WuhanPnuemonia is not from the Chinese leadership, but the US Secretary of Commerce Wilbur Ross, at the White House Lunar New Year event Meanwhile Chinese officials are busy shifting blame to each other 美國商務部部長羅斯在白宮農曆新年慶祝活動上， 帶領全場為新冠病毒遇難者默哀。 在中國官員正忙於甩鍋推責任時，美國已成為全球首個爲中國在病毒疫情中死亡者默哀的國家！
2231569715184485148; 0; False; 1580243862; The first person to offer a moment of silence to victims of new #Coronavirus #WuhanPnuemonia is not from the Chinese leadership, but the US Secretary of Commerce Wilbur Ross, at the White House Lunar New Year event Meanwhile Chinese officials are busy shifting blame to each other 美國商務部部長羅斯在白宮農曆新年慶祝活動上， 帶領全場為新冠病毒遇難者默哀。 在中國官員正忙於甩鍋推責任時，美國已成為全球首個爲中國在病毒疫情中死亡者默哀的國家！
2231569712912180914; 0; False; 1580243861; :globe_showing_Americas::globe_showing_Asia-Australia::globe_showing_Europe-Africa: Repost (pic 1) @veganism.is.the.only.option: “How can we treat mothers so badly? . . . :seedling:Follow @veganism.is.the.only.option for more vegan content :seedling: . . . :camera_with_flash: @andrewskowron” :broken_heart::pig::broken_heart::pig::broken_heart::pig::broken_heart::pig::broken_heart::pig::broken_heart::pig::broken_heart::pig::broken_heart::pig::broken_heart: #teachyourchildrenthetruth #alllivesmatter #differentbutequal #maketheconnection #life #love #family #motherhood #momlife #mom #pregnant #newborn #babyanimals #animals #babygirl #babyboy #piglet #pigletlove #cuteanimals #metoo #holocaust #feminism #equality #concentrationcamp #auschwitz #coronavirus #healthyfood #health #vegetarian #vegan
2231569702309055697; 0; False; 1580243860; China's Coronavirus is spreading. Here’s what you can do to keep your investments safe. http://bit.ly/310crB0 #investing #investingTips #coronavirus $MFC.CA $MFC $FTS.CA $FTS $RY $RY.CA $ENB.CA $ENB #stockInvesting #dividendStocks #dividends
2231569698590401616; 0; False; 1580243860; I just want to fix it. #corona #coronaaustralis #cured #coronavirus :princess_medium-light_skin_tone::dashing_away::brain::red_heart::sparkles:
2231569658183735981; 0; False; 1580243855; OZON TEDAVİSİ BAĞIŞIKLIK SİSTEMİNİ GÜÇLENDİRİR. #ozontedavisi #ozonterapi #bursaozontedavisi #beytiyebaş #grip #coronavirus #influenza
2231569645566122794; 0; False; 1580243853; Follow @medicalhangout Follow @medicalhangout . #medicalhangout #nigeriamedicalhangout . . #coronavirus #coronavirusoutbreak #coronavirusmemes #coronaviruses #coronavírus
2231569612347726811; 2; False; 1580243849; Wenn jemand in meine Richtung niesen möchte #coronavirus #fcgrünweiß #boxen #boxing #boxeo #amateurboxing #olypicboxing #olympischesboxen #training #sport #kampfsport #technik #boxschule #ukraine #russland #orthodox #kasachstan #sparring #ingolstadt #zukunft #kampf #sieg #gold #adidasboxing #paffensportboxing #blackforestcup
2231569479497062205; 2; False; 1580243848; beta tested by @neincircles meme created by me pls dm me before reporting or unfollowing me! ___________________ #gamingmemes #epicmemes #blackops2 #blackops #callofduty #funnymemes #blackopsmemes #zombies #zombiememes #callofdutymemes #cod #bo2 #treyarch #coronavirus #ironic #ironicmemes #shittymemes #darkhumor #dankmemesdaily #darkmemes #dankdank #illegalmemes
2231569457083683966; 3; False; 1580243845; Tayland Havayolları, Çin'in Wuhan kentinde ortaya çıkan ve şu ana kadar 100'den fazla kişinin ölümüne yol açan Corona virüsüne karşı, uçuş öncesinde uçakları dezenfekte ediyor. Tayland'da 14 kişiye Corona virüsü tanısı korunurken, Çin'den gelen tüm yolcularda ülkeye girmeden önce sağlık kontrollarından geçiriliyor. #voa #voaturkce #amerikaninsesi #voaturkish #coronavirus #thailand
2231569574844017013; 2; False; 1580243845; #corona #coronavirus #dumbjoke
2231569441908009630; 1; False; 1580243834; :heavy_large_circle: | El aeropuerto internacional DFW empezará a realizar revisiones de pasajeros internacionales para identificar síntomas del coronavirus, una vez que los Centros para la Prevención y Control de Enfermedades ampliaron sus medidas para prevenir la enfermedad. Más detalles en nuestro sitio link en bio @aldiadallas ————————————————————————⠀ #noticias #aldiadallas #dallasfortworth #dallas #fortworth #dallas #fortworth #DFWAirport #salud #coronavirus
2231569438443016880; 0; False; 1580243829; @corona_tedavisi sen buralarda harcanıyorsun. . . . . . . . . . . #corona #coronavirus #cin #çinvirüsü #chinese #wuhan #coronavirus #cin #çinvirüsü #chinese#wuhan #coronatedavisi
2231569432931714285; 1; False; 1580243828; When we say we #support #local #business we mean it. @haidilaohotpotus is suffering from rumors. Almost #empty #room #today. So I’m taking the #risk and #jumping in for a #bowl. Trusting my #immunesystem. #supportsmallbusiness #hotpot #coronavirus #livedangerously #daredevil #extreme #againstthegrain #asianindustryb2b #aib2b
2231569415391448688; 0; False; 1580243826; Soooooo someone found a cool mud puddle at recess today :grinning_squinting_face::see-no-evil_monkey::growing_heart: Sad fade is because he was so excited to get onto the next fun thing that he didn’t want to slow down! ⁣ ⁣ Meanwhile, Ouen was making Alita giggle contagiously...like #coronavirus level contagious:face_with_tears_of_joy: As chaotic as some moments can get with these three - they always manage to remind my Ruby, goal oriented self that sometimes jumping in the puddles IS the ultimate goal:raising_hands_medium_skin_tone:
2231569395268967804; 0; False; 1580243823; #Buzyn #coronavirus #france #memepaspeur
2231569364229110178; 3; False; 1580243820; New anti-viral masks may help prevent deadly viruses! Israeli companies are rushing to complete development of facemasks that could be vital prevention tools in epidemics like Wuhan coronavirus. Disposable facemasks cannot block all pathogens and do not kill them. A used and discarded mask can even become a vector for disease as the pathogens multiply in its fibers. The new masks are told to have anti-pathogen properties and ability to wash and reuse. Read more, link in bio! Article thanks to @israel21c #coronavirus #facemask #healthtechnology #healthtech #medicaltechnology
2231569312162988789; 1; False; 1580243814; The death toll from the #coronavirus topped 100 on Tuesday as #China confirmed more than 4,500 cases of the virus. Despite worldwide efforts to increase travel restrictions, the virus has continued to spread outside China. #virus #everydaychina #everydayasia #viral #health #sickness #wuhan #anews
2231569100792987717; 3; False; 1580243810; Mambo yenyewe ndo kama haya sasa isipatikne #coronavirus tena? Mchemsho wa Popo nini..kama kafa s***
2231569206633547974; 23; False; 1580243801; “La primera oportunidad que tenga, me gustaría salir de Wuhan¨: Estudiantes dominicanos en China en alerta por el Coronavirus. Dominicanos que cursan estudios en Wuhan (Hubei, China), explican cómo está la situación relacionada con el coronavirus desde el epicentro de esa pandemia. La información completa en www.noticiassin.com #NoticiasSIN #SIN #SINDigital #SIN24Horas #Coronavirus
2231569192843702003; 0; False; 1580243799; www.hatecouture616.com #hatecouture #jenesuispasunvirus #shokoasahara #sarin #coronavirus
2231568809951816063; 0; False; 1580243797; Sígueme para más Etiqueta a tus amigos . . . . Tags: #momos4k #memes #meme #memesenespañol #videosderisa #videos #videosgraciosos #dankvideos #videosrandom #risa #gracioso #youtube #minecraft #sdlg #momoscorp #coronavirus #luisitocomunica #legionmomo #legionholk #instalike #ranvi #ranvideos
2231569161570584489; 2; False; 1580243796; :newspaper:| Agotadas las mascarillas en las farmacias españolas.⠀ ⠀ La comunidad china ha terminado con las existencias de mascarillas en las boticas españolas. Los ciudadanos chinos residentes en España compran las mascarillas para enviarlas a sus familiares en el país asiático. Las ventas han crecido más de un 300% respecto al año anterior, según datos de Cofares, la cooperativa líder en la distribución farmacéutica española.⠀ ⠀ En Cataluña, la Agencia de Salud Pública está investigando un posible caso de coronavirus en la región. El paciente cumple los criterios clínicos y epidemiológicos que hacen sospechar de la infección, según han comunicado fuentes de la Generalitat.⠀ ⠀ En Alemania se ha registrado en la región de Baviera el primer caso confirmado del coronavirus por contagio entre humanos. Este paciente no había viajado a China, pero tuvo contacto con una colega procedente de dicho país que estaba de visita en Alemania, según han informado este martes las autoridades sanitarias del estado de Baviera.⠀ ⠀ :camera: Un voluntario de la Cruz Roja participa en labores de desinfección de un edificio en Qingdao |EFE⠀ ⠀ #coronavirus #virus #wuhan #health
2231569029825545205; 2; False; 1580243795; Drug stores, hardware stores and supply stores across the GTA are all running low of surgical and protective masks as more people fear the increasing spread of coronavirus. But do the masks actually help? . . . #surgicalmasks #protectivemasks #virus #coronavirus
2231569124459195817; 0; False; 1580243791; Hy vọng chúng ta nhanh chóng tìm ra vaccine phòng chống #coronavirus Tạm dịch: Trong một bước đột phá lớn trong cuộc chiến toàn cầu chống lại coronavirus, các nhà khoa học ở Úc đã phát triển một phiên bản phòng thí nghiệm của căn bệnh này.
2231569088345245103; 0; False; 1580243787; #coronavirus
2231569069882458601; 0; False; 1580243785; What it’s like living through the Wuhan Coronavirus outbreak #coronavirusoutbreak #coronavirus
2231568986516792714; 10; False; 1580243775; KARonaVIRUS . . . #sketch #sketchbook #corona #coronavirus #virus #china #art #artoftheday #artshare #artsy #dick #beer #surrealism #surreal #blackandwhite #pencil #drawing #albania #arte
2231568970184222795; 2; False; 1580243773; Sometimes, I think about things I'd do to have him out of office. Here's one. #postcardstodonald #donaldtrumpisaninfectiousdisease #anyonebuttrump2020 #votehimout #votebluenomatterwho #nevermypresident #coronavirus #dumpthetrumpadministration #fucktrump
2231566282942530158; 1; False; 1580243772; :Jamaica:REPORTEDLY DAMAGES CAUSED FROM EARTHQUAKE IN JAMAICA :Jamaica: LESS THAN A FEW HOURS AGO:double_exclamation_mark: . . . . . . . #coronavirus #china #sick #jamaica #earthquake #publichealth #breakingnews #uptopboss #unrulyboss #worldboss #proudjamaican #bug #viral #music #dancehalldaily #food #diet #bobmarley follow me @dancehallroom #caribbean #popcaan #chroniclaw #6ixx #proudjamaican #health #dancehallmusic #followers #africa #cannabiscommunity #uptopboss #yardmanting #genna #china #dancehalldaily
2231568920531556309; 0; False; 1580243767; #Nacionales | @ginesggarcia y @alferdezok descartaron la posibilidad de que el #coronavirus llegue a la Argentina [Link en bio]
2231568912294064718; 0; False; 1580243766; Who is playing Plague Inc? STOP I’m scared:face_screaming_in_fear::face_screaming_in_fear:@kingrando_loser #tiktok #offensivememes #schoolshootingmemes #dankmemes #memes #wholesomememes #memesdaily #funniestmemes #offensive #edgymemes #wholsomemes #edgy #offensivememes #dankmemes #dank #funny #funnymemes #memesdaily #dankmemes #offensivememes #offensive #corona #coronavirus #coronavirusmemes #coronavirusmemesarenotfunny
2231568901615843526; 0; False; 1580243765; #PrevenciónEsSalud | El Ministerio de Salud Pública, a través del Sistema de Vigilancia Epidemiológica, aconseja a la ciudadanía informarse por canales oficiales y mantener la calma. ¡En Ecuador no hay casos confirmados de #Coronavirus!
2231568863716006406; 0; False; 1580243760; Corre lá galera eu falando um pouco como estão as coisas por aqui da uma força lá no canal LINK Na BIO :backhand_index_pointing_up::backhand_index_pointing_up::backhand_index_pointing_up::backhand_index_pointing_up: #coronavírus #coronavirus #coronaviruschino #coronavírusChina #virus #vírus #China #brasileirosnachina #vlog #youtuber #vivernachina #morarnachina
2231568669249849373; 2; False; 1580243751; Sígueme para más Etiqueta a tus amigos . . . . Tags: #momos4k #memes #meme #memesenespañol #videosderisa #videos #videosgraciosos #dankvideos #videosrandom #risa #gracioso #youtube #minecraft #sdlg #momoscorp #coronavirus #luisitocomunica #legionmomo #legionholk #instalike #ranvi #ranvideos
2231568777195463002; 0; False; 1580243750; (((:red_circle:))) EN VIVO Atento Ecuador, el Ministerio de salud desmiente que ciudadano sospechoso de #coronavirus haya fallecido, sin embargo, informa que su situación es crítica. #Daule #Ecuador #Mundo #Quito #Esmeraldas #Manabí #Galápagos #SantaElena #Nobol #SantaLucía #Palestina #Colimes #Balzar #ElEmpalme #Quevedo #Vinces #Samborondón #Durán #Salitre #Guayaquil #Cuenca #Ambato #Machala #SantoDomingo
2231565024493335748; 11; False; 1580243749; DM den böyle bir video geldi çok çok çok büyük ihtimal fake ama paylaşmak istedim. :face_with_tears_of_joy: . . . . . #turkey #türkiye #corona #korona #virüs #coronavirüs #sondakika #istanbul #bursa #izmir #ankara #hasta #hastalık #virus #coronavirus #haber #haberler #sondakikahaberler #çin #china #wuhan #güncel #güncelhaber #güncelhaberler #coronaviruses #coronaviruese #new #news #sondakikahaberleri
2231568671625215897; 3; False; 1580243737; ‘Dis ma main man @skinnyjimmy85. He’s out right now buying a survival kit in case of a #coronavirus outbreak. He takes such good care of us. I love him so. :beating_heart::beating_heart::beating_heart:
2231568671742268656; 2; False; 1580243737; *chewing intensifies* *mother's screaming intensifies* . . . #dankmemes #memes #relatable #meme #dailyfunny #relatablememes #funny #dailymemes #reddit #redditmemes #dankmemesdaily #lol #tiktok #tiktokmemes #ww3 #kobe #kobebryant #animememes #cursedimages #offensivememes #washington #china #coronavirus #corona #plague #america #outbreak #lunarnewyear #chinesenewyear #pornmemes:no_one_under_eighteen:
2231568663806611622; 0; False; 1580243736; Segun Infobae.com, un nuevo virus surgido en China no para de reportar casos de contagios y de muertes. Se trata de una nueva cepa de coronavirus denominada 2019-nCoV que ya se cobró la vida de 80 personas e infectó a más de 2000. . El virus toma su nombre del latín debido a su aspecto de corona bajo el microscopio, y pertenece a una gran familia de patógenos comunes. Algunos coronavirus solo afectan a los animales, pero otros también pueden contagiar a los humanos. . Segun. bbc.com, algunos de sus síntomas son: 1) Dificultad para respirar. 2) Fiebre. 3)Tos. 4) Dolor muscular. 5) Falla renal. . Para prevenirlo, se recomienda, según la Sociedad Española de Medicina Preventiva, Salud Pública e Higiene (SEMPSPH): . Evitar el contacto cercano con personas afectadas por infecciones respiratorias. . Lavado de manos frecuente, especialmente antes y después del contacto directo con personas enfermas y su entorno. . Mantener una distancia de un metro entre personas, aproximadamente, cubrirse la boca y la nariz con el antebrazo o pañuelos desechables al toser o estornudar y lavarse las manos después. . #coronavirus #China #salud
2231568646602169559; 4; False; 1580243734; The CDC has instructed Americans to avoid all nonessential travel to China. At the moment, 17 Chinese cities with more than 50 million people are on lockdown. Export stats out today from the Federation Horlogère Suisse indicate that the Swiss watch industry is set to take a major hammering at the hands of the public health crisis in The People’s Republic of China . . . Read more at The Truth About Watches dot com (link in bio). • • • • • #coronavirus #coronavirusoutbreak #swisswatch #swisswatchesblog #luxurywatches #luxurywatches #watchindustry #watchfamjapan #watchfamphilippines #watchfamcanada #watchfamnorway #malaysiawatchfam #nzwatchfam
2231568561800133822; 0; False; 1580243724; CPAC is now calling for #donations to purchase much needed medical supplies for #Wuhan hospitals to fight the new #coronavirus. CPAC will release purchase orders to the public in a transparent manner. A final report of the use of the donations will be provided to the public with an audited financial statement by an independent auditor. To make a donation, please go to: https://www.gofundme.com/f/canada-for-wuhan-medical-supply-fund-raising For more information, please contact CPAC at 416-298-7885 x 101 CPAC sincerely thanks everyone for their care and generous donations.
2231568547775887429; 0; False; 1580243722; Odamda elektrik devresi atti ve mutfağa taşınmak zorunda kalan bir ben. Herkese selamlar bu arada. Prizlerimin hicbiri çalışmıyor. Dahası lambam da yanmıyor. Evde elektriğin çalişmayıp sorun çıkardığı tek yer benim odam nasıl olabiliyor hala inanabilmiş değilim ama talihim yok bahtım karaaaa türküsünden bir alıntı yaparak isyanlardayım.jfkfkdkdkdkd #birliktesoyle #talihimyokbahtımkara #study #osym #2020 #2020tayfa #coronavirus #book #night #light #tyt #ayt #yks #2020yks
2231568278441129093; 0; False; 1580243720; Durum böyle . . . . . . . . . . . . #corona #coronavirus #cin #çinvirüsü #chinese #wuhan #coronavirus #cin#çinvirüsü #coronatedavisi
2231568474854127985; 0; False; 1580243714; Bill Gates ha donato, tramite la Bill&Melinda Gates Foundation, 10 milioni di dollari per aiutare i soccorritori e tentare di arginare il diffondersi del coronavirus, che sta tenendo in allerta l’Organizzazione Mondiale della Sanità e gli Stati di tutto il mondo. Anche Tim Cook della Apple, Mark Zuckerberg e alcune grandi corporation (la tedesca Bayer, le francesi L’Oreal e Michelin) hanno fatto importanti donazioni. Secondo il Financial Times in queste ore sarebbero già stati raccolti fondi per 1,4 milioni di dollari. La Commissione Sanitaria cinese ha dichiarato che i casi di infezione fino ad ora accertati sono 4515 e che l’epidemia raggiungerà l’apice entro una decina di giorni. #coronavirus #coronavirusoutbreak #billgates #billgatesfoundation #hotspotceleb #timcook #markzuckerberg
2231568468745495561; 3; False; 1580243713; Ah! E già che ci siete avvisatemi quando finisce la WW3!:smiling_face_with_sunglasses: #onlyfattanza #love #groenlandia #ww3 #rilassarsi #gattoschifomadò #thebest #coronavirus #contagio #meme #memepage #alwaysawake
2231568465767188314; 0; False; 1580243713; Sígueme para más Etiqueta a tus amigos . . . . Tags: #momos4k #memes #meme #memesenespañol #videosderisa #videos #videosgraciosos #dankvideos #videosrandom #risa #gracioso #youtube #minecraft #sdlg #momoscorp #coronavirus #luisitocomunica #legionmomo #legionholk #instalike #ranvi #ranvideos
2231568454853742692; 0; False; 1580243711; If I die from coronavirus you have my permission to clown me and pour all these beers on my dead body #shitpost #meme #coronavirus #mexicanmemes #oc
2231568370816628557; 3; False; 1580243707; Sígueme para más Etiqueta a tus amigos . . . . Tags: #momos4k #memes #meme #memesenespañol #videosderisa #videos #videosgraciosos #dankvideos #videosrandom #risa #gracioso #youtube #minecraft #sdlg #momoscorp #coronavirus #luisitocomunica #legionmomo #legionholk #instalike #ranvi #ranvideos
2231568080656679832; 0; False; 1580243702; #coronavirus
2231568317952049597; 0; False; 1580243695; Non... Je ne ferai pas de vidéo sur l'infection à coronavirus. Soyez gentil, ne m demandez pas pourquoi. Et puis, je pense que ces infographies de l'OMS sont assez parlantes. Pour ceux qui ne maîtrisent pas la langue de Shakespeare, attrapez vos dicos les amis. Bon... Je vous fais quand même un petit recap. Il faut savoir que le coronavirus existe bien depuis des années et que l'infection avait déjà existé en Arabie Saoudite. Petite précision, on parle aujourd'hui d'une nouvelle souche. Le nouveau virus : 2019-nCoV . L'épidémie aurait débuté en Chine dans la ville de Wuhan. Comment l'infection se manifeste t-elle ? Des maux de tête, une fièvre, un mal à la gorge, une toux, du mal à respirer, bref des signes classiques d'une grippe voire ceux d'une pneumonie. Comment prévenir l'infection ? Le basique : une bonne hygiène des mains, attention aux contacts avec les animaux domestiques, chauffer correctement les aliments d'origine animale dont les fruits de mer (huitre, escargots de mer, crabes, poissons...), servez-vous de vos mouchoirs quand vous éternuez ou toussez, sinon toussez dans le creux de votre coude, jetez votre mouchoir utilisé, lavez-vous les mains, évitez le contact direct avec des personnes malades souffrant de grippe, et surtout un point super important auquel je tenais : l'immunité. Boostez votre système immunitaire les amis. Une pneumonie n'aura pas le même impact chez un vieil homme comparativement à un jeune. Une fatigue excessive, un stress mal géré, une dénutrition, tous ces facteurs qui créent une immuno-dépression, n'aident pas à combattre les infections. D'où la question clé : le style de vie (comment vous dormez, votre alimentation, comment vous gérez votre niveau de stress, la propreté de vos locaux ...), l'hygiène de vie. Voilà quelques éléments que je tenais à partager. Je n vais pas être plus long. Portez-vous bien :folded_hands:. #coronavirus #médecine #santepublique #santé #médecin #grippe
2231568274792357419; 0; False; 1580243690; El vicio es el vicio, valiendo madre el coronavirus...#memesterceraguerra #memesguerramundial3 #memesguerramundial #memesdelaguerra3 #memesvirus #memesviruschino #memescoronavirus #memesdelvirus #viruschinomemes #coronavirusmeme #coronavirus #viruschina #virus #wuhan #wuhanchina
2231568268970357002; 1; False; 1580243689; Latinos know! . . . . #vicks #coronavirus #corona #wwe #wwf #penicillin #mexican #latinos
2231568252530651357; 0; False; 1580243687; Photo de ce fameux #coronavirus chinois, en microscope :microbe::microscope: #Reddit #Actualités #Virus #Chine
2231568127146571295; 1; False; 1580243672; Lmao:face_with_tears_of_joy: Follow :backhand_index_pointing_right:(@daily._.funnymemes):backhand_index_pointing_left: for more!!! • • • • • • #kobe #ripkobe #ripjuicewrld #ripx #xxxtentacion #juicewrld #rip #song #songs #basketball #legend #legends #forkobe #legendsneverdie #best #cod #gaming #fortnite #apexlegends #helicopter #helicoptercrash #shooting #seizure #czechrepublic #czech #coronavirus #plagueinc #sfs #russia #slav
2231568045080188047; 0; False; 1580243662; Guys , please take a min to read this serious information regarding preventing Corona infection . This is from CDC verified message. Don’t take this lightly . . https://www.cdc.gov/coronavirus/about/prevention.html I travelled to Boston over the weekend, I have seen most of the passengers in the airport and flight wear masks . I had to do as well. . . Ministry of health’s emergency notification to the public that the Coronavirus influenza outbreak this time is serious & fatal. There's no cure once you are infected.* . Its spreading from China to various countries*, 2 cases confirmed in US. *Prevention method is to keep your throat moist, do not let your throat dry up. Thus do not hold your thirst because once your membrane in your throat is dried, the virus will invade into your body within 10 mins.* *Drink 50-80cc warm water, 30-50cc for kids, according to age.* *Everytime u feel your throat is dry, do not wait, keep water in hand.* *Do not drink plenty at one time as it doesn’t help, instead continue to keep throat moist.* *Till end of March 2020, do not go to crowded places, wear mask as needed especially in train or public transportation* * Avoid fried or spicy food and load up vitamin C and mutivitamins. . The symptoms/ description are* *1.repeated high fever* *2.prolonged coughing after fever* *3.Children are prone* *4.Adults usually feel uneasy,*headache and mainly respiratory related* *5: highly contagious*:police_car_light: . Please know and follow for your own health . . #coronavirus #cdc #health #globalsafety
2231568019134830275; 1; False; 1580243659; Let the panic begin Kansas City #coronavirus #weareallgoingtodie #dontgetsick
2231565206165628982; 10; False; 1580243655; Yo, China. Do us a favor - stop spreading this disease. Fucking disgusting, man!!!! I really hope these videos are just a hoax and not real .... I’m baffled :face_vomiting::face_vomiting::face_vomiting::face_vomiting::face_vomiting::face_vomiting::face_vomiting: #stopSpreadingyourDisease #china #coronavirus #dirtychina #eatTHIS:middle_finger_medium-light_skin_tone:#pandemic #barf #disgusting
2231567870178153527; 1; False; 1580243654; BİR ÇİNLİ ASANSÖR DÜĞMELERİNE TÜKÜRÜYOR MADEM GİDİCEM TEK GİTMİYİM HESABI #china #çin #wuhan #chinawuhan #wenom #wirus #virus #virüs #wuhanvirus #corona #coronavirus #coronavirüsü #wuhancoronavirus #wuhanchina #hastalik #hastalık #bulaşıcı #hijyenyok #tükürük
2231567930055689943; 0; False; 1580243649; Tetap waspada dengan terapkan prilaku sehat.!!! Dunia tengah digegerkan dengan keberadaan virus baru yang disebut dengan corona virus. Berdasarkan penuturan resmi dari Pemerintah Cina, virus tersebut pertama kali muncul dari wilayah Wuhan dan telah menyebar cepat. #coronavirus #ayoberphbs #germas #sehatindonesiaku
2231567175844528162; 0; False; 1580243647; Драка за маски у аптеки :ambulance: Подписка :China: Только свежие новости :fire::fire::fire: #Ухань #2019nCoV #заражение #инфекция #вирус #китайвирус #chinavirus #caronavirus #coronavirus #coronavirusoutbreak #coronaviruses #coronaviruschina #ухань #chinavirus #chinaeastern #武汉 #武汉大学 #武汉肺炎 #wuhanvirus #wuhanchina #wuhan
2231567897012732601; 14; False; 1580243645; Hayalet Şehir... . #coronavirus #wuhan #china
2231567856521479859; 1; False; 1580243640; Lo de la pandemía de #coronavirus es muy serio, pero sorprende la cspacidad drl humor #memescoronavirus #memesespañol #memes:face_with_tears_of_joy:
2231567822916683999; 0; False; 1580243636; - 4,515 confirmed coronavirus cases and 106 deaths reported on the Chinese mainland as of 24:00 on Jan 27 - As of Monday midnight, Hubei had reported 2,714 confirmed cases of novel coronavirus, including 100 deaths. - China postpones school semester amid novel coronavirus outbreak. - China sends nearly 6,000 medical workers from across the country to Hubei in virus fight. - Southwest China's Tibet autonomous region, the only provincial region that hasn't reported any novel coronavirus cases, has temporarily suspended the operation of all its scenic attractions to tourists. CHINA IS FIGHTING AN IMPORTANT BATTLE. OUR HEART IS WITH CHINA PEOPLE. OUR SOLIDARITY IS WITH CHINA 我们的心在中国 :beating_heart::beating_heart::beating_heart::flexed_biceps::flexed_biceps::flexed_biceps: ！！！ #china:China: #chinadestinations #chinapeople #crownvirus #coronavirus
2231567795527985755; 0; False; 1580243633; #Intermacionales || Xi Jinping sobre el Coronavirus: “La epidemia es un demonio y no podemos dejar que se oculte” El presidente chino, Xi Jinping, estimó el martes que su país libra una importante batalla contra el “demonio” del nuevo coronavirus y pidió transparencia en los esfuerzos que hace su gobierno para contener la epidemia. . “La epidemia es un demonio y no podemos dejar que el demonio se oculte”, dijo Xi durante una reunión con responsables de la Organización Mundial de Comercio (OMS), según informaron medios públicos. . Además, Xi aseguró que reforzará la cooperación internacional. “Creemos que la OMS y la comunidad internacional proveerán calma, objetivos y disposiciones racionales y China confía en ganar esta batalla contra el virus”, declaró. . . Con información de AFP . #28Ene #Noticias #Epidemia #Coronavirus #China #Mundo
2231567694209371660; 3; False; 1580243631; Çin'de ki çekilen karelerden bir korku filmi çıkar artık, durum vahim! . .@turkiyebirligi_ :backhand_index_pointing_left::backhand_index_pointing_left::backhand_index_pointing_left::thumbs_up:. Tavsiye ederim, arkaşta durumun ciddiyetini gösteren bolca video var #türkiye #receptayyiperdoğan #mhp #akparti #ülkücü #etiket #beğeni #deutschland #keşfet #gurbet #azerbaijan #almanya #usa #europe #coronavirus #kesfet #türk #tekbayrak #tekvatan #europa #ayyıldıztim #virus #china #nachrichten #yeni #göktürk #türkei #haberler #turkey #sondakika
2231566241552735808; 9; False; 1580243628; How one must prepare to fight the Coronavirus before boarding their flight to China #coronavirus #fightorflight
2231567692253832531; 0; False; 1580243620; Cosas que no le dejan dormir :thinking_face::thinking_face::thinking_face: #coronavirus
2231567661092157644; 0; False; 1580243617; Hi #meme #funny #coronavirus #nike #jordan #nmd #niggamemes #memes #dankmemes #lol #funnymemes #roadto100 #memepages #ripkobe #follow #nice #lbg4l #slimjim #2020 #tiktok
2231567620816380692; 0; False; 1580243612; Tuesday Tips: Drink Modelo to avoid the Coronavirus! :face_with_tears_of_joy::face_with_tears_of_joy: #deardiary #coronavirus #modelotime #funnyisfunny #:woman_facepalming: #corona #hadtoshare #hispanicsbelike #diary #shenanigans #tuesdaytips
2231567584403195105; 2; False; 1580243608; #carnivore #omnivore #coronavirus #govegan #diseases #virus #pandemic #carnivorous #meatismurder #wuhan #china #plantbased #vegan #thefutureisvegan #stopkillinganimals #animalliberation
2231567574697714811; 0; False; 1580243606; Te damos una serie de recomendaciones para reducir el riesgo de contagio de coronavirus por si tienes que viajar a algún país en riesgo de contagio :face_with_medical_mask: :face_with_medical_mask: . . . . . #farmacia #txurdinaga #bilbao #tecuidamos #salud #coronavirus #virus #gripe #who #oms
2231567546914871717; 1; False; 1580243603; As parents, the health and safety of our children is very important to us! We will gladly reschedule play for children and families who are unwell, or have been unwell. Thank you for helping us reduce the risk of spreading germs to others, keeping our children and our community safe. #fluseason #coronavirus :camera:: @real_ris_cave
2231567538540672059; 0; False; 1580243602; Na última semana, tivemos uma avalanche de notícias sobre um vírus que está causando temor na China: o coronavírus. Geralmente, as infecções por coronavírus causam doenças respiratórias leves a moderadas, semelhantes a um resfriado comum. No entanto, alguns coronavírus podem causar doenças graves com impacto importante em termos de saúde pública, como a Síndrome Respiratória Aguda Grave (SRAG). No Brasil, o ministério da saúde suspeita de um caso de uma estudante, de 22 anos, que esteve na China e voltou na última sexta. Saiba mais sobre este vírus no esquema acima. #DrabárbaraBillwiller #Infectologista #Coronavirus #China #Brasil
2231565231557845052; 0; False; 1580243601; #corona #coronavirus
2231567526932069054; 0; False; 1580243601; #shaunofthedead #coronavirus too early?:sneezing_face::grimacing_face::face_with_medical_mask:
2231567518963663909; 0; False; 1580243600; :exclamation_mark:Seitdem der Coronavirus sich stark verbreitet stieg der Bitcoin von 8200 USD $ auf bis zu 9200 USD $.:exclamation_mark::rocket: ... Der Grund für diesen Anstieg ist der Coronavirus. Chinas Bevölkerung kaufte sich in den letzten Wochen seitdem der Virus sich verbreitet, Flüge gestrichen werden, ganze Stadteile gesperrt werden und Touristen das Land so schnell wie möglich verlassen müssen Kryptowährungen, darunter auch am meißten Bitcoin, das erklärt wiederum den Boom von Bitcoin, als der Skandal sich verbreitete das : ,,Bitcoin unsicher ist" und jeder Hacker per Mausklick die möglichkeit hätte auch ihr Wallet leeren zu können weshalb der Preis um 800 USD $ sinkte (pro Bitcoin). :chart_decreasing::chart_increasing::rocket: .. Die Leute setzen auf Kryptowährungen weil sie damit unkompliziert bezahlen können vorallem in einem Kryptowährungs freundlichem Land wie China dort ist es fast überall verwendbar. Vorallem möchte die Regierung eine eigene Kryptowährung einführen. :chart_increasing::rocket::globe_with_meridians::bank: . #Kryptowährung #Krypto #Broker #Trading #Virus #Bitcoin #Corona #Bitcoincash #Litecoin #China #USD #Coronavirus #Bank #Pay #Chinapay #Blockchain #Payment #Stellar #Buy #Sell #method #TRX #XRP #Handel #Markt #Bullrun #Dollar
2231567420405149365; 1; False; 1580243588; #coronavirus
2231567354529036413; 0; False; 1580243580; "O que muda é o grau de vigilância nessa fase. Aumenta a nossa vigilância de portos e aeroportos, triagem de pacientes, o uso de determinado equipamentos de proteção, mas o nosso foco principal nesta fase é a vigilância”, disse Mandetta( Ministro da Saúde ) em entrevista coletiva para falar sobre as medidas tomadas pelo governo para evitar a entrada do vírus no país. . :small_orange_diamond:Devemos ficar atentos a precauções de contato e não há confirmação da doença no Brasil mas apenas de caso suspeito . . :small_blue_diamond:São considerados casos suspeitos , os de pessoas que estiveram em toda a China nos últimos 14 dias e apresentarem sintomas respiratórios, como tosse ou dificuldade para respirar com ou sem febre . . :small_orange_diamond: Como reduzir o risco de infecção pelo novo coronavírus? - Evitar contato próximo com pessoas com infecções respiratórias agudas; - Lavar frequentemente as mãos, especialmente após contato direto com pessoas doentes ou com o meio ambiente e antes de se alimentar; - Usar lenço descartável para higiene nasal; - Cobrir nariz e boca ao espirrar ou tossir; - Evitar tocar nas mucosas dos olhos; - Higienizar as mãos após tossir ou espirrar; - Não compartilhar objetos de uso pessoal, como talheres, pratos, copos ou garrafas; - Manter os ambientes bem ventilados; - Evitar contato próximo com animais selvagens e animais doentes em fazendas ou criações. Nesse momento não há indicação de isolamento , abstenção de aulas e a orientação é que os viajantes evitem a China como destino a não ser que seja algo inadiável. Aguardamos novas orientações do Ministério da Saúde e manteremos informados. . . #coronavirus #saude #medicina #adolescente #saudeinfantil #medicinadeadolescentes #hebiatria #pediatria #brasil #salvador #piaui #alerta #cuidado
2231567197419723249; 6; False; 1580243575; RIGHT NOW! MAXIMUM SHARE! People from Wuhan trying to break out from the quarantine zone! . #coronavirus #coronavirusoutbreak #virus #wuhan #wuhanvirus #coronaviruschina #wuhanchina #corona #coronovirus
2231567303097501479; 0; False; 1580243574; Investigadores de Hong Kong (China) advierten que el nuevo #coronavirus está a punto de convertirse en una epidemia global y estiman que unas 44.000 personas estarían infectadas con ese microorganismo, muchas más de las que sugieren las cifras oficiales hasta el momento.
2231567295816378364; 10; False; 1580243573; A preliminary test has come back positive for the Coronavirus and health officials are confident the results are accurate. A steady increase in worldwide victims has been documented and the death toll inches higher. Government officials are still seemingly optimistic about the overall outlook on curbing the virus but one must wonder how much of that is simply a panic reduction mechanism. ——————————————————————— #coronavirus #wuhanvirus #wuhancoronavirus #coronacanada #coronavirusoutbreak #britishcolumbiacanada #canada:maple_leaf: #canada:Canada: #vancouver_canada #vancouver_ig #vancouver_bc #trudeau #coronaviruses #coronacanada #cdnpoli #cdnnews #canadiannews #canadianpolitics #canadanews #canadapolitics #news #politics #cbc #cp24 #canada #canadian #centrist #canadianpodcast #conservative #liberal #onpoli
2231567269735958039; 1; False; 1580243570; O Coronavírus circula entre nós há anos. É um vírus de transmissão respiratória e via secreções de mucosas (boca e nariz). Mas por que tanto alerta agora? O fato é que a virulência desta cepa de Coronavírus é maior. E, como a China tem uma superpopulação, o espalhamento do vírus é mais fácil. Além disso, o Coronavírus pode ficar incubado, isto é, sem apresentar sintomas em um portador por até 7 dias. Por isso o alerta da vinda de pessoas de países que tenham o Coronavírus nas vésperas do Carnaval! Os sintomas são muito parecidos com os da gripe Influenza: febre alta, tosse, falta de ar, dor no corpo todo, dor de cabeça, secreção nasal branca e, em algumas pessoas, sintomas digestivos como náusea, vômitos e diarreia. O “perigo” é que, como também ocorre na Gripe H1N1, o paciente faz um quadro chamado Doença Respiratória Aguda Grave (DRAG) e precisa muitas vezes de UTI e intubação. Não devemos entrar em pânico, pois ainda não há casos confirmados no Brasil. A Vigilância Sanitária está alerta nos aeroportos, monitorando os voos que vêm da Ásia, principalmente os que vem da China. Os cruzeiros brasileiros não costumam ir nestes territórios, mas os navios já estão alertas e não pararão em portos onde já se tenham notificado casos. De qualquer forma, caso você seja apanhado de súbito por uma gripe grave, coloque uma máscara, separe utensílios pessoais para você, não se automedique e não perca tempo: procure um médico imediatamente. . :butterfly: Dra. Suzanne Pereira CRM-SC 8177 I CRM-PR 16828 :round_pushpin:Clínica INmedi #DraSuzanne #Infecto #Medicina #saude #cuidado #infectologia #infectologista #infecção #coronavirus #virus #gripe #H1N1
2231567240923443770; 0; False; 1580243567; China aumenta la cifra de muertos por el coronavirus a 106. Alemania confirma su primer caso. La Comisión Nacional de Sanidad china ha confirmado, a través de su comunicado diario, que ya son 106 los fallecidos. Y que se propaga por China y otros países. La evolución puede seguirse por la base de datos sobre la epidemia creada por la universidad John Hopkins. Además, el número de casos confirmados a nivel nacional ha aumentado a 4.515. La mayoría de las muertes se han producido en la región de Hubei, el origen del brote, aunque Pekín ya ha registrado su primer fallecimiento. Del total de infectados, 976 están en estado grave y nueve personas han sido dadas de alta, por lo que la cifra de pacientes que han superado la enfermedad sube a 60. En las últimas horas se ha conocido que el ministro de Educación ha decretado sine die la vuelta de los estudiantes a los centros -colegios, institutos, universidades, centros superiores-, que ahora disfrutan de las vacaciones por el Año Nuevo chino. Mientras, ya hay cerca de 6.000 médicos que se han desplazado a Wuhan para controlar la situación. Así lo ha confirmado en una rueda de prensa Jiao Yahui, la subdirectora de la Oficina de Políticas Médicas y Administración de la Comisión Nacional de Sanidad de China. #coronavirus #epidemia #infografia Un artículo de @rtve
2231567108022365412; 2; False; 1580243564; :Turkey:Jamaikada 7.7 büyüklüğünde deprem meydana geldi. Depremin etkisi videoda! :European_Union:A 7.7 magnitude earthquake occurred in Jamaica. Earthquake effect in Jamaica! #clinicalnews #coronavirus #virusoutbreak #corona #health #nursing #nurse #wuhan2020 #wuhanvirus #coronaoutbreak #who #china #doctor #hospital #european #europe #crisis #lastnews #cdc #coronavirus #wuhan2020 #outbreak #usa #earthquake #jamaica #deprem #coronaoutbreak #enfected #coronavirusoutbreak
2231567157882480841; 2; False; 1580243557; What if we put it in rice? #wtf2020
2231567089659084491; 3; False; 1580243553; Follow @coronavirusplague for more :skull: - - - - - - - Z - - Tags- #memes #dank #bruhmoment #wwz #dankmemes #ww3 #coronavirus #lmao #lol #meme #corona #yolo #china #disease #plagues #rofl #dead #explore #bruh #clown #clownmemes #w #haha #lmfao #memed #original #relatablememes #virus #plague #plaguememe
2231567106076592356; 0; False; 1580243551; #meme#memes#dailymemes#funny#coronavirus#bestmeme#bestmemes#bestmemesever #bestmemesdaily #dankmemes #memes:face_with_tears_of_joy: #memez #memepage #memestagram
2231567075583996888; 0; False; 1580243547; #china #coronavirus #sos #wuhan #wuhanchina #wuhanvirus #wuhancoronavirus
2231567057589388227; 7; False; 1580243545; Prevention is key! Washing your hands is the #1 way to prevent the spread of infections. Click the link in bio for more information. :microbe: La prévention est la clé! Se laver les mains est le premier moyen de prévenir la propagation des infections. Cliquez sur le lien en bio pour plus d'informations. #WashYourHands #HandWashing #HealthyOttawa #Ottawa #Ontario #Canada
2231567060156460759; 0; False; 1580243545; Coronavirus mood :face_with_medical_mask: #corona #coronavirus
2231566965900790708; 8; False; 1580243534; Пользуйтесь презервативами, и никакие коронавирусы вам не страшны! . . . . . . . #gay #instagay #coronavirus #condom #banana #instahomo
2231566846138878220; 2; False; 1580243520; :red_heart:︎ * 公園で自由に歩かせると、角っこに行く習性あり:cat_face_with_tears_of_joy: * #noahluikuch #park #centralpark #dartford #dartfordliving #swing #growing #growingupsofast #next #nike #tedbaker #boysfashion #red #redjacket #coronavirus #コロナウイルス #ハーフキッズ #公園#中央公園#ブランコ#風邪#大きくなった#成長#成長早い#毎日更新#イギリス#海外生活#インスタキッズ#ハーフ#クオーター
2231565254373588212; 0; False; 1580243330; :four_leaf_clover: #LIVE #CAM - https://m.yangshipin.cn/static/2020/c0126.html - during the building phase of the specialized #Coronavirus #hospital in #China :China: I wish my friends and colleagues in China all the best in their efforts against the virus :four_leaf_clover:
2231561186862886743; 4; False; 1580242989; Коронавирусы – это большое семейство вирусов, в которое входят вирусы, способные вызывать целый ряд заболеваний у людей – от распространенной простуды до тяжелого острого респираторного синдрома (ТОРС, "атипичная пневмония"), а также воспалительный процесс пищеварительного тракта. На долю коронавирусной инфекции приходится от 4 до 20% случаев всех ОРВИ (острая респираторная вирусная инфекция). Коронавирусы – это микробы сферической формы, содержащие одноцепочечную молекулу РНК (рибонуклеиновая кислота). Они имеют оболочку с редкими шипами или ворсинками, напоминающую корону при затмении солнца. Отсюда и название – коронавирус. Проникая внутрь клетки, коронавирусы размножаются в цитоплазме (полужидкое содержимое клетки). Они оседают на иммунокомпетентных клетках, используют их в качестве транспортного средства и быстро рассеиваются по всему организму. Коронавирусы подавляют иммунитет, и он перестает распознавать инфекцию и бороться с ней. Эти вирусы неустойчивы к действию внешних факторов и мгновенно разрушаются при температуре 56 градусов. #coronavirus #China #wuhan #коронавирус #китай #ухань
2231562281316651169; 0; False; 1580242975; Comunque quest'anno per rendere Sanremo interessante e virale ci vorrebbe un bel caso di coronavirus tra il pubblico in modo che mettono tutti in quarantena: cantanti, superospiti, amadeus e tutto il suo entourage di bagasce. Tutto il baraccone costretto all'isolamento, due settimane di quarantena e canzoni , costretti dalla fame al cannibalismo dopo aver mangiato tutti i fiori dell'Ariston. E l'unico che si salverebbe è Junior Cally, perché è l'unico che si portato dietro la mascherina.#sanremo #28giornidopo #coronavirus
2231558536030498331; 20; False; 1580242538; Bruh:moai::skull: Via.@gosha._.777 :face_with_tears_of_joy::face_with_tears_of_joy: . . . . . . . #funnyposts #memeaccount #cancerousmemes #memesfordays #memelord #memestagram #freshmemes #coronavirus #corona #coronavirusmemes #memecucks #stolenmemes #offensivememes #sub2pewdiepie #cursedimages #cringy #cursedimage #twittermemes #bepis #normiememes #spiceymemes
2231544918208106833; 1; False; 1580240906; Remember to verify the model number is N95 or N99
2231505906867153742; 3; False; 1580236263; F . . . . . . #dankmemes #dank #republican #rod #joker #jokermemes #dankestmemes #pubity #tdpoti #memesdaily#dank #dankmemes #memes #meme #dankmeme #memesdaily #funny #edgymemes #funnymemes #lmao #corona #coronavirus #blackplague
2231388755997077896; 0; False; 1580222290; That's a huge one @pulsenigeria247 . Follow @medicalhangout Follow @medicalhangout . #medicalhangout #nigeriamedicalhangout . #coronavirus #coronavirusoutbreak #coronavirusmemes #coronaviruses #coronavírus
2231247837181239838; 0; False; 1580205527; :face_with_tears_of_joy::face_with_tears_of_joy::face_with_tears_of_joy: Жми :red_heart:Подпишись, цель-50k :backhand_index_pointing_up: не пропусти обновления:clockwise_vertical_arrows: Друзья включайте уведомления о публикациях прям сейчас:raised_fist: @bastards_show @bastards_show @bastards_show @bastards_show @bastards_show #ухань #коронавирус #смерть #вирус #апокалипсис #эпидемия #болезнь #больные #Китай #вирусвкитае #страх #жесть #вакцина #сталкер #опасность #зараженные #прикол #конецсвета #2020 #vine #вброс #здоровье #bastards_show #china #wuhan #coronavirus #virus #epidemic #death #катастрофа
2228751159764825000; 0; False; 1579907864; :flexed_biceps_light_skin_tone::hundred_points: . . . . . . . . . . . . #momos #momazos #momossad #memes #memazos #meme #momo #memeschile #chilememes #crush #love #memesdaily #memesespañol #myheroacademia #crush #miriotogata #coronavirus #megustapormegusta #mgxmg #siguemeytesigo #coronavirus
2196115648694475595; 0; False; 1576017477; Like :thumbs_up:, comment :speech_balloon:, share :paperclip: . . Ramekno Mak :backhand_index_pointing_down::backhand_index_pointing_down: @sofyanajik_96 @bee.fly_id . . :heavy_minus_sign::heavy_minus_sign::heavy_minus_sign::heavy_minus_sign::heavy_minus_sign::heavy_minus_sign::heavy_minus_sign::heavy_minus_sign::heavy_minus_sign::heavy_minus_sign::heavy_minus_sign::heavy_minus_sign::heavy_minus_sign::heavy_minus_sign::heavy_minus_sign::heavy_minus_sign::heavy_minus_sign: Partner :sign_of_the_horns::sign_of_the_horns: :pushpin:@sajak.vidio :pushpin:@creator_budrek :pushpin:@kelangan.mantan_ :pushpin:@yoweskalem_ :pushpin:@setatus_jowo_28 :pushpin:@maido.gratis_id :pushpin:@team_kepyoh_indonesia :pushpin:@ngakakkocak_jowo :pushpin:@yowis.ambyar :pushpin:@kadung.jeru_official :pushpin:@remukan.ati_official :pushpin:@kreator.jowo :pushpin:@kadung.baper_id :pushpin:@_ojo.baper :pushpin:@ojo.sambat :pushpin:@cah.rewel_ :pushpin:@story.wasapp :pushpin:@story.wehaa :pushpin:@wa_stry :pushpin:@maido_penak :heavy_minus_sign::heavy_minus_sign::heavy_minus_sign::heavy_minus_sign::heavy_minus_sign::heavy_minus_sign::heavy_minus_sign::heavy_minus_sign::heavy_minus_sign::heavy_minus_sign::heavy_minus_sign::heavy_minus_sign::heavy_minus_sign::heavy_minus_sign::heavy_minus_sign::heavy_minus_sign::heavy_minus_sign: Tag :raised_fist::raised_fist: #storywa#storywakekinian#vidgram#kinemasterindonesia#dagelan#viavallen#ikingawi#story#balungankere#kartonyonomedotjanji#raffinagita1717#sma#vidgrambaper#selebgram#erlanggagusfian#jokowi#ambyar#didikempot#persebayaday#egaalfariz#kinemastertutorial#munduralonalon#lfl:yellow_heart:#salampreiwongruwet#indonesia#parikanjowo#dagelanvideo#ojobaperan#quotesjowo#coronavirus
2043017970151460551; 5; False; 1557766742; #kobebryantdied in helicopter on #kobebryantcartoon in 2016 also:man_shrugging_medium-dark_skin_tone::thinking_face: #orwell #edwardsnowden #billgates #patent #viral #coronavirus #iran #china NSA #theylive #pedoelitist #epsteindidntkillhimself #orlandobrown #westworld #harveyweinstein #elsagate #oprah personofinterest #theylive #vacinnes humanity #plauge trending #kobebryantconspiracy #metzizahbpeh #pizzagate #pedophilialegalizationmustbestopped #rickygervaise behindthescenes #adrenochrome #lebronjames #humantraffickingawareness #organharvesting 333me.life now since they cancelled my Youtube like they cancelled #issackappy Good job every1 ,I feel so good that I'm dedicating my entire life into Channeling divEYEness, even tho the algorithm suppresses my content:eye::OK_hand_medium-dark_skin_tone:w3 ar3 th3 saviors-take care+stay aware. 333me.life
2040036471634417035; 5; False; 1557411630; #kobebryantdied in helicopter on #kobebryantcartoon in 2016 also:man_shrugging_medium-dark_skin_tone::thinking_face: #orwell #edwardsnowden #billgates #patent #viral #coronavirus #iran #china NSA #theylive #pedoelitist #epsteindidntkillhimself #orlandobrown #westworld #harveyweinstein #elsagate #oprah personofinterest #theylive #vacinnes humanity #plauge trending #kobebryantconspiracy #metzizahbpeh #pizzagate #pedophilialegalizationmustbestopped #rickygervaise behindthescenes #adrenochrome #lebronjames #humantraffickingawareness #organharvesting 333me.life now since they cancelled my Youtube like they cancelled #issackappy Good job every1 ,I feel so good that I'm dedicating my entire life into Channeling divEYEness, even tho the algorithm suppresses my content:eye::OK_hand_medium-dark_skin_tone:w3 ar3 th3 saviors-take care+stay aware. 333me.life
2035407488104018940; 0; False; 1556859502; 333me.life #kobebryantdied in helicopter on #kobebryantcartoon in 2016 also:man_shrugging_medium-dark_skin_tone::thinking_face: #orwell #edwardsnowden #billgates #patent #viral #coronavirus #iran #china NSA #theylive #pedoelitist #epsteindidntkillhimself #orlandobrown #westworld #harveyweinstein #elsagate #oprah personofinterest #theylive #vacinnes humanity #plauge trending #kobebryantconspiracy #metzizahbpeh #pizzagate #pedophilialegalizationmustbestopped #rickygervaise behindthescenes #adrenochrome #lebronjames #humantraffickingawareness #organharvesting 333me.life now since they cancelled my Youtube like they cancelled #issackappy Good job every1 ,I feel so good that I'm dedicating my entire life into Channeling divEYEness, even tho the algorithm suppresses my content:eye::OK_hand_medium-dark_skin_tone:w3 ar3 th3 saviors-take care+stay aware. 333me.life
2035406354962611365; 1; False; 1556859367; #kobebryantdied in helicopter on #kobebryantcartoon in 2016 also:man_shrugging_medium-dark_skin_tone::thinking_face: #orwell #edwardsnowden #billgates #patent #viral #coronavirus #iran #china NSA #theylive #pedoelitist #epsteindidntkillhimself #orlandobrown #westworld #harveyweinstein #elsagate #oprah personofinterest #theylive #vacinnes humanity #plauge trending #kobebryantconspiracy #metzizahbpeh #pizzagate #pedophilialegalizationmustbestopped #rickygervaise behindthescenes #adrenochrome #lebronjames #humantraffickingawareness #organharvesting 333me.life now since they cancelled my Youtube like they cancelled #issackappy Good job every1 ,I feel so good that I'm dedicating my entire life into Channeling divEYEness, even tho the algorithm suppresses my content:eye::OK_hand_medium-dark_skin_tone:w3 ar3 th3 saviors-take care+stay aware. 333me.life#humantraffickingawareness #organharvesting 333me.life now since they cancelled my Youtube like they cancelled #issackappy Good job every1 ,I feel so good that I'm dedicating my entire life into Channeling divEYEness, even tho the algorithm suppresses my content:eye::OK_hand_medium-dark_skin_tone:w3 ar3 th3 saviors-take care+stay aware. 333me.life
1984438595135372656; 0; False; 1550783685; 1st actual coherent collection #kobebryantdied in helicopter on #kobebryantcartoon in 2016 also:man_shrugging_medium-dark_skin_tone::thinking_face: #orwell #edwardsnowden #billgates #patent #viral #coronavirus #iran #china NSA #theylive #pedoelitist #epsteindidntkillhimself #orlandobrown #westworld #harveyweinstein #elsagate #oprah personofinterest #theylive #vacinnes humanity #plauge trending #kobebryantconspiracy #metzizahbpeh #pizzagate #pedophilialegalizationmustbestopped #rickygervaise behindthescenes #adrenochrome #lebronjames #humantraffickingawareness #organharvesting 333me.life now since they cancelled my Youtube like they cancelled #issackappy Good job every1 ,I feel so good that I'm dedicating my entire life into Channeling divEYEness, even tho the algorithm suppresses my content:eye::OK_hand_medium-dark_skin_tone:w3 ar3 th3 saviors-take care+stay aware. 333me.life
740147593158071546; 15; False; 1402452490; Kim Jong ill as f&¡* #newsound #chinaszn
2231567006149379555; 0; False; 1580243539; #coronavirus
2231566955047569880; 0; False; 1580243533; #coronavirus #earthquake #tsunami IF we CLAIM to be Muslim, Christian, Jew, in Scriptures we are Warned God uses the FORCES of Nature to Chastise & Destroy nations. Then HOW in the HELL did we let Satan and his agents (#preachers, #reporters, #politicians, #meteorologists, #seismologists) :trick us into thinking God is too powerless to stop the destruction that is happening around the world?:thinking_face: Have You Ever Considered That God is The One Who ORDERED it? Since The Bible Warns us satan will deceive us About God, Have you Considered Exactly WHAT about God will he try to deceive us about? When we turn on the #fakenews, lying weather people blame #Mothernature and "weather patterns" when They KNOW Who is causing #rain, #hail, #snow, and #Earthquakes. God, #MasterFardMuhammad, #Christ, The #HonorableElijahMuhammad and Their Representative, Messiah #LouisFarrakhan with the 7 Angels are causing ALL the destruction we face at this very moment.:face_with_open_mouth: Hell, they even name the storm systems "El Nino". Did you know El Nino is Spanish for The Christ Child?:shushing_face: Ask ANY so called #seismologist/#preacher/#weatherman IF what we are saying is true or not.:face_with_raised_eyebrow: PUT IT TO THEM and MAKE them answer the question. Send them THIS Post. And IF they say that it is not true, WATCH what God does in their cities.:high_voltage::cloud_with_lightning::fire::fire::high_voltage::cloud_with_lightning: They may never get another #weatherforecast right again. They will forcast snow and it will be 75 degrees, in the WINTER. Because to call Elijah Muhammad or Farrakhan a liar is to call God a liar.:zipper-mouth_face: Let us MAKE THEM TELL THE TRUTH. ASK Them about Messiah #Farrakhan warning of A MAJOR Earthquake (11.0 to 13.0) destroying MANY Cities in America. He warns LARGE #tornado will hit #Chicago/ #LosAngeles Christ warns ALL the coastlines will be DESTROYED Yet these AGENTS of SATAN :face_with_symbols_on_mouth: got you worried about carbon gasses?:neutral_face: Are we really that cowardly where we wont read Revelation and SEE that EVERYTHING they are blaming on climate change God ordered His servants to do? In the Bible God didn't bring those Plagues Moses and Aaron did. To the People of #Australia, The ONLY WAY to STOP The Plagues is to PRESS Your Leaders to Contact #LouisFarrakhan
2231566929236033097; 0; False; 1580243529; #Coronavirus is a threat, but did anyone catch #NAMMthrax after the convention was over? Here’s a #Dimebash image by @roqnpix. More coming soon in our next issue. #NAMM #NAMM2020 #NAMMshow #ChrisBroderick #Kyng #KyngBand #DimebagDarrell
2231566885663875611; 0; False; 1580243524; A semana começou mal para as bolsas do mundo todo. O avanço do coronavírus na China durante o fim de semana colocou os mercados de molho nesta segunda. Já foram confirmados quase 3 mil casos em mais de dez países, sendo a maioria deles na China. Os investidores esperam que a epidemia afete o crescimento econômico chinês neste ano, ao levar à restrição da circulação de pessoas e mercadorias. Consequentemente, a economia mundial - e as companhias brasileiras que exportam para o gigante asiático - também devem ver impactos negativos. Com isso, as bolsas caíram ao redor do mundo. O Ibovespa despencou e, depois de ter batido um novo recorde de alta na semana passada, perdeu os ganhos do ano. Agora, o índice tem desempenho negativo de 1,01% em janeiro. Já o dólar fechou acima de R$ 4,20 e viu avanço no mundo todo, já que os investidores buscam a segurança da moeda americana em meio à incerteza. O índice de volatilidade VIX, conhecido como “índice do medo”, disparou 25% só no pregão de hoje. Esse salto na aversão ao risco se deve à percepção de que o coronavírus está se espalhando num ritmo mais veloz que o esperado — os esforços globais para conter a doença parecem não estar surtindo muito efeito. A cautela atingiu especialmente as ações de empresas do setor de commodities e que exportam para a China. É o caso de Vale ON (VALE3), que caiu 6,12%; CSN ON (CSNA3), em baixa de 7,78%; Gerdau PN (GGBR4), com perda de 7,94%; e Usiminas PNA (USIM5), recuando 7,12% Os papéis da Petrobras também caem forte acompanhando o recuo das cotações internacionais do petróleo. As ações ON da estatal (PETR3) fecharam em queda de 4,21%, enquanto as PNs (PETR4) têm baixa de 4,33%. Por enquanto há uma leve ‘’contaminação’’ porém acreditamos que a médio e longo prazo não surtirá tanto efeito* *Trecho adicionado B3dadepre Fonte: Seudinheiro #coronavirus #china #ações #rendavariavel #rendafixa #bolsadevalores #b3 #eua
2231566730585539477; 6; False; 1580243523; Reposted from @mofriswombrineso :pile_of_poo::pile_of_poo::pile_of_poo::pile_of_poo::pile_of_poo::pile_of_poo::skull_and_crossbones::skull_and_crossbones::skull_and_crossbones::skull_and_crossbones::skull_and_crossbones::skull_and_crossbones::face_vomiting::face_vomiting::face_vomiting::face_vomiting::face_vomiting:Posted @withregram • @anetek_30001 Posted @withregram • @blingblingbitch8888_888 What is that? Posted @withregram • @coronavirus.china.news Одна из версий почему вирус начал распространяться. В рационе были дикие животные ! One version of why the virus began to spread. There were wild animals in the diet! #китайвирус #коронавирус #китайухань #вирускитай # #wuhanvirus #coronavirus #коронавирускитай #coronaviruses #coronavirusoutbreak #wuhan #chinafood #viruswuhan - #regrann
2231566862135518845; 0; False; 1580243521; Kedi köpek v.b dostlarınızla çocuklarınızın arasına mesafe koymayın!!!!! Www.probitotikli.com #probiyotikli #probiyotik #coronavirus #corona #veteriner #benimkedim #hijyenik
2231566768577846584; 0; False; 1580243510; Pinched from @thatrainbowvegan :red_heart: #coronavirus #carnivorous #stopeatingflesh #idiots #govegan #plantbasedforyourhealth
2231566750414247256; 0; False; 1580243508; Hoy os dejamos unos consejos y métodos de prevención frente al #coronavirus de Wuhan. Gracias por los consejos @micofvlc :white_heart: #nosgustacuidarte #farmaciaortopediadelarambla
2231566253164921719; 1; False; 1580243500; On the latest episode of the Dark To Light Podcast, Frank and Beanz question the timing of the #JohnBolton book and the entire situation, the #Coronavirus, Andrew McCabe, and more (link to episode in bio) #podcast #podcasters #podcastersofinstagram #politics #impeachment #trump #donaldtrump
2231566427159212716; 0; False; 1580243496; qwqewewwew @coronavirusu . . . . . . . . . . . . . #corona #coronavirus #cin #çinvirüsü #chinese #wuhan #coronavirus #cin #çinvirüsü#chinese #coronaviruses#coronatedavisi
2231566547745372963; 8; False; 1580243484; Sežereme zadkem celé umyvadlo @lukyn_r :heart_suit: . . . . . . . . . . . . . . . . . . #prague #prague:Czechia: #praguegirl #czechgirl #czechrepublic #czech #girl #likeforlikes #like4likes #likeforfollow #likeforlikeback #liketime #mirrorselfie #mirror #mirrorpic #photography #2020 #2020goals #coronavirus :rolling_on_the_floor_laughing::face_with_tears_of_joy::red_heart:
2231566537580642315; 1; False; 1580243483; Our most heartfelt sympathies go to China and the other countries that have been infected. The Coronavirus has NOW reached the US. I have made UTouch available to at a reduced cost for the public while my supplies last. Visit the website at teqtouch.com
2231566382565706489; 1; False; 1580243464; Another dumbass like me :alien:
2231546270886259498; 6; False; 1580243464; Me: Is there coronavirus on my face? Stock Market: Nope. You’re good. . Looks to me like it’s the last week before the market drops :chart_decreasing: . :triangular_flag: Completely overbought. :triangular_flag: #coronavirus numbers are only going to get worse. :triangular_flag: supply chains will be disrupted for months. :triangular_flag: a crazy old socialist looks primed to win Iowa and New Hampshire. :triangular_flag: federal budget deficit to eclipse one trillion dollars. :triangular_flag: Dow to 30,000 felt like a pump :triangular_flag: 2020 Q1 consr spending :thinking_face:...:thumbs_down_light_skin_tone: :triangular_flag: Iran still hates us a lil bit :triangular_flag: Bitcoin and gold going for a run :triangular_flag: Boeing... :grimacing_face: All in my opinion, and not financial advice... $SDOW, $TECS, $RWM, $TWM . . . . #pumpanddump #stockmarketnews #investing #trading #daytrading #buy #sell #apple #tech #techstocks #cloud #amazon #microsoft #iowacaucus #iowa #newhampshire #trump #trump2020 #bitcoin #gold #bitcoincash #frenchbulldog #followback #dogsofinstagram #frenchiesofinstagram #dueyourownduedilligence #icouldbewrong #timewilltell
2231566358062256478; 0; False; 1580243461; Preguntas más frecuentes sobre el coronavirus. Ministerio de Sanidad #coronavirus #farmaciajulietadelamorena
2231566335916299495; 6; False; 1580243459; One ting bout #Jamaican people. We nah dead sad cause from day #Coronavirus, #Earthquake and now #Tsunami Cyaa compete with our memes
2231566330279682246; 0; False; 1580243458; Se presume que este virus dio como inicio en un mercado de pescados y animales silvestres de Wuhan, donde se encontraban serpientes vivas, tortugas, ratas de bambú, erizos, nutrias, etc. y NO ES LA PRIMERA VEZ que surge una epidemia por culpa de estos tipos de mercados. #consumedemaneraresponsabl #coronavirus #wuhan #virus #maltratoanimal #freecluelty #vegan
2231566324257967166; 0; False; 1580243457; What a great day for the mortgage industry!:partying_face::partying_face: Interest rates were slowly creeping up and correcting themselves after the China-Trade War phase 1 kicked in. Although, with the new up and coming deadly Corona Virus the public is shaking in their boots and moving their money from the stock market to safer bets like bonds. We had a quick drop in the 10 year bond resulting in lower rates. Many analyst think it was an overreaction to the stock market but we have a 24-48 hour window to capture some low mortgage rates. Today is the day if you are really thinking of saving money! #interestrates #rates #bond #bullmarket #mortgagerates #lower #coronavirus #coronavirusoutbreak
2231566288002733472; 2; False; 1580243453; Le pire des virus c'est le racisme systémique！ #JeNeSuisPasUnVirus #coronavirus #RacismeAntiAsiatique
2231566280033255838; 4; False; 1580243452; Atenção para o compartilhamento de @carolmarcospediatra :face_with_monocle: sobre o #coronavirus
2231566254649265650; 0; False; 1580243449; January 2020:expressionless_face::folded_hands: #fail #followforfollowback #funnymemes #funny #fun #memesdaily #meme #memes #ww3memes #worldwar3memes #chinamemes #coronamemes #coronavirus #coronavirusmemes #allstarmemes #australiamemes #australia #phillipines #phillipinesmemes #donaldtrumpmemes #2020memes #2020 #january #januarymemes
2231566246034068818; 0; False; 1580243448; foto de como eu queria estar. e como eu estou? aqui, fazendo pesquisa sobre o #coronavirus ! O mais importante nesse momento é não se desesperar. :black_small_square: Quer se informar? Procure alguma fonte segura, como por exemplo, os grandes portais de notícias! Já estão circulando via WhatsApp mensagens cujo objetivo é apenas criar sensacionalismo e uma sensação de pânico na sociedade.
2231566032677849902; 9; False; 1580243443; Follow @coronavirusplague for more :skull: - - - - - - - Z - - Tags- #memes #dank #bruhmoment #wwz #dankmemes #ww3 #coronavirus #lmao #lol #meme #corona #yolo #china #disease #plagues #rofl #dead #explore #bruh #clown #clownmemes #w #haha #lmfao #memed #original #relatablememes #virus #plague #plaguememe
2231566183638201735; 0; False; 1580243441; :red_circle:Almanya'da 3 yeni Corona Virüsü vakası tespit edildi. @news.fromthere #breakingnews #sondakika #news #coronavirus
2231563670655338885; 3; False; 1580243440; @Jb won’t let me redo this video even though my gum looks like an extra tooth. :face_with_symbols_on_mouth: Tune in today to get the scoop on things like the #coronavirus and the #zebramussels , yeah those are coming back. Get the app Austin 360 Radio or turn up the radio at statesman.com @statesman or Austin360.com @austin360 or hookem.com!! #austintexas #austin #keepaustinweird #stayinalive #austinnews #localstories @glamerdoc @whitney_stropp
2231558435678534834; 12; False; 1580243432; :eyes: closely! leave your thoughts below :thinking_face: . . Follow @jrueiam @dontfollowbravo & @slewiee Liquor :electric_plug: @top_hill_liquor_market . . #whatdoyouthink #liqourstore #prank #whiteclaw #mexican #white #stolenmemes #stealing #redbull #whiteandnerdy #leftalone #allbymyself #follow #tag #like #explorerpage #share #crazyvideos #anactorprepares #performingarts #huntingtonbeach #hilltopliqour #shoplocal #beer #corona #modelo #coronavirus #seltzer #weirdmemes
2231566105799982231; 0; False; 1580243431; Las autoridades del aeropuerto de Miami dijeron que desde el 17 de enero, el Centro de Control y Prevención de Enfermedades (CDC por sus siglas en inglés), comenzó a implementar exámenes de salud pública en los aeropuertos de San Francisco (SFO), Nueva York (JFK) Atlanta (ATL), Chicago (ORD) y Los Angeles (LAX), lugares a dode llegan a los Estados Unidos, todos los vuelos desde la zona afectada en China. Miami Mundo / Univisión “Dado que Miami no tiene vuelos de conexión sin escalas o regulares programados desde esa región de China, no es necesario ninguna acción por el momento”, dijo en un comunciado Indira Almeida-Pardillo, vocera del aeropuerto de Miami. Sin embargo, el CDC de Florida, ya cuenta con una estación de cuarentena para vigilar las enfermedades de transmisión de importancia para la salud pública. . @miamimundonews . #aeropuerto #Miami #estación #cuarentena #coronavirus #MiamiMundo
2231566105381838033; 2; False; 1580243431; . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . #memesdaily #memeslmao #memeslol #memes #meme #dailymemes #meandtheboys #dankmemes #dank #viralmemes #funnymemes #xds #xd #clown #spookyseason #calcium #science #joemama #nonutnovember #boomer #babyyoda #cybertruck #nostalgia #christmas #2020 #ww3 #worldwar3 #coronavirus
2231565921099910129; 0; False; 1580243429; China is scrambling to build a 1,000-bed hospital in just 10 days as authorities grapple with the spiralling outbreak of a virus that has left at least 41 dead, and infected hundreds of others. @thebuzzermedia . . . . . . . . . . . . . . . . . . . . #china #chinavirus #coronavirus #coronavirusoutbreak #beijing #instadaily #instafit #pakistanbloggers #pakistan #lahore #karachi #buzzermedia #videooftheday
2231566062827041146; 0; False; 1580243429; La vitamina B6 es vital para soportar reacciones bioquímicas en el sistema inmune. http://ow.ly/CpZr50y6Q5X #puroestadofisico #vitaminab6 #coronavirus #virus #bacterias #infecciones #salud #saludfisica #bienestar #sistemainmune #sistemainmunologico
2231566003309138758; 0; False; 1580243422; #Internacional - El Gobierno chino aceptó que la Organización Mundial de la Salud (OMS) envíe expertos internacionales lo antes posible para que colaboren en la lucha contra el coronavirus, anunció este martes la entidad sanitaria. Su presidente, Tedros Adhanom Ghebreyesus, se reunió con el presidente chino, Xi Jinping, con quien llegó a la conclusión de la conveniencia de que especialistas de otros países puedan contribuir a entender mejor ese brote epidémico, del cual todavía muchos aspectos se desconocen. Xi y Tedros también debatieron cuestiones claves de su colaboración frente a esta emergencia sanitaria, como la necesidad de que China siga compartiendo información y material biológico con la OMS. De igual modo se abordaron las medidas de contención requeridas en Wuhan, la localidad donde apareció la enfermedad, y en otras ciudades y provincias de China, así como la necesidad de continuar con los estudios que permitan entender la gravedad y la transmisión del virus. «Estas medidas ayudarán a una comprensión científica del virus y a desarrollar contramedidas, como tratamientos y vacunas», señaló la OMS en un comunicado emitido por su sede en Ginebra. Tras reunirse con el líder chino, Tedros recalcó la «seriedad» con la que China está tomando este brote y la transparencia que han demostrado las más altas autoridades del país, entre otras cosas entregando información sobre la secuencia genética de un virus que hasta ahora se desconocía en el ser humano. Síguenos a través de: Instagram: @elorientaldemonagas Youtube: El Oriental De Monagas Facebook: Diario El Oriental Twitter: @elorientalmon #OMS #Gobierno #China #Expertos #Coronavirus #Virus #Wuhan #Neumonia
2231565032513300037; 0; False; 1580243421; Terzo aggiornamento sullo stato dell' #emergenzasanitaria in #cina #coronavirus #nopanic #informazione #news #wuhan #virus #epidemia
2231565998484655335; 1; False; 1580243418; Bruh :unamused_face: this virus is making my wanna stay inside. It spread to Germany :Germany: now. Also has moved to Europe. . . . . . . #news #newsoftheday #viral #usa #uk #london #german #germany:Germany: #germany #virus #viral #postoftheday #picoftheday #pictureoftheday #viralnews #coronavirus #spreadtheword #spread #disease #ffs #europe #china #likeforlike #comment #share #2020 #explore #explorepage #trending #trend #trendingnow
2231564789082457068; 0; False; 1580243415; Кто досмотрел?:see-no-evil_monkey::see-no-evil_monkey::grinning_face_with_smiling_eyes: Сладких снов:beaming_face_with_smiling_eyes: Жми :red_heart:Подпишись, цель-50k :backhand_index_pointing_up: не пропусти обновления:clockwise_vertical_arrows: Друзья включайте уведомления о публикациях прям сейчас:raised_fist: @bastards_show @bastards_show @bastards_show @bastards_show @bastards_show . . . . . #ухань #коронавирус #смерть #вирус #апокалипсис #эпидемия #болезнь #больные #Китай #вирусвкитае #страх #жесть #вакцина #сталкер #опасность #зараженные #прикол #конецсвета #2020 #vine #вброс #здоровье #bastards_show #china #wuhan #coronavirus #virus #epidemic #death #катастрофа
2231565928256413251; 1; False; 1580243412; Internacional - Francia enviará un primer avión este miércoles a China para evacuar a los primeros franceses de Wuhan, la región en la que se originó la epidemia del coronavirus, indicó este martes el secretario de Estado de Transportes, Jean-Baptiste Djebbari. En una entrevista al canal «CNews», Djebbari explicó que en ese primer avión, que debería estar de vuelta en Francia el jueves, viajarán personas sin síntomas de enfermedad, que a su llegada serán puestas en cuarentena durante 14 días, que es el periodo de incubación del virus. Luego habrá un segundo vuelo con personas con síntomas, en una fecha todavía por determinar, que serán objeto de un tratamiento médico al aterrizar en Francia. Para mayor información, te invitamos a ingresar en el link de nuestro perfil. #Francia #Wuhan #Coronavirus #NoticieroVenevision #Venevision #28Ene
2231565890858742012; 1; False; 1580243406; Yes please? :folded_hands::purple_heart: . . . . . . . #coronavirus #china #wildlife #virus @chinadailynews @plantbasednews #vegan #conservation #savetheplanet
2231565487618694750; 10; False; 1580243403; HAHA :face_with_tears_of_joy: #corona . . . . @afghan_insta_one_official @afghan_insta_one_official @afghan_insta_one_official . . . . Follow me . . #afghani #afghan #afghans #afghangirl #afghanboy #afghansong #afghanboys #afg #kabul #farsi #hazara #afghanstyle #desi #afghanartist #afghanclothes #afghanjoke #afghancuple #afghanculture #afghanfunny #afghansong #afghansinger #iran #persian #afghanstyle #style #watandar#picoftheday#watandar#tiktok #afghantiktok#tiktokindia#coronavirus
2231565786413953674; 3; False; 1580243393; This is exactly what I've been thinking! #billgates #gatesfoundation #coronavirus #coronavirusoutbreak #manmadevirus #event201
2231565781715836041; 0; False; 1580243393; :winking_face_with_tongue::winking_face_with_tongue::winking_face_with_tongue: . . . . . #coronavirus #coronavirusoutbreak #coronavirusmemes #virus #chinavirus #coronavirusoutbreak #boss #ceo #employee #employeelife #corona #coronabeer #beercorona #beer #beerstagram #beertography #sickandtired #sick #excuses #relax #relaxing #keepdrinking #justdrink #drinking #manager #managerlife #entrepreneur #entrepreneurlife #sickday #efthyquote
2231565717289834094; 0; False; 1580243385; NO. take them back #coronavirus #explorepage
2231565687948733882; 0; False; 1580243381; #coronavírus#coronavirusmemes#coronaviruse #coronavirusoutbreak #coronaviruschina #coronaviruswuhan #coronavirusprevention #coronavirusupdate #coronavirus2020 #coronavirusoutbreak2020 #coronavirusmeme #coronavirüsü #coronaviruses #coronaviruschino #coronavirusaustralia #coronavirusinfection #coronavirusdewuhan #coronavirusindonesia #coronavirus #coronavirusu #coronavirusfrance #coronavirusawareness #coronavirüs #coronavirusnews A furia di scoparti il gatto del vicino cinese per beccarti la peste ma ti becchi solo il Corona virus. ~noot noot
2231565616176104455; 0; False; 1580243373; O Brasil está em perigo iminente para a circulação do coronavírus. Este vírus, que surgiu na China, já foi registrado em outros países, como os Estados Unidos. No Brasil, até o momento, há apenas um caso suspeito da doença, em Minas Gerais. A paciente está em observação e passa bem. ⠀ Confira mais informações sobre o coronavírus nas imagens. ⠀ #coronavirus
2231565537633378874; 2; False; 1580243364; ПОДВЕШЕННОЕ СОСТОЯНИЕ Мало приятного в происходящем сейчас здесь. Уж что что, а попасть в карантинный режим, к такому, как говорится, жизнь не готовила. Я очень привыкла к тому распорядку дня, который у меня устаканился, а пятый день без работы выбивает из колеи, и приходится перестраиваться. Абсолютно не нравится неопределённость, что будет дальше? когда всё станет на свои места? Но естественно никакой паники и во всём ищу позитив, плюсы и радуюсь мелочам Як у нас кажуць "усё будзе добра!" ..... Але толькі калі :thinking_face: #positivethinking#china#hainan#nostress#coronavirus#Sanya
2231565504722877858; 0; False; 1580243360; #corona #CoronaFlu #CoronaVirus #CoronaVirusOutbreak
2231565352494936712; 0; False; 1580243341; Coronavírus - Entenda e tire suas dúvidas! #coronavirus #saude #prevencao #cuidedevocê #fiqueligado #esdevasaude #dicas #coronavirusprevention
2231565259374928524; 0; False; 1580243330; La única y mejor forma de prevenir la influenza estacional es vacunarse todos los años, pero los hábitos saludables como cubrirse la boca al toser y lavarse las manos pueden ayudar a detener la proliferación de gérmenes y prevenir esta enfermedad; siempre es buen conocer las medidas que debe tomar para protegernos y proteger a otros de la influenza y detener la propagación de esta y otras patologías que puedan afectar nuestra salud. . | #farmacia #farmacias #salud #medicamentos #medicamento #belleza #pagodeservicios #bienestar #santiago #santiagodeloscaballeros #calidad #servicio #domicilio #seguro #seguromedico #pagocontarjeta #delivery #whatsapp #marykay #bella #belleza #piel #flu #influenza #coronavirus
2231565233252395516; 0; False; 1580243327; *DO'A BERLINDUNG DARI PENYAKIT BERBAHAYA*⁣ ⁣ اللَّهُمَّ إِنِّي أَعُوْذُ بِكَ⁣ ⁣ ALLAHUMMA INNII A’UUDZU BIKA⁣ Ya Allah, aku berlindung kepada-Mu⁣ ⁣ ⁣ ⁣ مِنَ الْبَرَصِ وَالْجُنُوْنِ⁣ ⁣ MINAL BARASHI WAL JUNUUNI⁣ Dari penyakit belang dan gila⁣ ⁣ ⁣ ⁣ وَالْجُذَامِ وَمِنْ سَيِّئِ الْأَسْقَامِ⁣ ⁣ WAL JUDZAAMI WA MIN SAYYI-IL ASQOOMI⁣ Dan kusta, dan dari segala penyakit yang buruk/mengerikan lainnya⁣ ⁣ ⁣ Artinya:⁣ ⁣ “Ya Allah, aku berlindung kepada-Mu dari penyakit belang, gila, kusta, dan dari segala penyakit yang buruk/mengerikan lainnya.”⁣ ⁣ (HR. Abu Dawud 1554)⁣ ⁣#coronavirus #virus #viruscorona
2231565223066783041; 2; False; 1580243326; Throughout my life I've been around so many people and so many cultures, but nothing beats Chinese my love for Chinese people. They are so warm and welcoming,kind and caring, and my favorite thing about China is the way of greeting, it's always followed by the term "你吃饭了吗" which means have you eaten?... I find it really cute that someone cares that much... Another thing I love is how hardworking they are, in China business means business,everyone works wholeheartedly and it's beautiful to watch. I love their respect for time, Never late always early, even an hour early, "African time" could learn a thing or two from that. But most importantly they are so helpful. It's crazy how a stranger you meet on the street could help you with almost anything, Something as simple as asking a stranger "which side is the library",and that person would literally drop everything and walk you there even if it takes them 20 minutes.... I could go on all day about my love for China and it's people. SO I ASK OF YOU TO PLEASE KEEP CHINA IN YOUR PRAYERS. THE COUNTRY THAT GAVE US A SAFE PLACE FOR STUDIES, WORK AND BUSINESS. 加油中国， 加油武汉 :red_heart::China::China::China::China::China::China: #prayforchina #prayforwuhan #qingdao #china #coronavirus
2231565216399686797; 0; False; 1580243325; That's weird,I just found out about this ,its apparently been happening more frequently in the last years ,is the Earth cooling or warming ? Just a thought :thinking_face: #florida #floridasnow #globalcooling #globalwarming #climatechange #coconutcreekfl #haarp #wuhan #geoengineering #coronavirus #kobebryanthelicoptercrash #conspiracy #money
2231565202145760905; 1; False; 1580243324; Influenza was bad enough, not taking any chances with corona virus. Sorry Kali you will get the contents in about six months haha #coronavirus #nogermshere #howlongdoesitlive #lysoleverything #RunGermsRun
2231565203118789650; 8; False; 1580243324; E assim começa o apocalipse zumbi #zumbi #coronavirus
2231565192314180145; 0; False; 1580243322; #Repost @minsaude (@get_repost) ・・・ #NovoCoronavírus | O Brasil tem grande capacidade técnica para apoiar o mundo na produção de vacinas. Hoje, o ministro da Saúde, @henriquemandetta, garantiu que o país será parte do movimento mundial em busca de vacina contra o novo coronavírus. Saiba mais sobre a doença em saude.gov.br/novo-coronavirus #coronavirus #sus #vigilância
2231565116699300635; 129; False; 1580243313; Y’all ain’t gettin us with that #coronavirus shiiiiiiiiidddd! Damn people was eating #Bats? #superbowl travels #Miami @getup @sportscenter @espn @firsttake @anaturalqt
2231565092332313135; 4; False; 1580243310; #coronavirus :heavy_heart_exclamation:
2231565033215629903; 1; False; 1580243306; Looking for additional tips on how to protect yourself from viruses check-out our blog post where we give our top 5 tips: https://rearz.ca/blog/5tips-to-prevent-illness #coronavirus #rearz #rearzdiapers #incontinence
2231565007362040815; 0; False; 1580243300; Mantenerse en calma y tomar medidas de prevención es la mejor forma de estar sanos. #PrevencionEsSalud #CoronaVirus
2231564993353439500; 0; False; 1580243299; El coronavirus: más de 4500 casos y aún no sabemos cómo se contagia. Link en la Bio. Síguenos en @centralweb.cl #china #coronavirus #epidemias #salud
2231564947989589090; 1; False; 1580243293; " Trojan virus " digital work - Rilievo 20.20 - Forza Cina ! #art #artist #artoftheday #artsy #coronavirus #creative #draw #drawing #gallery #graphic #graphics #illustration #instaart #instaartist #instagood #masterpiece #paper #virus #pencil #photography #photooftheday #picture #sketch #sketchbook
2231562101641795045; 0; False; 1580243290; ⁣ repost#corona #coronavirus #wuhancoronavirus #viruscorona_vsantioksidan⁣ .⁣
2231564886339763016; 0; False; 1580243286; :moon_viewing_ceremony::red_envelope::Japanese_dolls::tanabata_tree::pensive_face: #coronavirus #virus #coronavirus #chinese #china #chineseyear #art #artistsoninstagram #artwork #artists #instadraw #instadrawing #drawingpencil #drawing_pencil #draw:artist_palette: #drawingoninstagram #drawing2me #draweveryday #drawdrawdraw #drawingday #drawings #drawing #draws #drawart #drawing_pencile #draw #drawingbyme #drawing:artist_palette: #drawing:pencil:
2231564854666362925; 0; False; 1580243282; 昨天， 我前腳才踏進教室， 日本同學馬上就跟我問起兩個禮拜前回北京的中國同學， 日本同學憂心的表示， 中國同學會不會也染上疾病或是把病毒帶回來， 我回： 我覺得他出不了境的機率比較大，而且你應該擔心的不是他，而是其他可能的傳染媒介。 語畢，我赫然發現， 其他的東歐同學對武漢肺炎的消息完全不知情:face_screaming_in_fear:。 #coronavirus #武漢肺炎
2231564838594128567; 1; False; 1580243280; Our most heartfelt sympathies go to China and the other countries that have been infected. The Coronavirus has NOW reached the US. I have made UTouch available at a reduced cost to the public while my supplies last. Visit the website at teqtouch.com
2231564689534954213; 0; False; 1580243262; #eilmedlung #breakingnews #coronavirus #bayern #deutschland via @tagesschau
2231564648355341362; 1; False; 1580243258; #art#artofthedayl#rapido#urbain#paris#parisien#Street#streetart#artcontemporain#streetlife#streetstyle#draw#dessin#femmes#homme#Fashion#Graffitis#life#collection#voilà#bonnechance #fdj#amigo #coronavirus
2231564636989430342; 0; False; 1580243256; Episode 25 of O's Odyssey Podcast is up and kicking off #BlackHistoryMonth early:double_exclamation_mark: As we head into Black History Month, it seems more than appropriate to kick things off with the recipient of Spectacular Magazine's Emerging Leader in Tech Award and Founder of T.H.E. Founder Project, Tarryn Henry. In 2018. she spent four months in #Antigua and while she encountered a few challenges, she overcame them and shares her experiences with us. In addition to her time in Antigua, she also shares the way to cure sleepiness during long road trips. Please send any travel related questions you have to 'asksardines@gmail.com' or find us on IG, Facebook and Twitter. #SardinesLLC Thanks for listening! #AmericanUnderground #Introverts #BlackFounders #WomenInTech #Sunburn #MarchingBand #Coronavirus #Skittles #RDU #PHX #LAX #Hopper #BlackPodcasts #Podcasts #MediaTakeOut #Tattoos #Roti #FoodTourism #Carnival #Mas #Myst
2231564517333420006; 1; False; 1580243251; Savage :loudly_crying_face:
2231564533759847332; 1; False; 1580243244; That’s what happens when you eat cats dogs and bats:man_shrugging_medium_skin_tone: * Follow:face_with_tears_of_joy::backhand_index_pointing_right_medium_skin_tone: @nothin_but_laughs2 @nothin_but_laughs2 @nothin_but_laughs2 @nothin_but_laughs2 @nothin_but_laughs2 @nothin_but_laughs2 * #ohnah #wtf #memes #funnymemes #hoodmemes #deadasf #lmfao #spongebobmemes #coronavirus #china #memesdaily
2231563764205639629; 0; False; 1580243243; MEDIDAS DE PRECAUCIÓN.. #coronavirus #ecuador:Ecuador:
2231564393175755736; 1; False; 1580243241; #🅽:O_button_(blood_type):🆃🅸🆅🅸🆂🅸:O_button_(blood_type):🅽365 || Un video de #Wuhan que muestra a las personas infectadas con el #coronavirus. En el video podemos ver pacientes tratando de romper una ventana y escapar de la sala de cuarentena. . . . #28ene #coronarvirues #CoronaOutbreak #ChinaVirus #WuhanCoronavirus #coronavirus #coronavirusoutbreak #corona #wuhan #wuhanchina #wuhanvirus #wuhanvirusoutbreak #wuhanoutbreak
2231564064518136211; 0; False; 1580243239; ohoh FOLLOW (@fenatives) For Your Daily Meme Fix! - #meme #memes #funny #dankmemes #fame #funnymemes #lol #explore #humor #like #follow #lmao #dankmeme #edgymemes #offensivememes #anime #love #comedy #dailymemes #edgy #fun #memestagram #funnymeme #instagram #jokes #tiktok #ol #haha #coronavirus #corona
2231564481941851916; 1; False; 1580243238; Link in Bio Scared of the new deadly CoronaVirus?:exploding_head: Get your protective suit today and help prevent the spread of this mankind killing virus! Type 5/6 overalls. Disposable coveralls with hood, elastic cuffs, back and ankles. 1-way zip at front with 1-ply stormflap. Made from 55gsm SMS (spunbond, microporous spunbond) material with inside stitching. For noxious dust and splash. Ideal for dry particulate barrier and repellency. Lightweight and breathable. Liquid repellent. Designed to zip over neck to above the chin to protect exposed neck areas. EN13034 for limited protection against liquid particles (Type 6). EN13982-1 (Type 5) for protection against solid particles. Covershoes and gloves supplied separately. • Neck Type Hooded • Fabric Weight 55g/m² • Type Coverall • Closure Type Zipper #wuhan #wuhancoronavirus #coronavirus #outbreak #virusoutbreak #beijing #kualalumpur #shanghai #tokyo #illness #protection #protectivesuit #personalprotection #facemask #disposable #gloves #bacteria #infection #disease #prevention
2231564478820960358; 2; False; 1580243237; #darkhumor #plaguedoctor #coronavirus
2231564439548130198; 1; False; 1580243233; Llega el coronavirus a españita. . . #ilustración #illustration #dibujo #drawings #draw #sketch #sketchbook #boceto #dooble #art #arte #antistyle #trash #ignorantstyle #stupidart #contenporaryart #arteurbano #absurdo #absurd #españa #paint #pixel #simpsons #thesimpsons #simpson #burns #coronavirus #china #bazar
2231564424680953532; 0; False; 1580243231; :play_button: SANIDAD. :blue_circle: Francia ha confirmado este martes el cuarto caso de coronavirus. El director general de salud, Jérôme Salomon, ha anunciado en una rueda de prensa que este último paciente es un turista chino de unos 80 años que provenía de la provincia de Hubei. El paciente está actualmente hospitalizado en cuidados intensivos en París. #actualidad #news #sociedad #salud#sanidad#coronavirus#el_soplon #el_soplon_
2231561229661776097; 2; False; 1580243230; Rise up my people, God loves you and wants to save you :folded_hands::revolving_hearts::victory_hand::globe_showing_Asia-Australia: #Riseup #Love #Kobe #Illuminati #NWO #Coronavirus #Fear #Tactical #Wakeup #America #USA #Loveistheonlycure #Healuswithlove #NewWorld #NewEarth #ChangeisNOW #Grammys #Vaccine #Vaccinate #Unite #Truth #Balance #Harmony
2231564370951945587; 0; False; 1580243224; Hep buralardamı takılırsın:beer_mug: . . . . . . . . . . . . . #muhabbet #muhabbetkusuuretimiankara #kesfetteyiz #kesfetden #korona #coronavirus #kakadu #macawbaby
2231564304625085189; 0; False; 1580243224; #GOODnews: To help those impacted by the #coronavirus in China, #cityCURRENTPartner, @FedEx :airplane: is working with humanitarian aid organizations to deploy supplies to address critical needs :package: including 17 pallets of humanitarian aid, 200K surgical :face_with_medical_mask: masks, millions of hospital gloves :gloves:, surgical gowns and more. You can help by donating money directly to Direct Relief, International Medical Corps or another relief organization of your choice. Learn more→ https://citycur.rent/FedExCares_CV :purple_heart: #FedExCares #powertheGOOD
2231564358076060113; 1; False; 1580243223; Saw this guy on the street, look like everything is under control #coronavirus J'ai vue ce mec dans la rue, apparemment tout est sous control #coronavirus Follow me at @deuxos #dessin #draw #drawing #character #characterdesign #h2o #reve #cookies #abonnezvous #monstre #art #fanart #black #blackandwhite #ink #pest #medecin #pestenoire #peste #dark #mood #jemettropdehashtag
2231564344058438878; 0; False; 1580243221; Tudo que você precisa saber sobre o coronavírus. Informações do Ministério da Saúde. #coronavirus #prevencao #medidas #saudepublica
2231564257053542511; 0; False; 1580243211; #coronavirus #Travelawareness #travelsecurity #taiwan: Air Macau cancels flights due to coronavirus. :Macau_SAR_China: #macau : Air Macau cancels flights due to coronavirus. :Myanmar_(Burma): #myanmar : Several airlines suspend flights from China due to coronavirus. :South_Korea: #southkorea : Airlines suspend flights to China due to coronavirus outbreak . BE AWARE: www.safeexpat.com
2231564224991887022; 0; False; 1580243207; This #coronavirus finna be litty boys! :fire::fire::fire::fire::fire::face_with_medical_mask::face_with_thermometer::fire::fire::fire::fire::fire:
2231564062109733018; 5; False; 1580243202; I swear to god when I first heard about this virus I was like...uhhhh CoRoNa ViRuS???:woozy_face::woozy_face: In all seriousness, be safe, keep yourself clean. This virus spreads fast so do everything you can to protect yourself please. ○ #votd #tiktok #westindian #caribbean #guyanese #instadaily #corona #coronavirus #comedy #toronto
2231563899388643909; 0; False; 1580243202; #CoronaVirus#. I hope u gais be carefully.
2231564161297894590; 41; False; 1580243199; Горячие новости :fire::fire::fire:по последним данным #коронавирус мутиров!!!:fearful_face::face_screaming_in_fear::exploding_head: и теперь он продолжает жить в человеке после смерти!!! Сообщается прямо из Китая. Государство всеми путя старается молчать об этом инциденте. По не которым источникам сообщается что #коронавирус #деградирует! Это означает тоько одно! #ЗомбиАпокалипсис настал!!!!! :folded_hands_medium-light_skin_tone::folded_hands_medium-light_skin_tone::folded_hands_medium-light_skin_tone: А вы что думаете об этом?:face_screaming_in_fear: #coronavirus
2231564046507177939; 0; False; 1580243186; Governo de Minas investiga suspeita de coronavírus em Belo Horizonte. Após desembarcar na capital mineira de uma viagem feita para a China, uma mulher de 22 anos apresentou os sintomas do coronavírus, a paciente foi atendida na última sexta-feira (24), hoje (28) a paciente já está bem, o caso foi tratado como suspeito da doença mas ainda não se pode afirmar nada. ⠀⠀⠀⠀⠀⠀⠀⠀⠀ ⠀⠀⠀⠀⠀⠀⠀⠀⠀ ⠀⠀⠀⠀⠀⠀⠀⠀⠀ #bh #coronavirus #belohorizonte #contagem #barreiro #ibirite #hospital #mgemregistro #minasgerais #mg #portaldenoticias
2231564042128123804; 0; False; 1580243185; :face_with_raised_eyebrow::face_with_raised_eyebrow::face_with_raised_eyebrow::loudly_crying_face::loudly_crying_face::face_with_tears_of_joy: ayeeee that’s that guy! #petty #comedy #rp #haha #lol #coronavirus #buckleup #meme #hadto #hiphop #rap #rapper #hiphopartist #auraaudioent #cincinnati #ohio
2231563977468093534; 0; False; 1580243178; Das neue Coronavirus 2019-nCoV sollte nicht unterschätzt werden. Solche Informationen werden wir jeden Tag hochladen. #corona #coronavirus #coronavirusmemes #coronavirusoutbreak #coronaviruses #corona:beer_mug: #coronaviruschina #coronavirusdeutschland
2231563979153524070; 3; False; 1580243178; Pussies all worried about the Corona virus... I've had the Jim Beam plague, Miller Lite virus, and three two flu I dont know how many times and I'm still alive. #PLS #pipelineshit #pipelinelegit #pipelinepipeline #pipeline #pipeliner #pipelinelife #pipelife #pipelinewelder #pipelineshit #rigwelder #weldingrig #weldnation #weldernation #coronavirus #millerlite #millertime #jimbeam
2231563965187918763; 0; False; 1580243176; Bud light #funnymemes #cringememes #dankmemes #lolsurprise #poppingmeme #coronavirus
2231563954717974073; 4; False; 1580243175; Sígueme @ijokervzla #auronplayedit #ijokervzla #auronmemes #auronplay #auron #coronavirus #memesespañol #memesauronplay #momos4k #momossad #memesenespañol #memes #memer #memez #videosgraciosos #video #videos #lol #jajaja #genial #cmamo #chicassexys #instagood #instagram #insta #chic #nomames #momos_4k
2231563924680451894; 1; False; 1580243171; Swab UTM com meio líquido para transporte de vírus. Entre em contato conosco. #coronavirus #influenzavirus #chlamydia #mycoplasma
2231563921599441334; 2; False; 1580243171; Contagion filmi için Wuhan'ın 1984'ü diyebilir miyiz...! #contagion #salgın #virüs #wuhan #coronavirus #movie #cinema #1984
2231563862688604737; 0; False; 1580243164; Today we attended the 3rd meeting, our time was devoted to a debate about the Virus in general because it is a sensitive topic,specially nowadays with the new virus or"coronavirus"... the question is: Are you with the fact that each country must protect itself and to not think about other countries problems OR that countries must be welded and help each other? Give us your opinion to discuss .:globe_showing_Europe-Africa: #lazarskiuni #coronavirus #management #lazarskiuniversity #lazarskimanagmentclub #savetheplanet
2231563800578154265; 0; False; 1580243156; How do feel about it? partner - @coronavirusez - #coronavirusrussia #coronavirus #corona #estonia #virus #hope #illness #coronaviruses #coronavirusoutbreak #coronaviruschina #likeforlikes #usa #germany #france #russia #thailand #finland #poland #share #help #stopcorona #stopcoronavirus #follow #fortnite #sad #new #news #daily #updates
2231563785177350320; 0; False; 1580243155; :police_car_light: El #AlmorsaderoDT te informa: ACTUALIDAD| Comunicado Oficial - Caso asociado a sospecha de #coronavirus en #Ecuador :Ecuador:
2231563294685154459; 0; False; 1580243152; #coronavirus #prankcall
2231563700744223167; 0; False; 1580243145; Trump 'Yüzyılın Anlaşması' diye ilhak izni çıkardı: Benim vizyonumun İsrail Devleti'nin parçası olarak gördüğü her toprak üzerinde İsrail egemenliğini, ABD tanıyacaktır. #coronavirus #gundem #gündem #siyaset #sondakika #siyasi #tsk #dışpolitika #politika #politics #haber #haberler #türkiye #ankara #istanbul #izmir #antalya #bursa #msb #denizli #vatan #anadolu #turksilahlikuvvetleri #trump #putin #abd #rusya #türkiye #iran #çin
2231562916478577422; 0; False; 1580243140; #coronavirus#news
2231563643795633766; 1; False; 1580243138; Some bullshit :unamused_face::face_with_tears_of_joy: #funnymemes #coronavirus #wish #lmao
2231563529096356186; 0; False; 1580243124; #gündem#gündemhaberleri#sondakika#sondakikahaberler#chine#coronavirus#corona#wuhan#wuhanchina#haber#hastane#aviationlovers740#jetlag740
2231563518721583699; 11; False; 1580243123; Coronavirus Chan! Too soon? Cree este maquillaje inspirado en el coronavirus, no me maten(?) Quería hacer algo más o menos oriental con mí estilo, así que busque los colores de la bacteria y mandé fruta(?)Me ayudarían muchísimo compartiendo!!! #makeup #coronavirus #beauty #creation #inspiredmakeup #cosplay #me #makeitviral #viral #puns
2231563499761437168; 0; False; 1580243121; ÖNCEKI POSTA LÜTFEN BAKINhttps://www.instagram.com/p/B74FLOGgYoi/?igshid=rmc5bhfpom5q Bundan sonra önceki posta bakınWuhan/china #coronavirus #coronatedavisi #coronavirus #coronaviruses #corona #china #çin #wuhan #coronatreatment #viruscorona #coronas #fenerbahçe #galatasaray #beşiktaş #fenerbahce #dünya#hasta #ateş #bulantı #uykusuzluk #hastane #tedavi #önlem Wuhan/china #coronavirus #coronatedavisi #coronavirus #coronaviruses #corona #china #çin #wuhan #coronatreatment #viruscorona #coronas #fenerbahçe #galatasaray #beşiktaş #fenerbahce #dünya#hasta #ateş #bulantı #uykusuzluk #hastanWuhan/china #coronavirus #coronatedavisi #coronavirus #coronaviruses #corona #china #çin #wuhan #coronatreatment #viruscorona #coronas #fenerbahçe #galatasaray #beşiktaş #fenerbahce #dünya#hasta #ateş #bulantı #uykusuzluk #hastane #tedavi #önlem Wuhan/china #coronavirus #coronatedavisi #coronavirus #coronaviruses #corona #china #çin #wuhan #coronatreatment #viruscorona #coronas #fenerbahçe #galatasaray #beşiktaş #fenerbahce #dünya#hasta #ateş #bulantı #uykusuzluk #hastan
2231563474790506937; 5; False; 1580243118; Querem nos fazer acreditar que o SUS é uma :pile_of_poo: e que não funciona, mas mesmo sucateado, ele resiste! Vigilância epidemiológica é SUS! E a hora que o Corona vírus se espalhar pelo Brasil, quem vai segurar as pontas? É o SUS! E quem estuda sobre os vírus, seus mecanismos de transmissão, gravidade, formas de tratamento e vacinas? Os maconh...oooops, os pesquisadores das universidades públicas: alunos de mestrado, doutorado e pós doutorado, que trabalham para que o povo tenha condições melhores de saúde. Precisamos valorizar essas coisas e agradecer! #nutricionistajulianacrucinsky #nutricaoclinica #saudecoletiva #vigilanciaepidemiologica #anvisa #sus #saudeedireitodetodos #saudeedeverdoestado #coronavirus
2231563474704917949; 5; False; 1580243118; China :China: :red_heart: 加油武汉 :flexed_biceps:， 加油中国 :flexed_biceps: #coronavirus #coronavirusoutbreak #china:China: #shanghai #jingantemple
2231563469461779271; 0; False; 1580243117; #Coronavirus is a family of #Viruses that can cause a range of #Illnesses in Humans including #CommonCold and more severe forms like #SARS (Severe Acute Respiratory Syndrome) and #MERS (Middle East Respiratory Syndrome) which are life-threatening. The ##Virus is named after its shape which takes the form of a #Crown :crown: with protrusions around it and hence is known as #Coronavirus #ViralInfection #CoronaVirus #FatalDisease #Doctor #Medicine #Surgeon #RespiratoryInfection #Antiviral
2231563103484869145; 0; False; 1580243108; Tres estudiantes dominicanos residentes en la ciudad de Wuhan, China, la cual se encuentra totalmente cerrada en cuarentena debido a que fue donde se originó el coronavirus, dicen estar esperanzados de que serán sacados de China por el Gobierno dominicano. Melissa Santos, Misael Soriano y Jessica Santos, afirman que la embajada dominicana en el país asiático les ha dicho que realiza la logística para repatriarlo a Santo Domingo. Según declaraciones recientes del embajador dominicano en la República Popular China, Briunny Garabito, en el gigante asiático hay alrededor de 80 dominicanos, la mayoría estudiantes que lograron ir a ese país tras los acuerdos entre ambas naciones. . Que opinas de esto? . Video: fuente externa Regram @diariolibre #DL #DiarioLibre #Actualidad #Coronavirus #DominicanosenChina #DominicanosenWuhan #Wuhan
2231563340646665663; 0; False; 1580243102; #coronavirus #china #who #worldhealthorganization #unitednations #un #publicinterest #globalhealth #prevention
2231563313132948486; 0; False; 1580243098; Les traigo una ilu que tuve que hacer según el tema que nos dieron en una clase de fanbu:heart_suit: El tema era: el año nuevo chino(ratón) con el coronavirus. Espero les guste! . . . . . #coronavirus #añonuevochino #raton #cutegirl #kawaii#dibujos #drawing #drawthisinyourstyle #academiafanbu #illustration #ilustracionchilena #dibujotradicional #marcadores #sharpie #sharpieart #traditionalart #animedrawing
2231563278984138339; 48; False; 1580243094; Si te gustan los Remedios CASEROS, Trucos de BELLEZA y mas, síguenos:backhand_index_pointing_right_medium-light_skin_tone: @lomejorensalud_ No olvides dejarnos un saludo para saber que te llegan mis Consejos. @lomejorensalud_ :backhand_index_pointing_left:
2231562099226726172; 0; False; 1580243092; @djiglobal @exploreindonesia ⠀⠀⠀⠀⠀⠀ ⠀⠀⠀⠀⠀⠀ ⠀⠀⠀⠀⠀⠀ ⠀⠀⠀⠀⠀⠀ ⠀⠀⠀⠀⠀⠀ ⠀⠀⠀⠀⠀⠀ ⠀⠀⠀⠀⠀⠀ ⠀⠀⠀⠀⠀⠀ #bromo #volcano #dji #spark #nature #java #indonesia #travel #travelgram #instatravel #instanature #voyage #video #trekking #mountain #coronavirus #tourdumonde #asia #mavic #gopro #bali #balilife #boy #voyageur #backpacker #l4l
2231563227711246396; 0; False; 1580243088; Öldürücü corona virüsü Almanya’ya ulaştı Haberin detayları:turizmavrupa.com #Almanya #coronavirus #dunyanews #virus
2231563217996370866; 0; False; 1580243087; Huh :panda_face: . . . #coronavirus #coronavirusmemes #coronavirusoutbreak #kungfupanda #kungfupandamemes #tailung #kfp #kfpmemes #memes #po #masterpo
2231552631707803264; 0; False; 1580243083; I THINK THIS VIRUS IS POWERFUL THAN EBOLA #coronavirus
2231563179291479845; 0; False; 1580243082; #edgymemes #litmemes #coronavirus #yes #excellent #dankmemes
2231562639509823860; 19; False; 1580243075; What is Coronavirus? All you need to know about symptoms and risks. #ARYNews #ARYNewsInsta #ARYInsta #Coronavirus #Corona #Health #China #Virus
2231563103635967794; 0; False; 1580243073; En el combate que se lleva minuto a minuto contra el actual Coronavirus que se propaga en la región de Wuhan, China, se está realizando la construcción de un nuevo hospital de 25.000 m² en un plazo de tan solo 10 días. Este hecho representa una obra de ingeniería a gran escala que ya tiene un precedente en Beijing (2003), construido para lidiar con los infectados del SARS. El sistema se basa en bloques prefabricados y en un altísimo poder de ingeniería, característico del país que posee la empresa constructora #1 del mundo :building_construction: Mención aparte para los operarios e ingenieros que arriesgan su vida de forma constante, al trabajar su jornada en la zona neurálgica de la epidemia. Son sometidos a controles de temperatura en forma permanente y deben rendir al máximo con dicho peso sobre sus espaldas, tanto por ellos mismos como por sus familias :man_mechanic: #Coronavirus #Wuhan #Construcción #Ingeniería
2231563078780351420; 0; False; 1580243070; Esclareça suas dúvidas sobre o coronavírus :thinking_face::thinking_face: . Quais os sintomas? Dentre os possíveis sintomas estão febre, dor, dificuldade para respirar, tosse, diarreia e pneumonia. . Onde surgiu? . Na cidade de Wuhan, na província de Hubei, na China. A metrópole de 11 milhões de habitantes está isolada. Trens e voos foram interrompidos e detectores de febre foram instalados nas estações de embarque e no aeroporto. Nas estradas, a temperatura corporal é medida pelos postos de controle e, para sair da cidade, o transporte não pode ser feito de carro. Para evitar qualquer concentração de pessoas, as autoridades anularam as comemorações do Ano-Novo Lunar chinês na cidade. As autoridades também proibiram qualquer espetáculo e fecharam um museu. Como surgiu? . O Centro para Vigilância e Prevenção de Doenças (CDC), equivalente dos Estados Unidos à Anvisa, identifica um grande mercado atacadista de peixes e frutos do mar na cidade de Wuhan como a origem das infecções. Como ele é transmitido? De animal para pessoa e de pessoa para pessoa. Segundo o governo chinês, o vírus pode se modificar e ser transmitido mais facilmente. Conforme o CDC, pessoas mais velhas parecem ter maior risco. . Como é o tratamento? . Não há tratamento contra o coronavírus em si, apenas contra os sintomas. Pacientes tomam remédio para baixar a febre e podem receber máscara de oxigênio para respirar melhor, por exemplo. . Quais os cuidados? Lavar as mãos (sobretudo quem passar por aeroportos), evitar contato dos dedos com mucosas do nariz, olhos e boca. É recomendável usar álcool em gel. . A vacina contra a gripe protege? . Não. Segundo Alexandre Zavascki, chefe da Infectologia do Hospital Moinhos de Vento e professor da Universidade Federal do Rio Grande do Sul (UFRGS), o vírus da gripe não é o coronavírus, e sim o influenza. Portanto, a vacina regular tomada antes do inverno não protege. #sejasociosinthoress #juntossomosmaisfortes #sinthoress #santos #guaruja #saovicente #praiagrande #bertioga #registro #peruibe #valedoribeira #baixadasantista #coronavirus #bemestar #saude #medicina
2231563065946700847; 1; False; 1580243069; :exclamation_mark::exclamation_mark::exclamation_mark::exclamation_mark::exclamation_mark::exclamation_mark::exclamation_mark::exclamation_mark::exclamation_mark::exclamation_mark::exclamation_mark::exclamation_mark::exclamation_mark::exclamation_mark::exclamation_mark::exclamation_mark::right_arrow: @coronavirusoffiziell :left_arrow: Подпишись и будь в курсе всех новостей о коронавирусе :police_car_light: Subscribe and stay informed #pray #prayer #nature #indonesia #sydney #carlinhosmaia #bbb20 #anitta #bts #justinbieber #newyork #prayforrevival #prayforhealing #hope #Jesus #life #viruscorona #love #помощь #coronavirus #коронавирус #вирус #virus #china #china:China: #ухань #китай #bbc #news #новости
2231563026411454282; 1; False; 1580243064; Veja a matéria completa acessando: http://portalsaudeagora.com.br ⠀ #portalsaudeagora #noticiasaude #saude #medicina #portalsaude #medicina #nutrição #noticias #noticias #tudosobre #followme #instagood #like4like #follow #coronavirus #japao
2231562938891213574; 0; False; 1580243054; #coronavirus
2231562849017113521; 3; False; 1580243054; :Turkey:Deprem etkisiyle bir yol çöktü. :European_Union:The road collapsed due to the earthquake. #clinicalnews #coronavirus #virusoutbreak #corona #health #nursing #nurse #wuhan2020 #wuhanvirus #coronaoutbreak #who #china #doctor #hospital #european #europe #crisis #lastnews #cdc #coronavirus #wuhan2020 #outbreak #usa #earthquake #jamaica #deprem #jamaicaearthquake
2231562470154251196; 0; False; 1580243053; #coronavirus
2231562865893324925; 1; False; 1580243045; Los efectos de la pandemia llegan a la isla. #puertorico #corona #coronavirus
2231562835669286251; 1; False; 1580243041; New corona virus is pandemic now. Please keep hydrated and wash hands and gargle after coming home. Left photo is social med protocol which I created when I was 2nd year for targeting children. #medical #medicine #pikachu #pokemon #japan #japanese #coronavirus #bulgaria #surgeon #surgery #fightagainstcoronavirus
2231562772563288202; 0; False; 1580243034; #DailyNotable #EnglishNewsPaper Wednesday, 29, January, 2020 #News #LCCI #CoronaVirus #ForInformationAndQueries #Notable #EditorInChief #DrATTAULWADOOD dailynotable@gmail.com Contact +923451439999 www.thedailynotable.com
2231562762847529194; 0; False; 1580243033; Brasil investiga um caso suspeito de coronavírus, e ministério sobe nível de alerta ⠀ O Ministério da Saúde informou nesta terça-feira (28) que investiga um caso suspeito de coronavírus no país. O caso é de uma estudante de 22 anos atendida em Belo Horizonte e que viajou para a cidade de Wuhan, na China, epicentro da doença. Nível passa de 1 a 2, entre três possíveis, o que indica risco iminente do vírus chegar ao Brasil. ⠀ #Saude #Alerta #Coronavirus #Medicina
2231562701587824596; 2; False; 1580243025; Bebé no te me vayas a morir de coronavirus :'v . . . . . . . #ｙａｏｉ . . . . . . . . :cross_mark: [ Ignore this ] :cross_mark: #yaoi7u7 #yaoiships #yaoi #bananafish #eijixash #eijiokumura #ashlinx #gay #boyxboy #fanart #fanartyaois #memesyaoi #manhwa #manga #yaoi͎edits #sadyaoi #mysouliswithyou #yaoiboy #coronavirus #7n7 #7w7 #7w7r #7u7r
2231562692905225309; 0; False; 1580243024; #coronavirus #cina #epidemia #wuhan #wuhanchina #panico #skytg24 #tgcom24 #viruscinese #virus #pandemia #febbrecinese #annodeltopo #grossoguaioachinatown #propagandalive #propagandatop #striscialanotizia
2231562593844143624; 0; False; 1580243013; :face_with_tears_of_joy::face_with_tears_of_joy::face_with_tears_of_joy: #Repost @sole.whisky (@get_repost) ・・・ Questi professoroni di stirpe ci danno il loro parere :face_with_tears_of_joy::bomb::collision: #aldogiovanniegiacomo #professoroni #coronavirus #solewhiskyeseiinpoleposition #poleposition #italiancomedy #cinemacult #cinema #esportiamolapoleposition #anni80 #anni90 #funnymemes #commediaitaliana #italianmovie #risate #instaflicks #instagood #moviestar #goodmovie #memeita #followme #tagsforlikes #photooftheday #80s #90s #italia #film #comico #commedia
2231562544619126355; 0; False; 1580243007; OC: facts fuck NH:moai: - - - #coronavirus #meme #oc #memes #fuck #newhampshire #corona #nah #modelotime #cringe #normiememes #darn
2231562411700401199; 11; False; 1580243003; Wuhan residents are trying to break out of the quarantine zone right now #coronavirus #china #virus #wuhan #sars #epidemic #2019nCo
2231562505157931306; 0; False; 1580243002; ••blog alert•• Vandaag een blog over het coronavirus • • • #coronavirus #blog #makkelijk #uitleg #roze #heftig #populair #frankrijk #duitsland #oostenrijk #europa #heeldewereld #tulpen #bollenstreek #nikon #groen #ziekenhuis #china #wuhan #emoties
2231562426390045353; 1; False; 1580242998; #lol #lmfao #lmao #hilariousmemes #hilarious #omg #coronavirusmemes #coronavirus #followforfollowback #rofl #followmeplease #meme #memes #dankmemes #china
2231562348536187108; 0; False; 1580242983; #Repost @bluespots_productions with @make_repost ・・・ "Sooo, everyone is sick?" Augsburg | München | Sakhalin . Fernprobe fürs @brechtfestival . Danke @zamgwuerfelt für den Raum! . . . #freieszene #brechtFestival #erkältung #coronavirus #nurelisabethistfit #nodancing #actorslife #cold #ichmachjetztauchdiesepunktesache #aberfalsch #daslebenistkeinriesenrad
2231562186021640450; 0; False; 1580242974; Makyaj temizleme kuşu :blue_heart: . . . . . . . . . . . . . . . . . #budgerigars #makeup #makyajvideoları #muhabbet #muhabbetkusuegitimi #kesfetteyiz #birdslover #corona #coronavirus
2231562191289547761; 28; False; 1580242965; Bu ne hızdır. Daha fazlası için lütfen bizi takip edin:high_voltage:
2231548164681859614; 104; False; 1580241323; Je suis triste ça va se faire sans Paris ? :loudly_crying_face: _____________ #bts2020 #kpopfrance #btsmemes #btsmeme #btsworldtour #btsparis #btsparis2020 #actukpop_scandale #actukpop_classement #actukpop_concert #kpopmemes #kpopmeme #bangtanboys #comedie #coréedusud #coréen #coreedusud #coronavirus #anysongchallenge #korea #actukpop_bts #koreanboy #jimin #btsedits #btsconcert #btsconcertparis
2231514934235508473; 1; False; 1580237335; None
2229236634363741326; 5; False; 1579965891; ‪Les gens qui vont recevoir leurs colis d’AliExpress et de wish :police_car_light::warning::fire::airplane::shopping_cart::wrapped_gift::package::open_mailbox_with_raised_flag::wastebasket: #Aliexpress #WISH #joom #China #CORONAVIRUSFRANCE #ChinesePneumonia #chine :China::China::China:@AliExpressFr @AliExpressES @MinSoliSante ‬ :red_envelope::red_envelope::red_envelope::red_paper_lantern::red_paper_lantern::red_paper_lantern::Japanese_dolls::Japanese_dolls::Japanese_dolls::carp_streamer::carp_streamer::carp_streamer::soap::potable_water::toilet::test_tube::thermometer::syringe::dna::microbe::petri_dish::pill::microscope: #airfrance #coronavirus #greve28janvier #klm #ChinesePneumonia #chine #TPMP #orly #Aéroport #Aliexpress #Turquie #BFMTV #Twitter @cyrilhanouna @tpmptv #virus
2219022302390435672; 4; False; 1578748184; Dasar tikus :face_with_tears_of_joy: :headphone: . . Full version yt link di bio @shaggydogjogja @indomusikgram #ambyar #disayidan #reggae #lagiviral #perang #shaggydog #serang #coverlagu #musikindonesia #baper #likeforlikes #followforfollowback #lll #fff #marionjola #cina #china #coronavirus #viruscorona
1955317200476591731; 2; False; 1547312105; #corona #measlesoutbreak #ebola BankBars:collision::eye::OK_hand_medium-dark_skin_tone::fire::fire::fire::fire::fire::fire::fire: #vaccine hoax 333me.life #kobebryantdied in helicopter on #kobebryantcartoon in 2016 also:man_shrugging_medium-dark_skin_tone::thinking_face: orwell edwardsnowden #billgates #patent #viral #coronavirus #iran #china NSA #theylive #pedoelitist #epsteindidntkillhimself #orlandobrown #westworld #harveyweinstein #elsagate #oprah personofinterest #theylive humanity plauge trending #kobebryantconspiracy #metzizahbpeh #pizzagate #pedophilialegalizationmustbestopped rickygervaise behindthescenes #adrenochrome #lebronjames #humantraffickingawareness #organharvesting 333me.life now since they cancelled my Youtube like they cancelled #issackappy Good job every1 ,I feel so good that I'm dedicating my entire life into Channeling divEYEness, even tho the algorithm suppresses my content:eye::OK_hand_medium-dark_skin_tone:w3 ar3 th3 saviors-take care+stay aware. 333me.life (Not a rapper but still snappin better than yo fav battle
1937635261594506720; 0; False; 1545204144; #kobebryantdied in helicopter on #kobebryantcartoon in 2016 also:man_shrugging_medium-dark_skin_tone::thinking_face: #orwell #edwardsnowden #billgates #patent #viral #coronavirus #iran #china NSA #theylive #pedoelitist #epsteindidntkillhimself #orlandobrown #westworld #harveyweinstein #elsagate #oprah personofinterest #theylive #vacinnes humanity #plauge trending #kobebryantconspiracy #metzizahbpeh #pizzagate #pedophilialegalizationmustbestopped #rickygervaise behindthescenes #adrenochrome #lebronjames #humantraffickingawareness #organharvesting 333me.life now since they cancelled my Youtube like they cancelled #issackappy Good job every1 ,I feel so good that I'm dedicating my entire life into Channeling divEYEness, even tho the algorithm suppresses my content:eye::OK_hand_medium-dark_skin_tone:w3 ar3 th3 saviors-take care+stay aware. 333me.life
1934458605208063169; 0; False; 1544826224; #kobebryantdied in helicopter on #kobebryantcartoon in 2016 also:man_shrugging_medium-dark_skin_tone::thinking_face: #orwell #edwardsnowden #billgates #patent #viral #coronavirus #iran #china NSA #theylive #pedoelitist #epsteindidntkillhimself #orlandobrown #westworld #harveyweinstein #elsagate #oprah personofinterest #theylive #vacinnes humanity #plauge trending #kobebryantconspiracy #metzizahbpeh #pizzagate #pedophilialegalizationmustbestopped #rickygervaise behindthescenes #adrenochrome #lebronjames #humantraffickingawareness #organharvesting 333me.life now since they cancelled my Youtube like they cancelled #issackappy Good job every1 ,I feel so good that I'm dedicating my entire life into Channeling divEYEness, even tho the algorithm suppresses my content:eye::OK_hand_medium-dark_skin_tone:w3 ar3 th3 saviors-take care+stay aware. 333me.life
1934439613609093673; 0; False; 1544823193; 333me.life #kobebryantdied in helicopter on #kobebryantcartoon in 2016 also:man_shrugging_medium-dark_skin_tone::thinking_face: #orwell #edwardsnowden #billgates #patent #viral #coronavirus #iran #china NSA #theylive #pedoelitist #epsteindidntkillhimself #orlandobrown #westworld #harveyweinstein #elsagate #oprah personofinterest #theylive #vacinnes humanity #plauge trending #kobebryantconspiracy #metzizahbpeh #pizzagate #pedophilialegalizationmustbestopped #rickygervaise behindthescenes #adrenochrome #lebronjames #humantraffickingawareness #organharvesting 333me.life now since they cancelled my Youtube like they cancelled #issackappy Good job every1 ,I feel so good that I'm dedicating my entire life into Channeling divEYEness, even tho the algorithm suppresses my content:eye::OK_hand_medium-dark_skin_tone:w3 ar3 th3 saviors-take care+stay aware. 333me.life